F458565

General Info

Members Datasets Scaffolds Average Seq Length
520 212 1040 218

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0295250|Ga0395899_0295250_433_1083
Length 216
Sequence MTSPASPIVIAVDGPAASGKGTIARALAKHYGLPHMDTGMLYRAVALTMFRFGGDPASEFEAVRACEGTPQVDPTDPDLRTEIVSSIASRISAYPAVRAALLQRQQAFASQASGAVLDGRDIGTVIAPHATAKLFVTASPEVRARRRVAELLKRGMPAHYEDVLIDIRARDERDSKRDAAPLVQADDADLLDTSEMDIDEAIAAAIALVEAKIGAN

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
174 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 5
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0295250 3300037312 Bacteria 1098
2 JGI24747J21853_1001580 3300001978 Bacteria 1734
3 JGI24739J22299_10008945 3300001989 Bacteria 3736
4 JGI24737J22298_10026431 3300001990 Bacteria 1833
5 JGI24735J21928_10031377 3300002067 Bacteria 1575
6 JGI24735J21928_10035780 3300002067 Bacteria 1458
7 JGI24735J21928_10040219 3300002067 Bacteria 1366
8 JGI24745J21846_1002754 3300002073 Bacteria 1812
9 JGI24738J21930_10018195 3300002075 Bacteria 1470
10 JGI24744J21845_10000287 3300002077 Bacteria 8385
11 rootH1_10208177 3300003323 Bacteria 1327
12 Ga0070658_10026100 3300005327 Bacteria 4686
13 Ga0070658_10033381 3300005327 Bacteria 4140
14 Ga0070658_10076276 3300005327 Bacteria 2749
15 Ga0070658_10142407 3300005327 Bacteria 2003
16 Ga0070658_10577640 3300005327 Bacteria 973
17 Ga0070658_10710753 3300005327 Bacteria 872
18 Ga0070676_10046893 3300005328 Bacteria 2521
19 Ga0070683_100295705 3300005329 Bacteria 1540
20 Ga0070690_100045194 3300005330 Bacteria 2797
21 Ga0070690_100052565 3300005330 Bacteria 2604
22 Ga0070670_100030359 3300005331 Bacteria 4655
23 Ga0070670_100124951 3300005331 Bacteria 2221
24 Ga0070670_100181430 3300005331 Bacteria 1828
25 Ga0070670_100279175 3300005331 Bacteria 1459
26 Ga0068869_100059083 3300005334 Bacteria 2806
27 Ga0070666_10007245 3300005335 Bacteria 6839
28 Ga0070666_10018022 3300005335 Bacteria 4533
29 Ga0070666_10018242 3300005335 Bacteria 4508
30 Ga0070682_100354673 3300005337 Bacteria 1095
31 Ga0068868_100000237 3300005338 Bacteria 37449
32 Ga0068868_100006807 3300005338 Bacteria 8117
33 Ga0068868_100299968 3300005338 Bacteria 1364
34 Ga0070660_100003366 3300005339 Bacteria 10999
35 Ga0070660_100102984 3300005339 Bacteria 2263
36 Ga0070660_100179609 3300005339 Bacteria 1712
37 Ga0070660_100227333 3300005339 Bacteria 1517
38 Ga0070660_100434711 3300005339 Bacteria 1087
39 Ga0070689_100099347 3300005340 Bacteria 2303
40 Ga0070689_100451579 3300005340 Bacteria 1094
41 Ga0070661_100007217 3300005344 Bacteria 7661
42 Ga0070661_100043546 3300005344 Bacteria 3279
43 Ga0070661_100051844 3300005344 Bacteria 3003
44 Ga0070661_100109566 3300005344 Bacteria 2061
45 Ga0070692_10036947 3300005345 Bacteria 2481
46 Ga0070668_100006254 3300005347 Bacteria 8821
47 Ga0070668_100073903 3300005347 Bacteria 2659
48 Ga0070668_100145703 3300005347 Bacteria 1912
49 Ga0070668_100328395 3300005347 Bacteria 1289
50 Ga0070668_100336378 3300005347 Bacteria 1275
51 Ga0070669_100165589 3300005353 Bacteria 1721
52 Ga0070675_100087001 3300005354 Bacteria 2613
53 Ga0070675_100092888 3300005354 Bacteria 2530
54 Ga0070671_100013668 3300005355 Bacteria 6547
55 Ga0070671_100014207 3300005355 Bacteria 6430
56 Ga0070671_100015603 3300005355 Bacteria 6138
57 Ga0070671_100045988 3300005355 Bacteria 3629
58 Ga0070671_100077208 3300005355 Bacteria 2783
59 Ga0070671_100166042 3300005355 Bacteria 1866
60 Ga0070671_100218283 3300005355 Bacteria 1618
61 Ga0070674_100006593 3300005356 Bacteria 6786
62 Ga0070674_100006617 3300005356 Bacteria 6775
63 Ga0070674_100031836 3300005356 Bacteria 3499
64 Ga0070674_100032380 3300005356 Bacteria 3472
65 Ga0070673_100008272 3300005364 Bacteria 6909
66 Ga0070673_100013344 3300005364 Bacteria 5679
67 Ga0070673_100090533 3300005364 Bacteria 2499
68 Ga0070673_100168440 3300005364 Bacteria 1868
69 Ga0070673_100504370 3300005364 Bacteria 1095
70 Ga0070659_100023121 3300005366 Bacteria 4752
71 Ga0070659_100143512 3300005366 Bacteria 1944
72 Ga0070659_100149803 3300005366 Bacteria 1903
73 Ga0070659_100214018 3300005366 Bacteria 1589
74 Ga0070659_100248607 3300005366 Bacteria 1473
75 Ga0070667_100040495 3300005367 Bacteria 3907
76 Ga0070667_100122321 3300005367 Bacteria 2265
77 Ga0070667_100334121 3300005367 Bacteria 1369
78 Ga0070667_100385435 3300005367 Bacteria 1274
79 Ga0070667_100634877 3300005367 Bacteria 985
80 Ga0070667_100832733 3300005367 Bacteria 857
81 Ga0070714_100042688 3300005435 Bacteria 3832
82 Ga0070714_100374999 3300005435 Bacteria 1340
83 Ga0070713_100056520 3300005436 Bacteria 3264
84 Ga0070694_100167802 3300005444 Bacteria 1615
85 Ga0070663_100007211 3300005455 Bacteria 6753
86 Ga0070663_100021827 3300005455 Bacteria 4265
87 Ga0070663_100025599 3300005455 Bacteria 3986
88 Ga0070663_100061842 3300005455 Bacteria 2698
89 Ga0070663_100101244 3300005455 Bacteria 2150
90 Ga0070678_100021464 3300005456 Bacteria 4258
