F458564

General Info

Members Datasets Scaffolds Average Seq Length
520 254 1040 254

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0045078|Ga0395899_0045078_1006_1866
Length 286
Sequence VALHWHCKQNIGNLLILICSPVEIKEKQIMLAKRIIPCLDIKNGRTVKGINFENIRDAGDPVELAVYYSQKGADELVFLDITATVEKRKTLVELVKKIAANINIPFTVGGGISSVENAFELLQNGADKISINTAAFKNPEIVHLMAKEFGSQCVVLAIDTKKESDGNWYVYLNGGRSKTETLAYDWGKQAIDLGAGEILLTSMNNDGTKDGFAEDITSVFAKTFSVPVIASGGAGTMKHFAQVFTNANADAALAASVFHFGEIKITELKRFLAEQNINVRISKNII

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
209 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
210 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
215 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
220 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
238 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
243 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
244 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
245 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
246 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
247 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
248 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
249 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
250 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
251 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
252 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
253 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
254 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 0.96
Rhizosphere 85.38
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0045078 3300037312 Bacteria 3285
2 JGI24740J21852_10001160 3300001979 Bacteria 11892
3 JGI24739J22299_10001962 3300001989 Bacteria 7876
4 JGI24739J22299_10057839 3300001989 Bacteria 1233
5 JGI24751J29686_10005884 3300002459 Bacteria 2500
6 JGI25154J39366_1000040 3300002738 Bacteria 147410
7 JGI25157J39369_1002238 3300002741 Bacteria 5236
8 JGI25153J46596_10003586 3300003215 Bacteria 8623
9 JGI25153J46596_10015747 3300003215 Bacteria 3062
10 rootH2_10019144 3300003320 Bacteria 8706
11 rootL2_10043559 3300003322 Bacteria 4472
12 rootL2_10061634 3300003322 Bacteria 2147
13 rootL2_10094219 3300003322 Bacteria 1842
14 rootL2_10128071 3300003322 Bacteria 1259
15 JGI25160J50197_1003836 3300003354 Bacteria 6603
16 JGI25160J50197_1004305 3300003354 Bacteria 6168
17 JGI25160J50197_1013033 3300003354 Bacteria 2854
18 Ga0055542_1002855 3300003762 Bacteria 5146
19 Ga0055526_1030323 3300003771 Bacteria 1581
20 Ga0055536_1000001 3300003781 Bacteria 630663
21 Ga0055528_1001650 3300003790 Bacteria 13115
22 Ga0055530_10000387 3300003791 Bacteria 39558
23 Ga0055530_10007773 3300003791 Bacteria 4440
24 Ga0055531_10000131 3300003794 Bacteria 85257
25 Ga0065165_1000102 3300005262 Bacteria 140917
26 Ga0065714_10076696 3300005288 Unclassified 2763
27 Ga0065704_10073452 3300005289 Bacteria 7136
28 Ga0065712_10078473 3300005290 Bacteria 3329
29 Ga0065712_10236137 3300005290 Bacteria 997
30 Ga0065715_10123377 3300005293 Bacteria 2179
31 Ga0065715_10332155 3300005293 Unclassified 982
32 Ga0065707_10101368 3300005295 Bacteria 2869
33 Ga0070658_10025309 3300005327 Bacteria 4759
34 Ga0070658_10046100 3300005327 Bacteria 3527
35 Ga0070658_10308952 3300005327 Bacteria 1349
36 Ga0070676_10009041 3300005328 Bacteria 5390
37 Ga0070676_10141507 3300005328 Bacteria 1532
38 Ga0070683_100094838 3300005329 Bacteria 2804
39 Ga0070683_100517685 3300005329 Bacteria 1140
40 Ga0070670_100038532 3300005331 Bacteria 4111
41 Ga0070670_100057642 3300005331 Bacteria 3334
42 Ga0070670_100077103 3300005331 Unclassified 2864
43 Ga0070670_100195051 3300005331 Bacteria 1759
44 Ga0070670_100361469 3300005331 Unclassified 1276
45 Ga0068869_100092612 3300005334 Unclassified 2275
46 Ga0068869_100132793 3300005334 Bacteria 1915
47 Ga0070666_10123756 3300005335 Bacteria 1794
48 Ga0070666_10139449 3300005335 Bacteria 1689
49 Ga0070680_100395581 3300005336 Bacteria 1177
50 Ga0070682_100078889 3300005337 Bacteria 2125
51 Ga0070682_100124847 3300005337 Bacteria 1733
52 Ga0068868_100063845 3300005338 Bacteria 2922
53 Ga0068868_100090411 3300005338 Bacteria 2465
54 Ga0070660_100035082 3300005339 Bacteria 3795
55 Ga0070660_100352538 3300005339 Bacteria 1212
56 Ga0070689_100001732 3300005340 Bacteria 13951
57 Ga0070689_100020307 3300005340 Bacteria 4927
58 Ga0070689_100027105 3300005340 Bacteria 4318
59 Ga0070691_10016462 3300005341 Bacteria 3396
60 Ga0070687_100131555 3300005343 Bacteria 1445
61 Ga0070687_100445055 3300005343 Bacteria 860
62 Ga0070692_10158811 3300005345 Bacteria 1294
63 Ga0070668_100051874 3300005347 Bacteria 3161
64 Ga0070669_100004024 3300005353 Bacteria 10630
65 Ga0070669_100014373 3300005353 Bacteria 5633
66 Ga0070669_100233864 3300005353 Bacteria 1457
67 Ga0070675_100009839 3300005354 Bacteria 7452
68 Ga0070675_100071275 3300005354 Bacteria 2882
69 Ga0070675_100254133 3300005354 Unclassified 1539
70 Ga0070675_100326455 3300005354 Bacteria 1356
71 Ga0070675_100344876 3300005354 Bacteria 1320
