F458622

General Info

Members Datasets Scaffolds Average Seq Length
520 329 502 164

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515853823
Length 184
Sequence GLFGPYGELRHANPLDLGRTDRVSLYDIPLHTLTGKPGTLGDLAGKTLLVVNVASKCGLTPQYTGLERLQERYADQGFSVVGFPCNQFGGQEPGTAEEIQEFCSTTYGVTFPMFEKIEVNGPGRHPIYTELTATPDADGEAGDIQWNFEKFLIASDGTVINRFRPRTEPEDAAVVAAIEANLPA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
6 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
9 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
10 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
11 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
12 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
13 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
14 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
15 2922554459 Rhodococcus sp. 66b Isolate Unclassified
16 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
17 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
18 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
19 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
108 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
109 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 1.54
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 5.77
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1032784 3300001978 Bacteria 598
2 JGI24740J21852_10099037 3300001979 Bacteria 743
3 JGI24743J22301_10044772 3300001991 Bacteria 893
4 JGI24745J21846_1042702 3300002073 Bacteria 564
5 JGI24744J21845_10035094 3300002077 Bacteria 950
6 rootH2_10059946 3300003320 Bacteria 3835
7 Ga0070658_10185495 3300005327 Bacteria 1752
8 Ga0070676_10178240 3300005328 Bacteria 1380
9 Ga0070683_100010691 3300005329 Bacteria 7891
10 Ga0070690_100157638 3300005330 Bacteria 1553
11 Ga0068869_100273727 3300005334 Bacteria 1355
12 Ga0070666_10009723 3300005335 Bacteria 6008
13 Ga0070680_100075244 3300005336 Bacteria 2779
14 Ga0070682_100078446 3300005337 Bacteria 2130
15 Ga0068868_100139057 3300005338 Bacteria 1992
16 Ga0070660_100087569 3300005339 Bacteria 2451
17 Ga0070691_10025510 3300005341 Bacteria 2752
18 Ga0070661_100160380 3300005344 Bacteria 1703
19 Ga0070661_100236388 3300005344 Bacteria 1405
20 Ga0070668_100559205 3300005347 Bacteria 997
21 Ga0070675_100040688 3300005354 Bacteria 3795
22 Ga0070674_100129431 3300005356 Bacteria 1880
23 Ga0070673_100108404 3300005364 Bacteria 2299
24 Ga0070659_100150807 3300005366 Bacteria 1896
25 Ga0070667_100226641 3300005367 Bacteria 1665
26 Ga0070667_100502473 3300005367 Bacteria 1111
27 Ga0070714_100038216 3300005435 Bacteria 4036
28 Ga0070714_101156748 3300005435 Bacteria 754
29 Ga0070714_101228460 3300005435 Bacteria 731
30 Ga0070713_100062171 3300005436 Bacteria 3127
31 Ga0070713_100186538 3300005436 Bacteria 1867
32 Ga0070713_100218132 3300005436 Bacteria 1730
33 Ga0070710_10185113 3300005437 Bacteria 1306
34 Ga0070710_10243312 3300005437 Bacteria 1153
35 Ga0070710_10294223 3300005437 Bacteria 1058
36 Ga0070701_10003907 3300005438 Bacteria 5951
37 Ga0070711_100036343 3300005439 Bacteria 3300
38 Ga0070705_100019573 3300005440 Bacteria 3564
39 Ga0070700_100092717 3300005441 Bacteria 1974
40 Ga0070708_100294645 3300005445 Bacteria 1528
41 Ga0070708_100297924 3300005445 Bacteria 1518
42 Ga0070708_100624575 3300005445 Bacteria 1016
43 Ga0070663_100004385 3300005455 Bacteria 8285
44 Ga0070663_100088531 3300005455 Bacteria 2289
45 Ga0070663_100351212 3300005455 Bacteria 1194
46 Ga0070663_101041467 3300005455 Bacteria 713
47 Ga0070678_100354498 3300005456 Bacteria 1262
48 Ga0070662_100168674 3300005457 Bacteria 1717
49 Ga0070681_10147646 3300005458 Bacteria 2279
50 Ga0070681_11224222 3300005458 Bacteria 673
51 Ga0070685_10147211 3300005466 Bacteria 1489
52 Ga0070685_10790194 3300005466 Bacteria 699
53 Ga0070706_100010288 3300005467 Bacteria 8691
54 Ga0070706_100140518 3300005467 Bacteria 2254
55 Ga0070706_100486944 3300005467 Bacteria 1148
56 Ga0070707_100310916 3300005468 Bacteria 1531
57 Ga0070707_100398903 3300005468 Bacteria 1335
58 Ga0070698_100015097 3300005471 Bacteria 8165
59 Ga0070698_100033811 3300005471 Bacteria 5296
60 Ga0070698_100298504 3300005471 Bacteria 1542