91 Ga0070678_100055768 3300005456 Bacteria 2886
92 Ga0070662_100003264 3300005457 Bacteria 10090
93 Ga0070662_100286832 3300005457 Bacteria 1333
94 Ga0070662_100302892 3300005457 Bacteria 1299
95 Ga0070662_101095666 3300005457 Bacteria 683
96 Ga0070681_10531807 3300005458 Unclassified 1089
97 Ga0068867_100002869 3300005459 Bacteria 12129
98 Ga0068867_100058279 3300005459 Bacteria 2862
99 Ga0068867_100145751 3300005459 Bacteria 1855
100 Ga0068867_100154331 3300005459 Bacteria 1806
101 Ga0070685_10135386 3300005466 Bacteria 1545
102 Ga0070706_100248834 3300005467 Bacteria 1660
103 Ga0070679_100439976 3300005530 Bacteria 1249
104 Ga0068853_100036747 3300005539 Bacteria 4166
105 Ga0068853_100079809 3300005539 Bacteria 2862
106 Ga0070672_100000482 3300005543 Bacteria 23162
107 Ga0070672_100085728 3300005543 Bacteria 2532
108 Ga0070672_100118015 3300005543 Bacteria 2169
109 Ga0070672_100247642 3300005543 Bacteria 1500
110 Ga0070672_100851320 3300005543 Bacteria 804
111 Ga0070672_100879626 3300005543 Bacteria 791
112 Ga0070686_100129525 3300005544 Bacteria 1743
113 Ga0070695_100023104 3300005545 Bacteria 3818
114 Ga0070696_100006532 3300005546 Bacteria 7787
115 Ga0070693_100205124 3300005547 Bacteria 1283
116 Ga0070693_100318725 3300005547 Bacteria 1054
117 Ga0070665_100016225 3300005548 Bacteria 7473
118 Ga0070665_100138768 3300005548 Bacteria 2434
119 Ga0068855_100127353 3300005563 Bacteria 2911
120 Ga0068855_100853875 3300005563 Bacteria 964
121 Ga0070664_100030419 3300005564 Bacteria 4505
122 Ga0070664_100038109 3300005564 Bacteria 4045
123 Ga0070664_100141257 3300005564 Bacteria 2120
124 Ga0070664_100191258 3300005564 Bacteria 1823
125 Ga0068857_100332360 3300005577 Bacteria 1405
126 Ga0068854_100015826 3300005578 Bacteria 5010
127 Ga0068854_100091847 3300005578 Bacteria 2260
128 Ga0068854_100366947 3300005578 Bacteria 1183
129 Ga0068856_100042138 3300005614 Bacteria 4490
130 Ga0068856_100278743 3300005614 Bacteria 1689
131 Ga0068856_100334270 3300005614 Bacteria 1533
132 Ga0068852_100012312 3300005616 Bacteria 6489
133 Ga0068852_100036248 3300005616 Bacteria 4125
134 Ga0068852_100074676 3300005616 Bacteria 2987
135 Ga0068852_100093094 3300005616 Bacteria 2700
136 Ga0068852_100242350 3300005616 Bacteria 1724
137 Ga0068859_100003354 3300005617 Bacteria 16292
138 Ga0068859_100014674 3300005617 Bacteria 7873
139 Ga0068859_100069745 3300005617 Bacteria 3550
140 Ga0068859_100106596 3300005617 Bacteria 2862
141 Ga0068859_100552657 3300005617 Bacteria 1246
142 Ga0068864_100089105 3300005618 Bacteria 2718
143 Ga0068864_100098577 3300005618 Bacteria 2589
144 Ga0068866_10004001 3300005718 Bacteria 6053
145 Ga0068866_10005219 3300005718 Bacteria 5352
146 Ga0068866_10131801 3300005718 Bacteria 1423
147 Ga0068861_100203868 3300005719 Bacteria 1662
148 Ga0068851_10003876 3300005834 Bacteria 6697
149 Ga0068851_10009411 3300005834 Bacteria 4543
150 Ga0068870_10033540 3300005840 Bacteria 2620
151 Ga0068870_10131204 3300005840 Bacteria 1456
152 Ga0068863_100001961 3300005841 Bacteria 20447
153 Ga0068863_100138621 3300005841 Bacteria 2324
154 Ga0068863_100264835 3300005841 Bacteria 1662
155 Ga0068858_100001063 3300005842 Bacteria 28439
156 Ga0068858_100080260 3300005842 Bacteria 3031
157 Ga0068858_100549613 3300005842 Bacteria 1118
158 Ga0068860_100100415 3300005843 Bacteria 2761
159 Ga0068860_100147325 3300005843 Bacteria 2265
160 Ga0068860_101177625 3300005843 Bacteria 786
161 Ga0068862_100005659 3300005844 Bacteria 10428
162 Ga0068862_100264722 3300005844 Bacteria 1570
163 Ga0068862_100759856 3300005844 Bacteria 944
164 Ga0070717_10028934 3300006028 Bacteria 4441
165 Ga0075365_10330841 3300006038 Bacteria 1073
166 Ga0070716_100030809 3300006173 Bacteria 2914
167 Ga0070712_100010413 3300006175 Bacteria 5866
168 Ga0097621_100104514 3300006237 Bacteria 2387
169 Ga0097621_100827397 3300006237 Bacteria 859
170 Ga0068871_100013156 3300006358 Bacteria 6136
171 Ga0068865_100004584 3300006881 Bacteria 8340
172 Ga0068865_100277693 3300006881 Bacteria 1333
173 Ga0097620_100003354 3300006931 Bacteria 16292
174 Ga0097620_100014673 3300006931 Bacteria 7873
175 Ga0097620_100069748 3300006931 Bacteria 3550
176 Ga0097620_100106595 3300006931 Bacteria 2862
177 Ga0097620_100552648 3300006931 Bacteria 1246
178 Ga0105240_10373909 3300009093 Bacteria 1611
179 Ga0105245_10017352 3300009098 Bacteria 6280
180 Ga0105245_10019353 3300009098 Bacteria 5961
181 Ga0114129_10593315 3300009147 Bacteria 1436
182 Ga0105243_10244968 3300009148 Bacteria 1597
183 Ga0105242_10002696 3300009176 Bacteria 13894
184 Ga0105242_10296319 3300009176 Bacteria 1474
185 Ga0105248_10057467 3300009177 Bacteria 4367
186 Ga0105248_10097345 3300009177 Bacteria 3315
187 Ga0105248_10123267 3300009177 Bacteria 2924
188 Ga0105248_10150526 3300009177 Bacteria 2625
189 Ga0105248_10200160 3300009177 Bacteria 2250
190 Ga0105248_10239202 3300009177 Bacteria 2044
191 Ga0105248_10285213 3300009177 Bacteria 1859