72 Ga0070675_100552947 3300005354 Bacteria 1041
73 Ga0070671_100004803 3300005355 Bacteria 10743
74 Ga0070674_100227024 3300005356 Bacteria 1455
75 Ga0070673_100016781 3300005364 Bacteria 5189
76 Ga0070673_100484598 3300005364 Bacteria 1117
77 Ga0070688_100001700 3300005365 Bacteria 10987
78 Ga0070688_100010471 3300005365 Bacteria 5114
79 Ga0070659_100006368 3300005366 Bacteria 8525
80 Ga0070659_100013097 3300005366 Bacteria 6168
81 Ga0070659_100231832 3300005366 Bacteria 1526
82 Ga0070667_100058354 3300005367 Bacteria 3263
83 Ga0070663_100210389 3300005455 Bacteria 1522
84 Ga0070678_100009260 3300005456 Bacteria 5954
85 Ga0070678_100272443 3300005456 Bacteria 1428
86 Ga0070662_100016239 3300005457 Bacteria 4996
87 Ga0070662_100033380 3300005457 Bacteria 3623
88 Ga0070662_100049451 3300005457 Bacteria 3031
89 Ga0070681_10029313 3300005458 Bacteria 5526
90 Ga0070681_10095109 3300005458 Bacteria 2928
91 Ga0070681_10153223 3300005458 Bacteria 2231
92 Ga0068867_100098891 3300005459 Bacteria 2225
93 Ga0068867_100173527 3300005459 Bacteria 1709
94 Ga0068867_100285719 3300005459 Unclassified 1354
95 Ga0070685_10013492 3300005466 Bacteria 4310
96 Ga0070685_10041907 3300005466 Bacteria 2610
97 Ga0070679_100000634 3300005530 Bacteria 29900
98 Ga0070679_100006277 3300005530 Bacteria 11066
99 Ga0070679_100044014 3300005530 Bacteria 4446
100 Ga0070679_100057825 3300005530 Bacteria 3865
101 Ga0070679_100274952 3300005530 Bacteria 1638
102 Ga0070679_100294055 3300005530 Bacteria 1575
103 Ga0070684_100103964 3300005535 Bacteria 2541
104 Ga0070684_100739082 3300005535 Bacteria 918
105 Ga0068853_100013393 3300005539 Bacteria 6695
106 Ga0068853_100034498 3300005539 Bacteria 4295
107 Ga0068853_100089780 3300005539 Bacteria 2699
108 Ga0070686_100192292 3300005544 Bacteria 1457
109 Ga0070693_100393286 3300005547 Bacteria 959
110 Ga0070665_100045521 3300005548 Bacteria 4406
111 Ga0068855_100000346 3300005563 Bacteria 57719
112 Ga0068855_100135189 3300005563 Bacteria 2813
113 Ga0068855_100285200 3300005563 Bacteria 1832
114 Ga0068855_100294159 3300005563 Bacteria 1800
115 Ga0068855_100842014 3300005563 Bacteria 972
116 Ga0070664_100531993 3300005564 Unclassified 1086
117 Ga0068857_100043308 3300005577 Bacteria 3993
118 Ga0068857_100392933 3300005577 Bacteria 1290
119 Ga0068854_100062265 3300005578 Bacteria 2704
120 Ga0068856_100015577 3300005614 Bacteria 7350
121 Ga0068856_100022699 3300005614 Bacteria 6101
122 Ga0068856_100144992 3300005614 Bacteria 2382
123 Ga0068856_100463536 3300005614 Bacteria 1288
124 Ga0068852_100002479 3300005616 Bacteria 12715
125 Ga0068852_100147483 3300005616 Bacteria 2184
126 Ga0068852_100475034 3300005616 Bacteria 1241
127 Ga0068859_100002554 3300005617 Bacteria 18479
128 Ga0068859_100020542 3300005617 Bacteria 6627
129 Ga0068859_100026609 3300005617 Bacteria 5801
130 Ga0068859_100060222 3300005617 Bacteria 3825
131 Ga0068859_100241280 3300005617 Unclassified 1896
132 Ga0068859_100616612 3300005617 Unclassified 1178
133 Ga0068859_100955451 3300005617 Bacteria 940
134 Ga0068864_100100923 3300005618 Bacteria 2559
135 Ga0068864_100565114 3300005618 Bacteria 1101
136 Ga0068861_100017109 3300005719 Bacteria 5140
137 Ga0068861_100113637 3300005719 Bacteria 2173
138 Ga0068870_10008005 3300005840 Bacteria 4734
139 Ga0068870_10025380 3300005840 Bacteria 2941
140 Ga0068870_10089758 3300005840 Bacteria 1716
141 Ga0068863_100050027 3300005841 Bacteria 3963
142 Ga0068863_100132990 3300005841 Bacteria 2375
143 Ga0068863_100185179 3300005841 Bacteria 2000
144 Ga0068858_100023494 3300005842 Bacteria 5743
145 Ga0068860_100001316 3300005843 Bacteria 26971
146 Ga0068862_100021684 3300005844 Bacteria 5372
147 Ga0081539_10087560 3300005985 Bacteria 1617
148 Ga0070715_10106742 3300006163 Bacteria 1315
149 Ga0097621_100003432 3300006237 Bacteria 10914
150 Ga0097621_100006701 3300006237 Bacteria 8186
151 Ga0097621_100046576 3300006237 Bacteria 3509
152 Ga0068871_100000027 3300006358 Bacteria 78588
153 Ga0068871_100186014 3300006358 Bacteria 1787
154 Ga0075428_100110387 3300006844 Bacteria 2996
155 Ga0075430_100009529 3300006846 Bacteria 8210
156 Ga0075430_100334219 3300006846 Bacteria 1252
157 Ga0075431_100004434 3300006847 Bacteria 13760
158 Ga0075431_100009374 3300006847 Bacteria 9827
159 Ga0075431_100489372 3300006847 Bacteria 1222
160 Ga0075434_100270003 3300006871 Unclassified 1720
161 Ga0075429_100002808 3300006880 Bacteria 14737
162 Ga0075429_100079015 3300006880 Bacteria 2868
163 Ga0068865_100004608 3300006881 Bacteria 8323
164 Ga0097620_100002554 3300006931 Bacteria 18479
165 Ga0097620_100020542 3300006931 Bacteria 6627
166 Ga0097620_100026608 3300006931 Bacteria 5801
167 Ga0097620_100060222 3300006931 Bacteria 3825
168 Ga0097620_100241283 3300006931 Unclassified 1896
169 Ga0097620_100616591 3300006931 Unclassified 1178
170 Ga0097620_100955760 3300006931 Bacteria 940
171 Ga0105251_10040875 3300009011 Bacteria 2260
172 Ga0105240_10168623 3300009093 Bacteria 2595
173 Ga0105240_10271228 3300009093 Bacteria 1953