192 Ga0105248_10495441 3300009177 Bacteria 1377
193 Ga0105248_11442376 3300009177 Bacteria 779
194 Ga0105237_10554693 3300009545 Bacteria 1156
195 Ga0105238_10074784 3300009551 Bacteria 3380
196 Ga0105238_10281994 3300009551 Bacteria 1643
197 Ga0105238_10389906 3300009551 Bacteria 1385
198 Ga0105239_10046622 3300010375 Bacteria 4749
199 Ga0157373_10119369 3300013100 Bacteria 1853
200 Ga0157373_10187142 3300013100 Bacteria 1459
201 Ga0157371_10005796 3300013102 Bacteria 10340
202 Ga0157371_10261242 3300013102 Bacteria 1248
203 Ga0157370_10086037 3300013104 Bacteria 2954
204 Ga0157370_10339489 3300013104 Bacteria 1385
205 Ga0157369_10206595 3300013105 Bacteria 2059
206 Ga0157374_10000688 3300013296 Bacteria 29808
207 Ga0157374_10018582 3300013296 Bacteria 6138
208 Ga0157374_10067803 3300013296 Bacteria 3356
209 Ga0157374_10419440 3300013296 Bacteria 1337
210 Ga0157378_10182570 3300013297 Bacteria 1974
211 Ga0163162_10216505 3300013306 Bacteria 2045
212 Ga0163162_10240053 3300013306 Bacteria 1943
213 Ga0157372_10506167 3300013307 Bacteria 1408
214 Ga0157372_11024391 3300013307 Bacteria 956
215 Ga0157375_10028047 3300013308 Bacteria 5272
216 Ga0157375_10104755 3300013308 Bacteria 2918
217 Ga0157375_10118248 3300013308 Bacteria 2757
218 Ga0157375_10184436 3300013308 Bacteria 2239
219 Ga0157375_10541402 3300013308 Bacteria 1326
220 Ga0163163_10033263 3300014325 Bacteria 4987
221 Ga0163163_10712313 3300014325 Bacteria 1067
222 Ga0157379_10036388 3300014968 Bacteria 4390
223 Ga0157379_10129648 3300014968 Bacteria 2269
224 Ga0157379_10193202 3300014968 Bacteria 1839
225 Ga0157376_10020862 3300014969 Bacteria 5078
226 Ga0213876_10074375 3300021384 Bacteria 1794
227 Ga0213875_10004443 3300021388 Bacteria 7699
228 Ga0207697_10008065 3300025315 Bacteria 4647
229 Ga0207697_10011363 3300025315 Bacteria 3767
230 Ga0207656_10168284 3300025321 Bacteria 1046
231 Ga0207682_10003391 3300025893 Bacteria 6936
232 Ga0207682_10012163 3300025893 Bacteria 3360
233 Ga0207682_10049271 3300025893 Bacteria 1739
234 Ga0207642_10125270 3300025899 Bacteria 1332
235 Ga0207688_10025127 3300025901 Bacteria 3269
236 Ga0207680_10004711 3300025903 Bacteria 6484
237 Ga0207680_10015753 3300025903 Bacteria 3953
238 Ga0207680_10145817 3300025903 Bacteria 1573
239 Ga0207647_10004799 3300025904 Bacteria 10005
240 Ga0207647_10014821 3300025904 Bacteria 5362
241 Ga0207647_10157330 3300025904 Bacteria 1326
242 Ga0207645_10023605 3300025907 Bacteria 3994
243 Ga0207643_10096149 3300025908 Bacteria 1732
244 Ga0207643_10270556 3300025908 Bacteria 1051
245 Ga0207705_10017883 3300025909 Bacteria 5070
246 Ga0207705_10028159 3300025909 Bacteria 4006
247 Ga0207705_10099952 3300025909 Bacteria 2133
248 Ga0207705_10137685 3300025909 Bacteria 1821
249 Ga0207705_10182489 3300025909 Bacteria 1584
250 Ga0207705_10208989 3300025909 Bacteria 1480
251 Ga0207684_10322330 3300025910 Bacteria 1332
252 Ga0207707_10257532 3300025912 Bacteria 1515
253 Ga0207707_10576242 3300025912 Unclassified 954
254 Ga0207695_10252223 3300025913 Bacteria 1664
255 Ga0207693_10020143 3300025915 Bacteria 5306
256 Ga0207657_10031106 3300025919 Bacteria 4839
257 Ga0207657_10039319 3300025919 Bacteria 4205
258 Ga0207657_10042957 3300025919 Bacteria 3985
259 Ga0207657_10132709 3300025919 Bacteria 2040
260 Ga0207657_10207610 3300025919 Bacteria 1573
261 Ga0207657_10231699 3300025919 Bacteria 1477
262 Ga0207657_10260301 3300025919 Bacteria 1381
263 Ga0207657_10314356 3300025919 Bacteria 1239
264 Ga0207657_10330439 3300025919 Bacteria 1204
265 Ga0207657_10656807 3300025919 Bacteria 816
266 Ga0207649_10028121 3300025920 Bacteria 3308
267 Ga0207649_10095519 3300025920 Bacteria 1956
268 Ga0207649_10214436 3300025920 Bacteria 1367
269 Ga0207649_10372656 3300025920 Bacteria 1062
270 Ga0207652_10258022 3300025921 Bacteria 1572
271 Ga0207681_10176013 3300025923 Bacteria 1626
272 Ga0207694_10087365 3300025924 Bacteria 2456
273 Ga0207650_10442296 3300025925 Bacteria 1081
274 Ga0207659_10054284 3300025926 Bacteria 2861
275 Ga0207687_10294734 3300025927 Bacteria 1305
276 Ga0207664_10092944 3300025929 Bacteria 2477
277 Ga0207644_10000196 3300025931 Bacteria 43119
278 Ga0207644_10024755 3300025931 Bacteria 4123
279 Ga0207644_10083987 3300025931 Bacteria 2359
280 Ga0207644_10094735 3300025931 Bacteria 2231
281 Ga0207644_10211758 3300025931 Bacteria 1533
282 Ga0207644_10265214 3300025931 Bacteria 1374
283 Ga0207644_10336153 3300025931 Bacteria 1224
284 Ga0207690_10056203 3300025932 Bacteria 2654
285 Ga0207690_10059565 3300025932 Bacteria 2587
286 Ga0207690_10076399 3300025932 Bacteria 2326
287 Ga0207706_10000840 3300025933 Bacteria 31741
288 Ga0207706_10004449 3300025933 Bacteria 13166
289 Ga0207706_10022419 3300025933 Bacteria 5668
290 Ga0207706_10215242 3300025933 Bacteria 1683
291 Ga0207706_10243416 3300025933 Bacteria 1572
292 Ga0207709_10331398 3300025935 Bacteria 1143
293 Ga0207670_10178205 3300025936 Bacteria 1599
294 Ga0207669_10061892 3300025937 Bacteria 2302
295 Ga0207704_10638721 3300025938 Bacteria 875
296 Ga0207691_10000705 3300025940 Bacteria 33075
297 Ga0207691_10015370 3300025940 Bacteria 7283
298 Ga0207691_10026477 3300025940 Bacteria 5440
299 Ga0207691_10059530 3300025940 Bacteria 3472
300 Ga0207691_10103966 3300025940 Bacteria 2532
301 Ga0207691_10526373 3300025940 Bacteria 1003
302 Ga0207691_10591179 3300025940 Bacteria 940
303 Ga0207711_10000826 3300025941 Bacteria 30270
304 Ga0207711_10005440 3300025941 Bacteria 10766
305 Ga0207711_10005651 3300025941 Bacteria 10566
306 Ga0207711_10398973 3300025941 Bacteria 1278
307 Ga0207711_10727142 3300025941 Bacteria 926
308 Ga0207689_10010936 3300025942 Bacteria 7801
309 Ga0207661_10234000 3300025944 Bacteria 1628
310 Ga0207661_10412039 3300025944 Bacteria 1227
311 Ga0207679_10023034 3300025945 Bacteria 4251
312 Ga0207679_10076662 3300025945 Bacteria 2541
313 Ga0207679_10086567 3300025945 Bacteria 2410
314 Ga0207679_10122637 3300025945 Bacteria 2072
315 Ga0207679_10367917 3300025945 Bacteria 1257
316 Ga0207667_10060438 3300025949 Bacteria 3966
317 Ga0207667_10136274 3300025949 Bacteria 2528
318 Ga0207651_10000999 3300025960 Bacteria 12480
319 Ga0207651_10026562 3300025960 Bacteria 3620
320 Ga0207651_10078621 3300025960 Bacteria 2367
321 Ga0207651_10095478 3300025960 Bacteria 2190
322 Ga0207651_10160136 3300025960 Bacteria 1763
323 Ga0207651_10370540 3300025960 Bacteria 1211
324 Ga0207668_10191711 3300025972 Bacteria 1620
325 Ga0207668_10286224 3300025972 Bacteria 1354
326 Ga0207668_10597214 3300025972 Bacteria 961
327 Ga0207640_10179242 3300025981 Bacteria 1587
328 Ga0207640_10246742 3300025981 Bacteria 1383
329 Ga0207640_10713191 3300025981 Bacteria 861
330 Ga0207658_10008208 3300025986 Bacteria 7114
331 Ga0207658_10021355 3300025986 Bacteria 4493
332 Ga0207658_10033791 3300025986 Bacteria 3649
333 Ga0207658_10156901 3300025986 Bacteria 1861
334 Ga0207658_10707872 3300025986 Bacteria 910
335 Ga0207658_10769948 3300025986 Bacteria 872
336 Ga0207677_10009046 3300026023 Bacteria 5589
337 Ga0207677_10018096 3300026023 Bacteria 4222
338 Ga0207677_10021077 3300026023 Bacteria 3974
339 Ga0207677_10117830 3300026023 Bacteria 1991
340 Ga0207677_10409135 3300026023 Bacteria 1152
341 Ga0207703_10008014 3300026035 Bacteria 8349
342 Ga0207703_10069607 3300026035 Bacteria 2902
343 Ga0207703_10182061 3300026035 Bacteria 1855
344 Ga0207703_10337034 3300026035 Bacteria 1385
345 Ga0207639_10107899 3300026041 Bacteria 2263
346 Ga0207639_10135502 3300026041 Bacteria 2044
347 Ga0207639_10158071 3300026041 Bacteria 1907
348 Ga0207639_10166460 3300026041 Bacteria 1863
349 Ga0207678_10001628 3300026067 Bacteria 20589
350 Ga0207678_10004245 3300026067 Bacteria 12855
351 Ga0207678_10009726 3300026067 Bacteria 8455
352 Ga0207678_10010002 3300026067 Bacteria 8323
353 Ga0207678_10060651 3300026067 Bacteria 3253
354 Ga0207678_10151122 3300026067 Bacteria 1983
355 Ga0207678_10163402 3300026067 Bacteria 1902
356 Ga0207702_10027154 3300026078 Bacteria 4753
357 Ga0207641_10029710 3300026088 Bacteria 4521
358 Ga0207641_10060791 3300026088 Bacteria 3221
359 Ga0207641_10188806 3300026088 Bacteria 1892
360 Ga0207648_10000889 3300026089 Bacteria 33700
361 Ga0207648_10009239 3300026089 Bacteria 9469
362 Ga0207648_10239787 3300026089 Bacteria 1614
363 Ga0207676_10094294 3300026095 Bacteria 2466
364 Ga0207676_10143031 3300026095 Bacteria 2050
365 Ga0207676_10395544 3300026095 Bacteria 1290
366 Ga0207674_10350189 3300026116 Bacteria 1428
367 Ga0207675_100610585 3300026118 Bacteria 1094
368 Ga0207683_10001943 3300026121 Bacteria 18297
369 Ga0207683_10002694 3300026121 Bacteria 15527
370 Ga0207683_10142139 3300026121 Bacteria 2163
371 Ga0207683_10292282 3300026121 Bacteria 1490
372 Ga0207698_10005796 3300026142 Bacteria 7668
373 Ga0207698_10252468 3300026142 Bacteria 1615
374 Ga0207698_10313869 3300026142 Bacteria 1465
375 Ga0268266_10029060 3300028379 Bacteria 4698
376 Ga0268266_10166205 3300028379 Bacteria 1999
377 Ga0268265_10003952 3300028380 Bacteria 10443
378 Ga0268265_10260527 3300028380 Bacteria 1541
379 Ga0268265_10260898 3300028380 Bacteria 1540
380 Ga0268264_10124925 3300028381 Bacteria 2273
381 Ga0268264_10144671 3300028381 Bacteria 2124
382 Ga0268264_10363903 3300028381 Bacteria 1380
383 Ga0307408_100032429 3300031548 Bacteria 3642
384 Ga0307408_100042329 3300031548 Bacteria 3234
385 Ga0307405_10012233 3300031731 Bacteria 4533
386 Ga0307405_10131603 3300031731 Bacteria 1729
387 Ga0307405_10286788 3300031731 Bacteria 1242
388 Ga0307405_10460207 3300031731 Bacteria 1011
389 Ga0307413_10332985 3300031824 Bacteria 1164
390 Ga0307410_10002455 3300031852 Bacteria 8952
391 Ga0307410_10064236 3300031852 Bacteria 2521
392 Ga0307410_10476803 3300031852 Bacteria 1023
393 Ga0307406_10009362 3300031901 Bacteria 5491
394 Ga0307407_10051046 3300031903 Bacteria 2369
395 Ga0307407_10199116 3300031903 Bacteria 1341
396 Ga0307412_10020992 3300031911 Bacteria 3983