174 Ga0111539_10005620 3300009094 Bacteria 16217
175 Ga0105245_10155295 3300009098 Bacteria 2167
176 Ga0105247_10003977 3300009101 Bacteria 9513
177 Ga0114129_10158299 3300009147 Bacteria 3096
178 Ga0114129_10825644 3300009147 Bacteria 1180
179 Ga0105241_10012333 3300009174 Bacteria 6268
180 Ga0105241_10243142 3300009174 Bacteria 1522
181 Ga0105241_10527305 3300009174 Bacteria 1057
182 Ga0105242_10002149 3300009176 Bacteria 15569
183 Ga0105242_10051880 3300009176 Unclassified 3344
184 Ga0105242_10294229 3300009176 Bacteria 1480
185 Ga0105248_10015617 3300009177 Bacteria 8370
186 Ga0105237_10028409 3300009545 Bacteria 5697
187 Ga0105237_10123599 3300009545 Bacteria 2582
188 Ga0105249_10002281 3300009553 Bacteria 16658
189 Ga0105249_10005103 3300009553 Bacteria 11318
190 Ga0105249_10012672 3300009553 Bacteria 7436
191 Ga0105249_10019729 3300009553 Bacteria 6019
192 Ga0105249_10037570 3300009553 Bacteria 4395
193 Ga0105249_10114467 3300009553 Bacteria 2554
194 Ga0105249_11096180 3300009553 Bacteria 866
195 Ga0105239_10000048 3300010375 Bacteria 177855
196 Ga0105239_10042529 3300010375 Bacteria 4979
197 Ga0105239_10464624 3300010375 Bacteria 1437
198 Ga0105239_10690712 3300010375 Bacteria 1167
199 Ga0105246_10091998 3300011119 Bacteria 2188
200 Ga0157373_10009404 3300013100 Bacteria 7217
201 Ga0157373_10013034 3300013100 Bacteria 6101
202 Ga0157373_10019401 3300013100 Bacteria 4948
203 Ga0157373_10231345 3300013100 Bacteria 1305
204 Ga0157373_10273805 3300013100 Bacteria 1195
205 Ga0157371_10000563 3300013102 Bacteria 43940
206 Ga0157371_10001497 3300013102 Bacteria 24172
207 Ga0157371_10003112 3300013102 Bacteria 15343
208 Ga0157371_10004118 3300013102 Bacteria 12831
209 Ga0157371_10040438 3300013102 Bacteria 3330
210 Ga0157371_10056505 3300013102 Bacteria 2784
211 Ga0157371_10122245 3300013102 Bacteria 1851
212 Ga0157371_10180407 3300013102 Bacteria 1510
213 Ga0157370_10000500 3300013104 Bacteria 48866
214 Ga0157370_10001022 3300013104 Bacteria 35238
215 Ga0157370_10112683 3300013104 Bacteria 2542
216 Ga0157370_10188162 3300013104 Bacteria 1916
217 Ga0157370_10430218 3300013104 Bacteria 1214
218 Ga0157370_10481267 3300013104 Bacteria 1141
219 Ga0157369_10050640 3300013105 Bacteria 4496
220 Ga0157369_10148579 3300013105 Bacteria 2477
221 Ga0157369_10264436 3300013105 Bacteria 1794
222 Ga0157369_10314583 3300013105 Bacteria 1628
223 Ga0157374_10000001 3300013296 Bacteria 1077351
224 Ga0157374_10010040 3300013296 Bacteria 8128
225 Ga0157378_10008736 3300013297 Bacteria 8819
226 Ga0157378_10103270 3300013297 Bacteria 2604
227 Ga0163162_10005326 3300013306 Bacteria 12412
228 Ga0163162_10022730 3300013306 Bacteria 6183
229 Ga0163162_10029631 3300013306 Bacteria 5418
230 Ga0163162_10082388 3300013306 Bacteria 3289
231 Ga0163162_10101267 3300013306 Bacteria 2972
232 Ga0163162_10154646 3300013306 Bacteria 2413
233 Ga0157372_10002207 3300013307 Bacteria 21135
234 Ga0157372_10013299 3300013307 Bacteria 8785
235 Ga0157372_10016109 3300013307 Bacteria 8021
236 Ga0157372_10055331 3300013307 Bacteria 4430
237 Ga0157372_10069471 3300013307 Bacteria 3961
238 Ga0157372_10087600 3300013307 Bacteria 3533
239 Ga0157372_10169118 3300013307 Bacteria 2529
240 Ga0157372_10236621 3300013307 Bacteria 2118
241 Ga0157372_10286041 3300013307 Bacteria 1917
242 Ga0157372_10307577 3300013307 Bacteria 1844
243 Ga0157375_10000229 3300013308 Bacteria 52257
244 Ga0157375_10003748 3300013308 Bacteria 13182
245 Ga0157375_10318015 3300013308 Bacteria 1721
246 Ga0157375_10483209 3300013308 Bacteria 1403
247 Ga0157375_10580167 3300013308 Bacteria 1282
248 Ga0157375_10997286 3300013308 Bacteria 977
249 Ga0163163_10066771 3300014325 Bacteria 3574
250 Ga0163163_10348234 3300014325 Bacteria 1537
251 Ga0157380_10004225 3300014326 Bacteria 9934
252 Ga0157380_10087442 3300014326 Bacteria 2563
253 Ga0157380_10912700 3300014326 Bacteria 905
254 Ga0157380_10984348 3300014326 Bacteria 876
255 Ga0157377_10232327 3300014745 Bacteria 1186
256 Ga0157379_10026820 3300014968 Bacteria 5128
257 Ga0157376_10002407 3300014969 Bacteria 12640
258 Ga0157376_10014178 3300014969 Bacteria 5972
259 Ga0157376_10037792 3300014969 Bacteria 3924
260 Ga0157376_10232759 3300014969 Bacteria 1712
261 Ga0157376_10274480 3300014969 Bacteria 1585
262 Ga0157376_10822399 3300014969 Bacteria 943
263 Ga0182005_1000263 3300015265 Bacteria 33328
264 Ga0183373_1001 3300015682 Bacteria 1410374
265 Ga0163161_10024699 3300017792 Bacteria 4248
266 Ga0163161_10106137 3300017792 Bacteria 2096
267 Ga0163161_10200571 3300017792 Bacteria 1537
268 Ga0209436_100493 3300025208 Bacteria 17414
269 Ga0209436_115469 3300025208 Bacteria 1178
270 Ga0209258_100151 3300025242 Bacteria 160444
271 Ga0209646_1000002 3300025246 Bacteria 1425781
272 Ga0209026_1003408 3300025250 Bacteria 5229
273 Ga0209148_1000154 3300025254 Bacteria 145214
274 Ga0209673_1000208 3300025273 Bacteria 117755
275 Ga0209130_1012180 3300025284 Bacteria 2265
276 Ga0209676_1000008 3300025292 Bacteria 991778