397 Ga0307412_10064806 3300031911 Bacteria 2470
398 Ga0307409_100182249 3300031995 Bacteria 1860
399 Ga0307409_100643043 3300031995 Bacteria 1053
400 Ga0307414_10254795 3300032004 Bacteria 1461
401 Ga0307411_10061374 3300032005 Bacteria 2502
402 Ga0307411_10272209 3300032005 Bacteria 1343
403 Ga0307411_10759268 3300032005 Bacteria 850
404 Ga0307415_100080796 3300032126 Bacteria 2320
405 Ga0307415_100102676 3300032126 Bacteria 2101
406 Ga0373928_0097196 3300035084 Bacteria 763
407 Ga0373923_0178101 3300035111 Bacteria 976
408 Ga0373935_0024057 3300035692 Bacteria 3746
409 Ga0395899_0000103 3300037312 Bacteria 147274
410 Ga0395899_0031413 3300037312 Bacteria 3991
411 Ga0395899_0038808 3300037312 Bacteria 3566
412 Ga0395899_0084262 3300037312 Bacteria 2310
413 Ga0395899_0100349 3300037312 Bacteria 2090
414 Ga0395900_0000031 3300037418 Bacteria 262393
415 Ga0395900_0000862 3300037418 Bacteria 40012
416 Ga0395900_0002384 3300037418 Bacteria 20759
417 Ga0395900_0013399 3300037418 Bacteria 8377
418 Ga0395900_0063590 3300037418 Bacteria 3793
419 Ga0395900_0203635 3300037418 Bacteria 2001
420 Ga0395900_0263696 3300037418 Bacteria 1719
421 Ga0395900_0284787 3300037418 Bacteria 1643
422 Ga0395900_0289330 3300037418 Bacteria 1627
423 Ga0395900_0434466 3300037418 Bacteria 1271
424 Ga0395900_0597365 3300037418 Bacteria 1044
425 Ga0395898_0000053 3300037466 Bacteria 279600
426 Ga0395898_0003373 3300037466 Bacteria 17893
427 Ga0395898_0055086 3300037466 Bacteria 3879
428 Ga0395898_0058977 3300037466 Bacteria 3735
429 Ga0395898_0085812 3300037466 Bacteria 3034
430 Ga0395898_0157671 3300037466 Bacteria 2171
431 Ga0395898_0211248 3300037466 Bacteria 1851
432 Ga0395898_0241905 3300037466 Bacteria 1721
433 Ga0395898_0250029 3300037466 Bacteria 1691
434 Ga0395898_0376696 3300037466 Bacteria 1353
435 Ga0395905_0000031 3300037471 Bacteria 286757
436 Ga0395905_0000365 3300037471 Bacteria 64175
437 Ga0395905_0027046 3300037471 Bacteria 5409
438 Ga0395905_0066499 3300037471 Bacteria 3375
439 Ga0395905_0099067 3300037471 Bacteria 2737
440 Ga0395905_0153227 3300037471 Bacteria 2168
441 Ga0395905_0342313 3300037471 Bacteria 1386
442 Ga0395905_0488765 3300037471 Bacteria 1130
443 Ga0395905_0498737 3300037471 Bacteria 1117
444 Ga0436364_1311127 3300037853 Bacteria 690
445 Ga0436364_1360610 3300037853 Bacteria 32497
446 Ga0395901_0000163 3300038443 Bacteria 87103
447 Ga0395901_0002051 3300038443 Bacteria 20650
448 Ga0395901_0035805 3300038443 Bacteria 5129
449 Ga0395901_0042145 3300038443 Bacteria 4732
450 Ga0395901_0134999 3300038443 Bacteria 2593
451 Ga0395901_0172036 3300038443 Bacteria 2272
452 Ga0395901_0210614 3300038443 Bacteria 2034
453 Ga0395901_0245226 3300038443 Bacteria 1867
454 Ga0395901_0251891 3300038443 Bacteria 1839
455 Ga0395901_0330627 3300038443 Bacteria 1575
456 Ga0395901_0803286 3300038443 Bacteria 929
457 Ga0395901_0939074 3300038443 Bacteria 844
458 Ga0436365_0504349 3300039437 Bacteria 9584
459 Ga0436363_0214937 3300039450 Bacteria 778
460 Ga0439438_031102 3300041405 Bacteria 1420
461 Ga0450905_005530 3300042142 Bacteria 1698
462 Ga0450889_000034 3300042144 Bacteria 11809
463 Ga0439464_0007229 3300042439 Bacteria 2902
464 Ga0466965_0161247 3300044683 Bacteria 1176
465 Ga0466963_0003565 3300044694 Bacteria 8939
466 Ga0466963_0007455 3300044694 Bacteria 6524
467 Ga0466963_0050713 3300044694 Bacteria 2747
468 Ga0466963_0117592 3300044694 Bacteria 1827
469 Ga0466971_0001977 3300044719 Bacteria 8670
470 Ga0466957_0026243 3300044842 Bacteria 3455
471 Ga0466960_0006351 3300044901 Bacteria 4739
472 Ga0466960_0261844 3300044901 Bacteria 964
473 Ga0466958_0003049 3300045836 Bacteria 8588
474 Ga0466967_0036370 3300045976 Bacteria 4203
475 Ga0466967_0052221 3300045976 Bacteria 3587
476 Ga0466967_0053129 3300045976 Bacteria 3560
477 Ga0466967_0183430 3300045976 Bacteria 1975
478 Ga0466967_0501958 3300045976 Bacteria 1191
479 Ga0495598_0007122 3300046537 Bacteria 2553
480 Ga0495633_0077772 3300046558 Bacteria 1545
481 Ga0495669_0021229 3300046684 Bacteria 2817
482 Ga0495669_0040505 3300046684 Bacteria 2066
483 Ga0495670_0000002 3300046691 Bacteria 601814
484 Ga0495670_0001581 3300046691 Bacteria 11130
485 Ga0495649_0117925 3300046694 Bacteria 1405
486 Ga0496100_0005386 3300048903 Bacteria 6884
487 Ga0496101_0006613 3300048904 Bacteria 7469
488 Ga0496101_0020211 3300048904 Bacteria 4553
489 Ga0496102_0046197 3300048905 Bacteria 3954
490 Ga0496102_0403847 3300048905 Bacteria 1284
491 Ga0496103_0010493 3300048906 Bacteria 5483
492 Ga0496104_0034086 3300048907 Bacteria 4745
493 Ga0496105_0097795 3300048908 Bacteria 2424
494 Ga0496106_0003808 3300048909 Bacteria 11240
495 Ga0496106_0176142 3300048909 Bacteria 1697
496 Ga0496107_0009640 3300048910 Bacteria 6695
497 Ga0496107_0381868 3300048910 Bacteria 1048
498 Ga0496108_0000396 3300048911 Bacteria 35971
499 Ga0496108_0313186 3300048911 Bacteria 1368
500 Ga0496108_0487484 3300048911 Bacteria 1077
501 Ga0496109_0003559 3300048912 Bacteria 13006
502 Ga0496109_0199074 3300048912 Bacteria 1883
503 Ga0496110_0002181 3300048913 Bacteria 14631
504 Ga0496111_0000917 3300048914 Bacteria 16063
505 Ga0496112_0003726 3300048915 Bacteria 12722
506 Ga0496112_0054159 3300048915 Bacteria 3941
507 Ga0496112_0165703 3300048915 Bacteria 2176
508 Ga0496113_0002217 3300048916 Bacteria 11210
509 Ga0496113_0107789 3300048916 Bacteria 2165
510 Ga0496114_0000152 3300048917 Bacteria 50128
511 Ga0496115_0011238 3300048918 Bacteria 6709
512 Ga0501067_0236146 3300049583 Bacteria 1017
513 Ga0501249_034346 3300049679 Bacteria 1137
514 nmdc:mga05p37_230730_c1 3300050507 Bacteria 2230
515 Ga0500583_0317756 3300053092 Bacteria 760
516 Ga0500641_0005984 3300053096 Bacteria 4305
517 Ga0500559_0224704 3300053136 Bacteria 885
518 Ga0500588_0042173 3300053146 Bacteria 1381
519 Ga0500645_005952 3300053730 Bacteria 4415
520 Ga0466962_0003110 3300061719 Bacteria 7886
521 Ga0395899_0295250
522 JGI24747J21853_1001580
523 JGI24739J22299_10008945
524 JGI24737J22298_10026431
525 JGI24735J21928_10031377
526 JGI24735J21928_10035780
527 JGI24735J21928_10040219
528 JGI24745J21846_1002754
529 JGI24738J21930_10018195
530 JGI24744J21845_10000287
531 rootH1_10208177
532 Ga0070658_10026100
533 Ga0070658_10033381
534 Ga0070658_10076276
535 Ga0070658_10142407
536 Ga0070658_10577640
537 Ga0070658_10710753
538 Ga0070676_10046893
539 Ga0070683_100295705
540 Ga0070690_100045194
541 Ga0070690_100052565
542 Ga0070670_100030359
543 Ga0070670_100124951
544 Ga0070670_100181430
545 Ga0070670_100279175
546 Ga0068869_100059083
547 Ga0070666_10007245
548 Ga0070666_10018022
549 Ga0070666_10018242
550 Ga0070682_100354673
551 Ga0068868_100000237
552 Ga0068868_100006807
553 Ga0068868_100299968
554 Ga0070660_100003366
555 Ga0070660_100102984
556 Ga0070660_100179609
557 Ga0070660_100227333
558 Ga0070660_100434711
559 Ga0070689_100099347
560 Ga0070689_100451579
561 Ga0070661_100007217
562 Ga0070661_100043546
563 Ga0070661_100051844
564 Ga0070661_100109566
565 Ga0070692_10036947
566 Ga0070668_100006254
567 Ga0070668_100073903
568 Ga0070668_100145703
569 Ga0070668_100328395
570 Ga0070668_100336378
571 Ga0070669_100165589
572 Ga0070675_100087001
573 Ga0070675_100092888
574 Ga0070671_100013668
575 Ga0070671_100014207
576 Ga0070671_100015603
577 Ga0070671_100045988
578 Ga0070671_100077208
579 Ga0070671_100166042
580 Ga0070671_100218283
581 Ga0070674_100006593
582 Ga0070674_100006617
583 Ga0070674_100031836
584 Ga0070674_100032380
585 Ga0070673_100008272
586 Ga0070673_100013344
587 Ga0070673_100090533
588 Ga0070673_100168440
589 Ga0070673_100504370
590 Ga0070659_100023121
591 Ga0070659_100143512
592 Ga0070659_100149803
593 Ga0070659_100214018
594 Ga0070659_100248607
595 Ga0070667_100040495
596 Ga0070667_100122321
597 Ga0070667_100334121
598 Ga0070667_100385435
599 Ga0070667_100634877
600 Ga0070667_100832733
601 Ga0070714_100042688
602 Ga0070714_100374999
603 Ga0070713_100056520
604 Ga0070694_100167802
605 Ga0070663_100007211
606 Ga0070663_100021827
607 Ga0070663_100025599
608 Ga0070663_100061842
609 Ga0070663_100101244
610 Ga0070678_100021464
611 Ga0070678_100055768
612 Ga0070662_100003264
613 Ga0070662_100286832
614 Ga0070662_100302892
615 Ga0070662_101095666
616 Ga0070681_10531807
617 Ga0068867_100002869
618 Ga0068867_100058279
619 Ga0068867_100145751
620 Ga0068867_100154331
621 Ga0070685_10135386
622 Ga0070706_100248834
623 Ga0070679_100439976
624 Ga0068853_100036747
625 Ga0068853_100079809
626 Ga0070672_100000482
627 Ga0070672_100085728
628 Ga0070672_100118015
629 Ga0070672_100247642
630 Ga0070672_100851320
631 Ga0070672_100879626
632 Ga0070686_100129525
633 Ga0070695_100023104
634 Ga0070696_100006532
635 Ga0070693_100205124
636 Ga0070693_100318725
637 Ga0070665_100016225
638 Ga0070665_100138768
639 Ga0068855_100127353
640 Ga0068855_100853875
641 Ga0070664_100030419
642 Ga0070664_100038109
643 Ga0070664_100141257
644 Ga0070664_100191258
645 Ga0068857_100332360
646 Ga0068854_100015826
647 Ga0068854_100091847
648 Ga0068854_100366947
649 Ga0068856_100042138
650 Ga0068856_100278743
651 Ga0068856_100334270
652 Ga0068852_100012312
653 Ga0068852_100036248
654 Ga0068852_100074676
655 Ga0068852_100093094
656 Ga0068852_100242350
657 Ga0068859_100003354
658 Ga0068859_100014674
659 Ga0068859_100069745
660 Ga0068859_100106596
661 Ga0068859_100552657
662 Ga0068864_100089105
663 Ga0068864_100098577
664 Ga0068866_10004001
665 Ga0068866_10005219
666 Ga0068866_10131801
667 Ga0068861_100203868
668 Ga0068851_10003876
669 Ga0068851_10009411
670 Ga0068870_10033540
671 Ga0068870_10131204
672 Ga0068863_100001961
673 Ga0068863_100138621
674 Ga0068863_100264835
675 Ga0068858_100001063
676 Ga0068858_100080260
677 Ga0068858_100549613
678 Ga0068860_100100415
679 Ga0068860_100147325
680 Ga0068860_101177625
681 Ga0068862_100005659
682 Ga0068862_100264722
683 Ga0068862_100759856
684 Ga0070717_10028934