277 Ga0209564_1004681 3300025295 Bacteria 8211
278 Ga0209564_1008371 3300025295 Bacteria 5113
279 Ga0209758_1006777 3300025297 Bacteria 8046
280 Ga0209758_1007336 3300025297 Bacteria 7546
281 Ga0209758_1010527 3300025297 Bacteria 5516
282 Ga0209050_1000045 3300025298 Bacteria 388022
283 Ga0209050_1000134 3300025298 Bacteria 184417
284 Ga0207426_1000051 3300025302 Bacteria 391700
285 Ga0207426_1000497 3300025302 Bacteria 58506
286 Ga0207426_1001981 3300025302 Bacteria 14539
287 Ga0209257_1000001 3300025304 Bacteria 2274655
288 Ga0209257_1001605 3300025304 Bacteria 25882
289 Ga0207647_10022087 3300025904 Bacteria 4233
290 Ga0207647_10027673 3300025904 Bacteria 3693
291 Ga0207645_10000782 3300025907 Bacteria 26555
292 Ga0207645_10135954 3300025907 Bacteria 1601
293 Ga0207643_10016360 3300025908 Bacteria 4046
294 Ga0207643_10119626 3300025908 Bacteria 1559
295 Ga0207705_10060015 3300025909 Bacteria 2746
296 Ga0207705_10213945 3300025909 Bacteria 1462
297 Ga0207705_10257642 3300025909 Bacteria 1331
298 Ga0207707_10134583 3300025912 Bacteria 2161
299 Ga0207707_10274356 3300025912 Bacteria 1461
300 Ga0207695_10253437 3300025913 Unclassified 1659
301 Ga0207695_10254251 3300025913 Bacteria 1656
302 Ga0207671_10021174 3300025914 Bacteria 4938
303 Ga0207660_10048609 3300025917 Bacteria 3003
304 Ga0207660_10064694 3300025917 Bacteria 2640
305 Ga0207657_10049273 3300025919 Bacteria 3672
306 Ga0207657_10134095 3300025919 Bacteria 2028
307 Ga0207652_10001696 3300025921 Bacteria 19285
308 Ga0207652_10002592 3300025921 Bacteria 15165
309 Ga0207652_10158119 3300025921 Bacteria 2031
310 Ga0207652_10202970 3300025921 Bacteria 1784
311 Ga0207652_10521074 3300025921 Bacteria 1069
312 Ga0207681_10006023 3300025923 Bacteria 7439
313 Ga0207681_10096341 3300025923 Bacteria 2124
314 Ga0207681_10212032 3300025923 Bacteria 1493
315 Ga0207650_10012587 3300025925 Bacteria 5838
316 Ga0207650_10139402 3300025925 Bacteria 1905
317 Ga0207650_10190582 3300025925 Unclassified 1638
318 Ga0207659_10008155 3300025926 Bacteria 6484
319 Ga0207659_10089692 3300025926 Bacteria 2293
320 Ga0207659_10115461 3300025926 Bacteria 2048
321 Ga0207659_10147106 3300025926 Bacteria 1836
322 Ga0207690_10036991 3300025932 Bacteria 3166
323 Ga0207690_10112100 3300025932 Bacteria 1966
324 Ga0207690_10252357 3300025932 Bacteria 1363
325 Ga0207706_10033721 3300025933 Bacteria 4555
326 Ga0207706_10052521 3300025933 Bacteria 3598
327 Ga0207706_10094302 3300025933 Bacteria 2633
328 Ga0207686_10000546 3300025934 Bacteria 24296
329 Ga0207670_10005099 3300025936 Bacteria 7171
330 Ga0207670_10015030 3300025936 Bacteria 4614
331 Ga0207670_10100569 3300025936 Bacteria 2064
332 Ga0207691_10051170 3300025940 Bacteria 3778
333 Ga0207691_10525220 3300025940 Bacteria 1004
334 Ga0207691_10613576 3300025940 Bacteria 920
335 Ga0207711_10029958 3300025941 Bacteria 4591
336 Ga0207689_10004039 3300025942 Bacteria 13333
337 Ga0207689_10373610 3300025942 Bacteria 1187
338 Ga0207661_10072131 3300025944 Bacteria 2825
339 Ga0207667_10025406 3300025949 Bacteria 6483
340 Ga0207667_10048899 3300025949 Bacteria 4469
341 Ga0207667_10083053 3300025949 Bacteria 3317
342 Ga0207667_10208949 3300025949 Bacteria 2001
343 Ga0207651_10013976 3300025960 Bacteria 4619
344 Ga0207712_10002040 3300025961 Bacteria 13248
345 Ga0207712_10007103 3300025961 Bacteria 7062
346 Ga0207712_10015320 3300025961 Bacteria 4942
347 Ga0207712_10048997 3300025961 Bacteria 2941
348 Ga0207712_10068122 3300025961 Bacteria 2549
349 Ga0207712_10111979 3300025961 Bacteria 2049
350 Ga0207640_10360215 3300025981 Bacteria 1172
351 Ga0207677_10046060 3300026023 Bacteria 2917
352 Ga0207677_10108892 3300026023 Bacteria 2058
353 Ga0207639_10045073 3300026041 Bacteria 3320
354 Ga0207639_10131555 3300026041 Bacteria 2072
355 Ga0207639_10334169 3300026041 Bacteria 1349
356 Ga0207639_10415861 3300026041 Bacteria 1214
357 Ga0207639_10445067 3300026041 Bacteria 1175
358 Ga0207678_10025896 3300026067 Bacteria 5119
359 Ga0207702_10015301 3300026078 Bacteria 6360
360 Ga0207702_10042660 3300026078 Bacteria 3806
361 Ga0207702_10162492 3300026078 Bacteria 2040
362 Ga0207641_10039405 3300026088 Bacteria 3952
363 Ga0207641_10046365 3300026088 Bacteria 3663
364 Ga0207641_10347941 3300026088 Bacteria 1412
365 Ga0207648_10003442 3300026089 Bacteria 16603
366 Ga0207648_10083847 3300026089 Bacteria 2780
367 Ga0207648_10173743 3300026089 Bacteria 1905
368 Ga0207648_10199986 3300026089 Bacteria 1772
369 Ga0207676_10607880 3300026095 Bacteria 1051
370 Ga0207674_10017537 3300026116 Bacteria 7811
371 Ga0207674_10054880 3300026116 Bacteria 4054
372 Ga0207674_10181682 3300026116 Bacteria 2055
373 Ga0207674_10261623 3300026116 Bacteria 1677
374 Ga0207674_10819930 3300026116 Unclassified 898
375 Ga0207675_100000304 3300026118 Bacteria 47181
376 Ga0207675_100021657 3300026118 Bacteria 5983
377 Ga0207675_100067745 3300026118 Bacteria 3337
378 Ga0207675_100250132 3300026118 Bacteria 1715
379 Ga0207675_100262787 3300026118 Bacteria 1673
380 Ga0207683_10006532 3300026121 Bacteria 9983