685 Ga0075365_10330841
686 Ga0070716_100030809
687 Ga0070712_100010413
688 Ga0097621_100104514
689 Ga0097621_100827397
690 Ga0068871_100013156
691 Ga0068865_100004584
692 Ga0068865_100277693
693 Ga0097620_100003354
694 Ga0097620_100014673
695 Ga0097620_100069748
696 Ga0097620_100106595
697 Ga0097620_100552648
698 Ga0105240_10373909
699 Ga0105245_10017352
700 Ga0105245_10019353
701 Ga0114129_10593315
702 Ga0105243_10244968
703 Ga0105242_10002696
704 Ga0105242_10296319
705 Ga0105248_10057467
706 Ga0105248_10097345
707 Ga0105248_10123267
708 Ga0105248_10150526
709 Ga0105248_10200160
710 Ga0105248_10239202
711 Ga0105248_10285213
712 Ga0105248_10495441
713 Ga0105248_11442376
714 Ga0105237_10554693
715 Ga0105238_10074784
716 Ga0105238_10281994
717 Ga0105238_10389906
718 Ga0105239_10046622
719 Ga0157373_10119369
720 Ga0157373_10187142
721 Ga0157371_10005796
722 Ga0157371_10261242
723 Ga0157370_10086037
724 Ga0157370_10339489
725 Ga0157369_10206595
726 Ga0157374_10000688
727 Ga0157374_10018582
728 Ga0157374_10067803
729 Ga0157374_10419440
730 Ga0157378_10182570
731 Ga0163162_10216505
732 Ga0163162_10240053
733 Ga0157372_10506167
734 Ga0157372_11024391
735 Ga0157375_10028047
736 Ga0157375_10104755
737 Ga0157375_10118248
738 Ga0157375_10184436
739 Ga0157375_10541402
740 Ga0163163_10033263
741 Ga0163163_10712313
742 Ga0157379_10036388
743 Ga0157379_10129648
744 Ga0157379_10193202
745 Ga0157376_10020862
746 Ga0213876_10074375
747 Ga0213875_10004443
748 Ga0207697_10008065
749 Ga0207697_10011363
750 Ga0207656_10168284
751 Ga0207682_10003391
752 Ga0207682_10012163
753 Ga0207682_10049271
754 Ga0207642_10125270
755 Ga0207688_10025127
756 Ga0207680_10004711
757 Ga0207680_10015753
758 Ga0207680_10145817
759 Ga0207647_10004799
760 Ga0207647_10014821
761 Ga0207647_10157330
762 Ga0207645_10023605
763 Ga0207643_10096149
764 Ga0207643_10270556
765 Ga0207705_10017883
766 Ga0207705_10028159
767 Ga0207705_10099952
768 Ga0207705_10137685
769 Ga0207705_10182489
770 Ga0207705_10208989
771 Ga0207684_10322330
772 Ga0207707_10257532
773 Ga0207707_10576242
774 Ga0207695_10252223
775 Ga0207693_10020143
776 Ga0207657_10031106
777 Ga0207657_10039319
778 Ga0207657_10042957
779 Ga0207657_10132709
780 Ga0207657_10207610
781 Ga0207657_10231699
782 Ga0207657_10260301
783 Ga0207657_10314356
784 Ga0207657_10330439
785 Ga0207657_10656807
786 Ga0207649_10028121
787 Ga0207649_10095519
788 Ga0207649_10214436
789 Ga0207649_10372656
790 Ga0207652_10258022
791 Ga0207681_10176013
792 Ga0207694_10087365
793 Ga0207650_10442296
794 Ga0207659_10054284
795 Ga0207687_10294734
796 Ga0207664_10092944
797 Ga0207644_10000196
798 Ga0207644_10024755
799 Ga0207644_10083987
800 Ga0207644_10094735
801 Ga0207644_10211758
802 Ga0207644_10265214
803 Ga0207644_10336153
804 Ga0207690_10056203
805 Ga0207690_10059565
806 Ga0207690_10076399
807 Ga0207706_10000840
808 Ga0207706_10004449
809 Ga0207706_10022419
810 Ga0207706_10215242
811 Ga0207706_10243416
812 Ga0207709_10331398
813 Ga0207670_10178205
814 Ga0207669_10061892
815 Ga0207704_10638721
816 Ga0207691_10000705
817 Ga0207691_10015370
818 Ga0207691_10026477
819 Ga0207691_10059530
820 Ga0207691_10103966
821 Ga0207691_10526373
822 Ga0207691_10591179
823 Ga0207711_10000826
824 Ga0207711_10005440
825 Ga0207711_10005651
826 Ga0207711_10398973
827 Ga0207711_10727142
828 Ga0207689_10010936
829 Ga0207661_10234000
830 Ga0207661_10412039
831 Ga0207679_10023034
832 Ga0207679_10076662
833 Ga0207679_10086567
834 Ga0207679_10122637
835 Ga0207679_10367917
836 Ga0207667_10060438
837 Ga0207667_10136274
838 Ga0207651_10000999
839 Ga0207651_10026562
840 Ga0207651_10078621
841 Ga0207651_10095478
842 Ga0207651_10160136
843 Ga0207651_10370540
844 Ga0207668_10191711
845 Ga0207668_10286224
846 Ga0207668_10597214
847 Ga0207640_10179242
848 Ga0207640_10246742
849 Ga0207640_10713191
850 Ga0207658_10008208
851 Ga0207658_10021355
852 Ga0207658_10033791
853 Ga0207658_10156901
854 Ga0207658_10707872
855 Ga0207658_10769948
856 Ga0207677_10009046
857 Ga0207677_10018096
858 Ga0207677_10021077
859 Ga0207677_10117830
860 Ga0207677_10409135
861 Ga0207703_10008014
862 Ga0207703_10069607
863 Ga0207703_10182061
864 Ga0207703_10337034
865 Ga0207639_10107899
866 Ga0207639_10135502
867 Ga0207639_10158071
868 Ga0207639_10166460
869 Ga0207678_10001628
870 Ga0207678_10004245
871 Ga0207678_10009726
872 Ga0207678_10010002
873 Ga0207678_10060651
874 Ga0207678_10151122
875 Ga0207678_10163402
876 Ga0207702_10027154
877 Ga0207641_10029710
878 Ga0207641_10060791
879 Ga0207641_10188806
880 Ga0207648_10000889
881 Ga0207648_10009239
882 Ga0207648_10239787
883 Ga0207676_10094294
884 Ga0207676_10143031
885 Ga0207676_10395544
886 Ga0207674_10350189
887 Ga0207675_100610585
888 Ga0207683_10001943
889 Ga0207683_10002694
890 Ga0207683_10142139
891 Ga0207683_10292282
892 Ga0207698_10005796
893 Ga0207698_10252468
894 Ga0207698_10313869
895 Ga0268266_10029060
896 Ga0268266_10166205
897 Ga0268265_10003952
898 Ga0268265_10260527
899 Ga0268265_10260898
900 Ga0268264_10124925
901 Ga0268264_10144671
902 Ga0268264_10363903
903 Ga0307408_100032429
904 Ga0307408_100042329
905 Ga0307405_10012233
906 Ga0307405_10131603
907 Ga0307405_10286788
908 Ga0307405_10460207
909 Ga0307413_10332985
910 Ga0307410_10002455
911 Ga0307410_10064236
912 Ga0307410_10476803
913 Ga0307406_10009362
914 Ga0307407_10051046
915 Ga0307407_10199116
916 Ga0307412_10020992
917 Ga0307412_10064806
918 Ga0307409_100182249
919 Ga0307409_100643043
920 Ga0307414_10254795
921 Ga0307411_10061374
922 Ga0307411_10272209
923 Ga0307411_10759268
924 Ga0307415_100080796
925 Ga0307415_100102676
926 Ga0373928_0097196
927 Ga0373923_0178101
928 Ga0373935_0024057
929 Ga0395899_0000103
930 Ga0395899_0031413
931 Ga0395899_0038808
932 Ga0395899_0084262
933 Ga0395899_0100349
934 Ga0395900_0000031
935 Ga0395900_0000862
936 Ga0395900_0002384
937 Ga0395900_0013399
938 Ga0395900_0063590
939 Ga0395900_0203635
940 Ga0395900_0263696
941 Ga0395900_0284787
942 Ga0395900_0289330
943 Ga0395900_0434466
944 Ga0395900_0597365
945 Ga0395898_0000053
946 Ga0395898_0003373
947 Ga0395898_0055086
948 Ga0395898_0058977
949 Ga0395898_0085812
950 Ga0395898_0157671
951 Ga0395898_0211248
952 Ga0395898_0241905
953 Ga0395898_0250029
954 Ga0395898_0376696
955 Ga0395905_0000031
956 Ga0395905_0000365
957 Ga0395905_0027046
958 Ga0395905_0066499
959 Ga0395905_0099067
960 Ga0395905_0153227
961 Ga0395905_0342313
962 Ga0395905_0488765
963 Ga0395905_0498737
964 Ga0436364_1311127
965 Ga0436364_1360610
966 Ga0395901_0000163
967 Ga0395901_0002051
968 Ga0395901_0035805
969 Ga0395901_0042145
970 Ga0395901_0134999
971 Ga0395901_0172036
972 Ga0395901_0210614
973 Ga0395901_0245226
974 Ga0395901_0251891
975 Ga0395901_0330627
976 Ga0395901_0803286
977 Ga0395901_0939074
978 Ga0436365_0504349
979 Ga0436363_0214937
980 Ga0439438_031102
981 Ga0450905_005530
982 Ga0450889_000034
983 Ga0439464_0007229
984 Ga0466965_0161247
985 Ga0466963_0003565
986 Ga0466963_0007455
987 Ga0466963_0050713
988 Ga0466963_0117592
989 Ga0466971_0001977
990 Ga0466957_0026243
991 Ga0466960_0006351
992 Ga0466960_0261844
993 Ga0466958_0003049
994 Ga0466967_0036370
995 Ga0466967_0052221
996 Ga0466967_0053129
997 Ga0466967_0183430
998 Ga0466967_0501958
999 Ga0495598_0007122
1000 Ga0495633_0077772
1001 Ga0495669_0021229
1002 Ga0495669_0040505
1003 Ga0495670_0000002
1004 Ga0495670_0001581
1005 Ga0495649_0117925
1006 Ga0496100_0005386
1007 Ga0496101_0006613
1008 Ga0496101_0020211
1009 Ga0496102_0046197
1010 Ga0496102_0403847
1011 Ga0496103_0010493
1012 Ga0496104_0034086
1013 Ga0496105_0097795
1014 Ga0496106_0003808
1015 Ga0496106_0176142
1016 Ga0496107_0009640
1017 Ga0496107_0381868
1018 Ga0496108_0000396
1019 Ga0496108_0313186
1020 Ga0496108_0487484
1021 Ga0496109_0003559
1022 Ga0496109_0199074
1023 Ga0496110_0002181
1024 Ga0496111_0000917
1025 Ga0496112_0003726
1026 Ga0496112_0054159
1027 Ga0496112_0165703
1028 Ga0496113_0002217
1029 Ga0496113_0107789
1030 Ga0496114_0000152
1031 Ga0496115_0011238
1032 Ga0501067_0236146
1033 Ga0501249_034346
1034 nmdc:mga05p37_230730_c1
1035 Ga0500583_0317756
1036 Ga0500641_0005984
1037 Ga0500559_0224704
1038 Ga0500588_0042173
1039 Ga0500645_005952
1040 Ga0466962_0003110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

10

211

0.94

PF13207

AAA_17

AAA domain

14

165

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fem-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli 0.8909 11 202
1cke-assembly1.cif.gz_A cmp kinase from escherichia coli free enzyme structure 0.8879 11 202
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8791 7 202
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8378 10 197
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.829 7 202
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8909 11 202 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8226 11 202 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7808 10 200 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7542 10 200 3.40.50.300
3w90A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7332 12 196 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A285M6Y7-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9387 7 203 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A3B0RXE6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9099 7 206 GO:0003866
GO:0005524
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431
AF-A0A2N2UIP7-F1-model_v4 Multifunctional fusion protein [Includes: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase)] 0.9001 11 202 GO:0003866
GO:0005524
GO:0005737
GO:0006220
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431
AF-A0A389M5X6-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.8987 9 204 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A0H3XH65-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.891 11 205 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431

Map