381 Ga0207683_10055587 3300026121 Bacteria 3471
382 Ga0207683_10113376 3300026121 Bacteria 2428
383 Ga0207698_10002060 3300026142 Bacteria 11858
384 Ga0207698_10052383 3300026142 Bacteria 3126
385 Ga0207698_10139324 3300026142 Bacteria 2087
386 Ga0268265_10019901 3300028380 Bacteria 4675
387 Ga0268264_10011235 3300028381 Bacteria 7398
388 Ga0268264_10014882 3300028381 Bacteria 6389
389 Ga0268264_10213609 3300028381 Bacteria 1772
390 Ga0307515_10000001 3300028794 Bacteria 4259510
391 Ga0307515_10009265 3300028794 Bacteria 19056
392 Ga0307515_10309856 3300028794 Bacteria 1255
393 Ga0265327_10000192 3300031251 Bacteria 129439
394 Ga0265316_10028488 3300031344 Bacteria 4608
395 Ga0265316_10068580 3300031344 Bacteria 2739
396 Ga0307508_10264329 3300031616 Bacteria 1315
397 Ga0307516_10001558 3300031730 Bacteria 31533
398 Ga0307405_10236614 3300031731 Bacteria 1350
399 Ga0307413_10049073 3300031824 Bacteria 2528
400 Ga0307410_10024419 3300031852 Bacteria 3776
401 Ga0307406_10048601 3300031901 Bacteria 2681
402 Ga0307407_10062491 3300031903 Bacteria 2181
403 Ga0307412_10184557 3300031911 Bacteria 1572
404 Ga0373923_0062490 3300035111 Bacteria 1585
405 Ga0395899_0001884 3300037312 Bacteria 17312
406 Ga0395899_0023527 3300037312 Bacteria 4664
407 Ga0395900_0006601 3300037418 Bacteria 12073
408 Ga0395900_0008607 3300037418 Bacteria 10486
409 Ga0395900_0012177 3300037418 Bacteria 8793
410 Ga0395900_0699243 3300037418 Bacteria 947
411 Ga0395898_0001651 3300037466 Bacteria 30118
412 Ga0395898_0031717 3300037466 Bacteria 5277
413 Ga0395898_0065100 3300037466 Bacteria 3534
414 Ga0395898_0099670 3300037466 Bacteria 2790
415 Ga0395905_0000254 3300037471 Bacteria 79953
416 Ga0395905_0006569 3300037471 Bacteria 11683
417 Ga0395905_0124105 3300037471 Bacteria 2428
418 Ga0395901_0010578 3300038443 Bacteria 9348
419 Ga0395901_0019400 3300038443 Bacteria 6953
420 Ga0436365_0390802 3300039437 Bacteria 2140
421 Ga0439453_0045357 3300041408 Bacteria 874
422 Ga0451807_0985874 3300041486 Bacteria 1263
423 Ga0439431_0001262 3300041997 Bacteria 5544
424 Ga0439457_015882 3300042014 Bacteria 1681
425 Ga0451577_0025056 3300042876 Bacteria 5415
426 Ga0451577_0070574 3300042876 Bacteria 3115
427 Ga0451577_0454997 3300042876 Viruses 1162
428 Ga0453683_0001431 3300044673 Bacteria 20758
429 Ga0453683_0034953 3300044673 Bacteria 3168
430 Ga0453683_0124300 3300044673 Bacteria 1624
431 Ga0453683_0759776 3300044673 Bacteria 637
432 Ga0453684_0000557 3300044712 Bacteria 140566
433 Ga0453684_0037465 3300044712 Bacteria 6656
434 Ga0453684_0096014 3300044712 Bacteria 3643
435 Ga0453684_0122440 3300044712 Bacteria 3138
436 Ga0453684_0703944 3300044712 Unclassified 1097
437 Ga0466957_0085450 3300044842 Bacteria 1971
438 Ga0466959_0112445 3300045049 Bacteria 1942
439 Ga0451576_0000003 3300045051 Bacteria 1550573
440 Ga0451576_0003675 3300045051 Bacteria 20814
441 Ga0451576_0034344 3300045051 Bacteria 5387
442 Ga0451576_0663043 3300045051 Unclassified 1096
443 Ga0451576_0946502 3300045051 Bacteria 903
444 Ga0495627_006073 3300046453 Bacteria 4774
445 Ga0495650_0041565 3300046471 Bacteria 1965
446 Ga0495633_0000080 3300046558 Bacteria 127703
447 Ga0495686_0000884 3300047472 Bacteria 38050
448 Ga0496100_0068659 3300048903 Unclassified 2358
449 Ga0496101_0036034 3300048904 Unclassified 3502
450 Ga0496110_0107705 3300048913 Bacteria 2502
451 Ga0496114_0053354 3300048917 Unclassified 3370
452 Ga0496121_0000020 3300048924 Bacteria 498732
453 Ga0496126_0097434 3300048929 Bacteria 2577
454 Ga0501033_0246960 3300049570 Bacteria 1266
455 Ga0501034_0018957 3300049571 Bacteria 7050
456 Ga0501034_0051387 3300049571 Bacteria 4156
457 Ga0501034_0161209 3300049571 Bacteria 2214
458 Ga0501034_0176949 3300049571 Bacteria 2099
459 Ga0501034_0210005 3300049571 Bacteria 1902
460 Ga0501034_0455885 3300049571 Bacteria 1196
461 Ga0501037_0067042 3300049573 Bacteria 2614
462 Ga0501047_0019499 3300049581 Bacteria 6506
463 Ga0501072_0209526 3300049588 Unclassified 1553
464 Ga0501201_008430 3300049651 Bacteria 995
465 Ga0501202_006180 3300049652 Bacteria 2136
466 Ga0501209_056842 3300049656 Bacteria 1082
467 Ga0501222_001620 3300049662 Bacteria 3125
468 Ga0501223_000793 3300049663 Bacteria 7486
469 Ga0501235_021253 3300049669 Bacteria 1442
470 Ga0501253_026845 3300049683 Bacteria 1065
471 Ga0501257_002024 3300049686 Bacteria 4227
472 Ga0501259_000101 3300049688 Bacteria 12324
473 Ga0501259_008067 3300049688 Bacteria 1691
474 Ga0501261_004163 3300049690 Bacteria 1781
475 Ga0501221_001429 3300049704 Bacteria 3949
476 Ga0501221_018944 3300049704 Bacteria 1330
477 Ga0501225_0058514 3300049705 Bacteria 1082
478 Ga0501225_0066505 3300049705 Bacteria 1019
479 Ga0501245_000190 3300049708 Bacteria 6812
480 Ga0501241_000031 3300049758 Bacteria 52001
481 Ga0501266_013028 3300049763 Bacteria 1079
482 Ga0501035_0048319 3300049822 Bacteria 3816
483 Ga0501044_0083611 3300049823 Bacteria 3228
484 Ga0501044_0150387 3300049823 Bacteria 2311
485 Ga0501044_0532054 3300049823 Bacteria 1074
486 Ga0501212_007121 3300049851 Bacteria 1525
487 nmdc:mga05p37_640643_c1 3300050507 Bacteria 1192
488 nmdc:mga09592_32552_c1 3300050508 Bacteria 4347
489 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
490 nmdc:mga0qj67_314117_c1 3300050509 Bacteria 1269
491 nmdc:mga06r32_10152_c1 3300050510 Bacteria 8500
492 nmdc:mga06r32_472180_c1 3300050510 Bacteria 1233
493 nmdc:mga08y16_119672_c1 3300050511 Bacteria 2741
494 nmdc:mga08y16_69611_c1 3300050511 Bacteria 3668
495 Ga0500644_0000283 3300053088 Bacteria 28078
496 Ga0500646_0004258 3300053090 Bacteria 3626
497 Ga0500583_0107285 3300053092 Bacteria 1373
498 Ga0500569_000329 3300053109 Bacteria 7609
499 Ga0500607_010729 3300053121 Bacteria 5440
500 Ga0500652_013881 3300053131 Bacteria 2865
501 Ga0500658_0008871 3300053134 Bacteria 3711
502 Ga0500559_0112244 3300053136 Bacteria 1263
503 Ga0500577_0018793 3300053142 Bacteria 2228
504 Ga0500589_097814 3300053147 Bacteria 1280
505 Ga0500616_0037455 3300053153 Bacteria 2626
506 Ga0500622_0000777 3300053156 Bacteria 27709
507 Ga0500636_0018231 3300053177 Bacteria 4151
508 2819573636 2818991442 Bacteria 8318214
509 2819680864 2818991460 Bacteria 7595395
510 2821136970 2821136567 Bacteria 8080116
511 2883072592 2883068021 Bacteria 6192739
512 2884795621 2884791551 Bacteria 8511252
513 2896087759 2896085136 Bacteria 6129793
514 2896112535 2896109856 Bacteria 7140722
515 2904468288 2904467357 Bacteria 8057758
516 2929178808 2929177148 Bacteria 7883697
517 2929923249 2929921140 Bacteria 8649150
518 2945981212 2945977869 Bacteria 7777518
519 2946019387 2946013367 Bacteria 7766675
520 8003152121 8003151029 Bacteria 8187759
521 Ga0395899_0045078
522 JGI24740J21852_10001160
523 JGI24739J22299_10001962
524 JGI24739J22299_10057839
525 JGI24751J29686_10005884
526 JGI25154J39366_1000040
527 JGI25157J39369_1002238
528 JGI25153J46596_10003586
529 JGI25153J46596_10015747
530 rootH2_10019144
531 rootL2_10043559
532 rootL2_10061634
533 rootL2_10094219
534 rootL2_10128071
535 JGI25160J50197_1003836
536 JGI25160J50197_1004305
537 JGI25160J50197_1013033
538 Ga0055542_1002855
539 Ga0055526_1030323
540 Ga0055536_1000001
541 Ga0055528_1001650
542 Ga0055530_10000387
543 Ga0055530_10007773
544 Ga0055531_10000131
545 Ga0065165_1000102
546 Ga0065714_10076696
547 Ga0065704_10073452
548 Ga0065712_10078473
549 Ga0065712_10236137
550 Ga0065715_10123377
551 Ga0065715_10332155
552 Ga0065707_10101368
553 Ga0070658_10025309
554 Ga0070658_10046100
555 Ga0070658_10308952
556 Ga0070676_10009041
557 Ga0070676_10141507
558 Ga0070683_100094838
559 Ga0070683_100517685
560 Ga0070670_100038532
561 Ga0070670_100057642
562 Ga0070670_100077103
563 Ga0070670_100195051
564 Ga0070670_100361469
565 Ga0068869_100092612
566 Ga0068869_100132793
567 Ga0070666_10123756
568 Ga0070666_10139449
569 Ga0070680_100395581
570 Ga0070682_100078889
571 Ga0070682_100124847
572 Ga0068868_100063845
573 Ga0068868_100090411
574 Ga0070660_100035082
575 Ga0070660_100352538
576 Ga0070689_100001732
577 Ga0070689_100020307
578 Ga0070689_100027105
579 Ga0070691_10016462
580 Ga0070687_100131555
581 Ga0070687_100445055
582 Ga0070692_10158811
583 Ga0070668_100051874
584 Ga0070669_100004024
585 Ga0070669_100014373
586 Ga0070669_100233864
587 Ga0070675_100009839
588 Ga0070675_100071275
589 Ga0070675_100254133
590 Ga0070675_100326455
591 Ga0070675_100344876
592 Ga0070675_100552947
593 Ga0070671_100004803
594 Ga0070674_100227024
595 Ga0070673_100016781
596 Ga0070673_100484598
597 Ga0070688_100001700
598 Ga0070688_100010471
599 Ga0070659_100006368
600 Ga0070659_100013097
601 Ga0070659_100231832
602 Ga0070667_100058354
603 Ga0070663_100210389
604 Ga0070678_100009260
605 Ga0070678_100272443
606 Ga0070662_100016239
607 Ga0070662_100033380
608 Ga0070662_100049451
609 Ga0070681_10029313
610 Ga0070681_10095109
611 Ga0070681_10153223
612 Ga0068867_100098891
613 Ga0068867_100173527
614 Ga0068867_100285719
615 Ga0070685_10013492
616 Ga0070685_10041907
617 Ga0070679_100000634
618 Ga0070679_100006277
619 Ga0070679_100044014
620 Ga0070679_100057825
621 Ga0070679_100274952
622 Ga0070679_100294055
623 Ga0070684_100103964
624 Ga0070684_100739082
625 Ga0068853_100013393
626 Ga0068853_100034498
627 Ga0068853_100089780
628 Ga0070686_100192292
629 Ga0070693_100393286
630 Ga0070665_100045521
631 Ga0068855_100000346
632 Ga0068855_100135189
633 Ga0068855_100285200
634 Ga0068855_100294159
635 Ga0068855_100842014
636 Ga0070664_100531993
637 Ga0068857_100043308
638 Ga0068857_100392933
639 Ga0068854_100062265
640 Ga0068856_100015577
641 Ga0068856_100022699
642 Ga0068856_100144992
643 Ga0068856_100463536
644 Ga0068852_100002479
645 Ga0068852_100147483
646 Ga0068852_100475034
647 Ga0068859_100002554
648 Ga0068859_100020542
649 Ga0068859_100026609
650 Ga0068859_100060222
651 Ga0068859_100241280
652 Ga0068859_100616612
653 Ga0068859_100955451
654 Ga0068864_100100923
655 Ga0068864_100565114
656 Ga0068861_100017109
657 Ga0068861_100113637
658 Ga0068870_10008005
659 Ga0068870_10025380
660 Ga0068870_10089758
661 Ga0068863_100050027
662 Ga0068863_100132990
663 Ga0068863_100185179
664 Ga0068858_100023494
665 Ga0068860_100001316
666 Ga0068862_100021684
667 Ga0081539_10087560
668 Ga0070715_10106742
669 Ga0097621_100003432
670 Ga0097621_100006701
671 Ga0097621_100046576
672 Ga0068871_100000027
673 Ga0068871_100186014
674 Ga0075428_100110387
675 Ga0075430_100009529
676 Ga0075430_100334219
677 Ga0075431_100004434
678 Ga0075431_100009374
679 Ga0075431_100489372
680 Ga0075434_100270003
681 Ga0075429_100002808
682 Ga0075429_100079015
683 Ga0068865_100004608
684 Ga0097620_100002554
685 Ga0097620_100020542
686 Ga0097620_100026608
687 Ga0097620_100060222
688 Ga0097620_100241283
689 Ga0097620_100616591
690 Ga0097620_100955760
691 Ga0105251_10040875
692 Ga0105240_10168623
693 Ga0105240_10271228
694 Ga0111539_10005620
695 Ga0105245_10155295
696 Ga0105247_10003977
697 Ga0114129_10158299
698 Ga0114129_10825644
699 Ga0105241_10012333
700 Ga0105241_10243142
701 Ga0105241_10527305
702 Ga0105242_10002149
703 Ga0105242_10051880
704 Ga0105242_10294229
705 Ga0105248_10015617
706 Ga0105237_10028409
707 Ga0105237_10123599
708 Ga0105249_10002281
709 Ga0105249_10005103
710 Ga0105249_10012672
711 Ga0105249_10019729
712 Ga0105249_10037570
713 Ga0105249_10114467
714 Ga0105249_11096180
715 Ga0105239_10000048
716 Ga0105239_10042529
717 Ga0105239_10464624
718 Ga0105239_10690712
719 Ga0105246_10091998
720 Ga0157373_10009404
721 Ga0157373_10013034
722 Ga0157373_10019401
723 Ga0157373_10231345
724 Ga0157373_10273805
725 Ga0157371_10000563
726 Ga0157371_10001497
727 Ga0157371_10003112
728 Ga0157371_10004118
729 Ga0157371_10040438
730 Ga0157371_10056505
731 Ga0157371_10122245
732 Ga0157371_10180407
733 Ga0157370_10000500
734 Ga0157370_10001022
735 Ga0157370_10112683
736 Ga0157370_10188162
737 Ga0157370_10430218
738 Ga0157370_10481267
739 Ga0157369_10050640
740 Ga0157369_10148579
741 Ga0157369_10264436
742 Ga0157369_10314583
743 Ga0157374_10000001
744 Ga0157374_10010040
745 Ga0157378_10008736
746 Ga0157378_10103270
747 Ga0163162_10005326
748 Ga0163162_10022730
749 Ga0163162_10029631
750 Ga0163162_10082388
751 Ga0163162_10101267
752 Ga0163162_10154646
753 Ga0157372_10002207
754 Ga0157372_10013299
755 Ga0157372_10016109
756 Ga0157372_10055331
757 Ga0157372_10069471
758 Ga0157372_10087600
759 Ga0157372_10169118
760 Ga0157372_10236621
761 Ga0157372_10286041
762 Ga0157372_10307577
763 Ga0157375_10000229
764 Ga0157375_10003748
765 Ga0157375_10318015
766 Ga0157375_10483209
767 Ga0157375_10580167
768 Ga0157375_10997286
769 Ga0163163_10066771
770 Ga0163163_10348234
771 Ga0157380_10004225
772 Ga0157380_10087442
773 Ga0157380_10912700
774 Ga0157380_10984348
775 Ga0157377_10232327
776 Ga0157379_10026820
777 Ga0157376_10002407
778 Ga0157376_10014178
779 Ga0157376_10037792
780 Ga0157376_10232759
781 Ga0157376_10274480
782 Ga0157376_10822399
783 Ga0182005_1000263
784 Ga0183373_1001
785 Ga0163161_10024699
786 Ga0163161_10106137
787 Ga0163161_10200571
788 Ga0209436_100493
789 Ga0209436_115469
790 Ga0209258_100151
791 Ga0209646_1000002
792 Ga0209026_1003408
793 Ga0209148_1000154
794 Ga0209673_1000208
795 Ga0209130_1012180
796 Ga0209676_1000008
797 Ga0209564_1004681
798 Ga0209564_1008371
799 Ga0209758_1006777
800 Ga0209758_1007336
801 Ga0209758_1010527
802 Ga0209050_1000045
803 Ga0209050_1000134
804 Ga0207426_1000051
805 Ga0207426_1000497
806 Ga0207426_1001981
807 Ga0209257_1000001
808 Ga0209257_1001605
809 Ga0207647_10022087
810 Ga0207647_10027673
811 Ga0207645_10000782
812 Ga0207645_10135954
813 Ga0207643_10016360
814 Ga0207643_10119626
815 Ga0207705_10060015
816 Ga0207705_10213945
817 Ga0207705_10257642
818 Ga0207707_10134583
819 Ga0207707_10274356
820 Ga0207695_10253437
821 Ga0207695_10254251
822 Ga0207671_10021174
823 Ga0207660_10048609
824 Ga0207660_10064694
825 Ga0207657_10049273
826 Ga0207657_10134095
827 Ga0207652_10001696
828 Ga0207652_10002592
829 Ga0207652_10158119
830 Ga0207652_10202970
831 Ga0207652_10521074
832 Ga0207681_10006023
833 Ga0207681_10096341
834 Ga0207681_10212032
835 Ga0207650_10012587
836 Ga0207650_10139402
837 Ga0207650_10190582
838 Ga0207659_10008155
839 Ga0207659_10089692
840 Ga0207659_10115461
841 Ga0207659_10147106
842 Ga0207690_10036991
843 Ga0207690_10112100
844 Ga0207690_10252357
845 Ga0207706_10033721
846 Ga0207706_10052521
847 Ga0207706_10094302
848 Ga0207686_10000546
849 Ga0207670_10005099
850 Ga0207670_10015030
851 Ga0207670_10100569
852 Ga0207691_10051170
853 Ga0207691_10525220
854 Ga0207691_10613576
855 Ga0207711_10029958
856 Ga0207689_10004039
857 Ga0207689_10373610
858 Ga0207661_10072131
859 Ga0207667_10025406
860 Ga0207667_10048899
861 Ga0207667_10083053
862 Ga0207667_10208949
863 Ga0207651_10013976
864 Ga0207712_10002040
865 Ga0207712_10007103
866 Ga0207712_10015320
867 Ga0207712_10048997
868 Ga0207712_10068122
869 Ga0207712_10111979
870 Ga0207640_10360215
871 Ga0207677_10046060
872 Ga0207677_10108892
873 Ga0207639_10045073
874 Ga0207639_10131555
875 Ga0207639_10334169
876 Ga0207639_10415861
877 Ga0207639_10445067
878 Ga0207678_10025896
879 Ga0207702_10015301
880 Ga0207702_10042660
881 Ga0207702_10162492
882 Ga0207641_10039405
883 Ga0207641_10046365
884 Ga0207641_10347941
885 Ga0207648_10003442
886 Ga0207648_10083847
887 Ga0207648_10173743
888 Ga0207648_10199986
889 Ga0207676_10607880
890 Ga0207674_10017537
891 Ga0207674_10054880
892 Ga0207674_10181682
893 Ga0207674_10261623
894 Ga0207674_10819930
895 Ga0207675_100000304
896 Ga0207675_100021657
897 Ga0207675_100067745
898 Ga0207675_100250132
899 Ga0207675_100262787
900 Ga0207683_10006532
901 Ga0207683_10055587
902 Ga0207683_10113376
903 Ga0207698_10002060
904 Ga0207698_10052383
905 Ga0207698_10139324
906 Ga0268265_10019901
907 Ga0268264_10011235
908 Ga0268264_10014882
909 Ga0268264_10213609
910 Ga0307515_10000001
911 Ga0307515_10009265
912 Ga0307515_10309856
913 Ga0265327_10000192
914 Ga0265316_10028488
915 Ga0265316_10068580
916 Ga0307508_10264329
917 Ga0307516_10001558
918 Ga0307405_10236614
919 Ga0307413_10049073
920 Ga0307410_10024419
921 Ga0307406_10048601
922 Ga0307407_10062491
923 Ga0307412_10184557
924 Ga0373923_0062490
925 Ga0395899_0001884
926 Ga0395899_0023527
927 Ga0395900_0006601
928 Ga0395900_0008607
929 Ga0395900_0012177
930 Ga0395900_0699243
931 Ga0395898_0001651
932 Ga0395898_0031717
933 Ga0395898_0065100
934 Ga0395898_0099670
935 Ga0395905_0000254
936 Ga0395905_0006569
937 Ga0395905_0124105
938 Ga0395901_0010578
939 Ga0395901_0019400
940 Ga0436365_0390802
941 Ga0439453_0045357
942 Ga0451807_0985874
943 Ga0439431_0001262
944 Ga0439457_015882
945 Ga0451577_0025056
946 Ga0451577_0070574
947 Ga0451577_0454997
948 Ga0453683_0001431
949 Ga0453683_0034953
950 Ga0453683_0124300
951 Ga0453683_0759776
952 Ga0453684_0000557
953 Ga0453684_0037465
954 Ga0453684_0096014
955 Ga0453684_0122440
956 Ga0453684_0703944
957 Ga0466957_0085450
958 Ga0466959_0112445
959 Ga0451576_0000003
960 Ga0451576_0003675
961 Ga0451576_0034344
962 Ga0451576_0663043
963 Ga0451576_0946502
964 Ga0495627_006073
965 Ga0495650_0041565
966 Ga0495633_0000080
967 Ga0495686_0000884
968 Ga0496100_0068659
969 Ga0496101_0036034
970 Ga0496110_0107705
971 Ga0496114_0053354
972 Ga0496121_0000020
973 Ga0496126_0097434
974 Ga0501033_0246960
975 Ga0501034_0018957
976 Ga0501034_0051387
977 Ga0501034_0161209
978 Ga0501034_0176949
979 Ga0501034_0210005
980 Ga0501034_0455885
981 Ga0501037_0067042
982 Ga0501047_0019499
983 Ga0501072_0209526
984 Ga0501201_008430
985 Ga0501202_006180
986 Ga0501209_056842
987 Ga0501222_001620
988 Ga0501223_000793
989 Ga0501235_021253
990 Ga0501253_026845
991 Ga0501257_002024
992 Ga0501259_000101
993 Ga0501259_008067
994 Ga0501261_004163
995 Ga0501221_001429
996 Ga0501221_018944
997 Ga0501225_0058514
998 Ga0501225_0066505
999 Ga0501245_000190
1000 Ga0501241_000031
1001 Ga0501266_013028
1002 Ga0501035_0048319
1003 Ga0501044_0083611
1004 Ga0501044_0150387
1005 Ga0501044_0532054
1006 Ga0501212_007121
1007 nmdc:mga05p37_640643_c1
1008 nmdc:mga09592_32552_c1
1009 nmdc:mga09592_983_c1
1010 nmdc:mga0qj67_314117_c1
1011 nmdc:mga06r32_10152_c1
1012 nmdc:mga06r32_472180_c1
1013 nmdc:mga08y16_119672_c1
1014 nmdc:mga08y16_69611_c1
1015 Ga0500644_0000283
1016 Ga0500646_0004258
1017 Ga0500583_0107285
1018 Ga0500569_000329
1019 Ga0500607_010729
1020 Ga0500652_013881
1021 Ga0500658_0008871
1022 Ga0500559_0112244
1023 Ga0500577_0018793
1024 Ga0500589_097814
1025 Ga0500616_0037455
1026 Ga0500622_0000777
1027 Ga0500636_0018231
1028 2819573636
1029 2819680864
1030 2821136970
1031 2883072592
1032 2884795621
1033 2896087759
1034 2896112535
1035 2904468288
1036 2929178808
1037 2929923249
1038 2945981212
1039 2946019387
1040 8003152121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

34

264

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.967 1 251
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9653 3 251
7qc9-assembly1.cif.gz_A hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima 0.9648 2 251
6ymu-assembly1.cif.gz_A imidazole glycerol phosphate synthase 0.9645 1 251
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9632 1 251
ID Description Score Start End Superfamily
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9718 1 251 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 1 251 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9625 1 246 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.957 1 251 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9533 1 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q3SL08-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9868 136 250 GO:0000105
GO:0000107
GO:0016829
AF-A0A847PQ77-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.985 66 251 GO:0000105
GO:0000107
GO:0016829
AF-A0A660WTR3-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9847 76 250 GO:0000105
GO:0000107
GO:0016829
AF-A0A1V6EDP8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9842 101 251 GO:0000105
GO:0000107
GO:0016829
AF-A0A351MD50-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9821 55 251 GO:0000105
GO:0000107
GO:0016829

Map