61 Ga0070699_100125465 3300005518 Bacteria 2259
62 Ga0070679_100014169 3300005530 Bacteria 7650
63 Ga0070684_100055569 3300005535 Bacteria 3452
64 Ga0070684_100331080 3300005535 Bacteria 1399
65 Ga0068853_100123332 3300005539 Bacteria 2314
66 Ga0070672_100039666 3300005543 Bacteria 3608
67 Ga0070686_100018252 3300005544 Bacteria 4113
68 Ga0070695_100042959 3300005545 Bacteria 2872
69 Ga0070696_100032530 3300005546 Bacteria 3578
70 Ga0070693_100128722 3300005547 Bacteria 1579
71 Ga0070665_100021205 3300005548 Bacteria 6532
72 Ga0070665_100111257 3300005548 Bacteria 2741
73 Ga0070665_100826008 3300005548 Bacteria 940
74 Ga0070664_100004731 3300005564 Bacteria 10915
75 Ga0070664_100511166 3300005564 Bacteria 1108
76 Ga0068857_100049915 3300005577 Bacteria 3712
77 Ga0068857_100551503 3300005577 Bacteria 1086
78 Ga0068854_100123257 3300005578 Bacteria 1970
79 Ga0068856_100193149 3300005614 Bacteria 2049
80 Ga0068856_101152774 3300005614 Bacteria 792
81 Ga0068852_100057339 3300005616 Bacteria 3370
82 Ga0068852_100468324 3300005616 Bacteria 1250
83 Ga0068852_100758872 3300005616 Bacteria 982
84 Ga0068864_100205279 3300005618 Bacteria 1812
85 Ga0068864_100333654 3300005618 Bacteria 1427
86 Ga0068866_10090570 3300005718 Bacteria 1664
87 Ga0068861_100252515 3300005719 Bacteria 1505
88 Ga0068861_100702197 3300005719 Bacteria 940
89 Ga0068851_10094111 3300005834 Bacteria 1582
90 Ga0068870_10022978 3300005840 Bacteria 3070
91 Ga0068863_100222610 3300005841 Bacteria 1818
92 Ga0068863_100299162 3300005841 Bacteria 1561
93 Ga0068858_100340492 3300005842 Bacteria 1435
94 Ga0068860_100158977 3300005843 Bacteria 2178
95 Ga0068860_100218742 3300005843 Bacteria 1849
96 Ga0068862_100296463 3300005844 Bacteria 1486
97 Ga0068862_100445344 3300005844 Bacteria 1220
98 Ga0081455_10184341 3300005937 Bacteria 1578
99 Ga0081455_10564639 3300005937 Bacteria 749
100 Ga0081539_10000173 3300005985 Bacteria 151356
101 Ga0070717_10006637 3300006028 Bacteria 8527
102 Ga0070717_10010777 3300006028 Bacteria 6919
103 Ga0070717_10277113 3300006028 Bacteria 1487
104 Ga0075363_100002126 3300006048 Bacteria 7959
105 Ga0070715_10046792 3300006163 Bacteria 1841
106 Ga0070715_10130635 3300006163 Bacteria 1208
107 Ga0070716_100140893 3300006173 Bacteria 1537
108 Ga0070712_100003399 3300006175 Bacteria 9791
109 Ga0075367_10277460 3300006178 Bacteria 1053
110 Ga0075369_10169729 3300006186 Bacteria 1001
111 Ga0075370_10024270 3300006353 Bacteria 3348
112 Ga0068871_100114378 3300006358 Bacteria 2273
113 Ga0068871_100515832 3300006358 Bacteria 1079
114 Ga0075428_100015235 3300006844 Bacteria 8529
115 Ga0075434_100255138 3300006871 Bacteria 1772
116 Ga0075434_101121876 3300006871 Bacteria 799
117 Ga0099794_10128885 3300007265 Bacteria 1276
118 Ga0099795_10023434 3300007788 Bacteria 2049
119 Ga0105251_10145479 3300009011 Bacteria 1072
120 Ga0105250_10045362 3300009092 Bacteria 1762
121 Ga0105247_10005195 3300009101 Bacteria 8231
122 Ga0105243_10140680 3300009148 Bacteria 2059
123 Ga0105242_11629610 3300009176 Bacteria 680
124 Ga0105237_10004429 3300009545 Bacteria 16276
125 Ga0105238_10052473 3300009551 Bacteria 4099
126 Ga0105239_10007880 3300010375 Bacteria 12176
127 Ga0105239_10954837 3300010375 Bacteria 985
128 Ga0105246_10416534 3300011119 Bacteria 1120
129 Ga0105246_10477644 3300011119 Bacteria 1054
130 Ga0157335_1002836 3300012492 Bacteria 1073
131 Ga0157342_1005110 3300012507 Bacteria 1195
132 Ga0157338_1006795 3300012515 Bacteria 1068
133 Ga0157373_10455186 3300013100 Bacteria 921
134 Ga0157369_10195563 3300013105 Bacteria 2124
135 Ga0157374_10007942 3300013296 Bacteria 9063
136 Ga0163162_10305082 3300013306 Bacteria 1724
137 Ga0157372_10731192 3300013307 Bacteria 1151
138 Ga0163163_10216195 3300014325 Bacteria 1965
139 Ga0163163_10382478 3300014325 Bacteria 1465
140 Ga0157377_10020243 3300014745 Bacteria 3484
141 Ga0157379_10271451 3300014968 Bacteria 1542
142 Ga0182005_1200156 3300015265 Bacteria 600
143 Ga0197907_10830985 3300020069 Bacteria 1163
144 Ga0206356_11507630 3300020070 Bacteria 1100
145 Ga0206350_10314167 3300020080 Bacteria 1075
146 Ga0206353_10134612 3300020082 Bacteria 2135
147 Ga0224712_10051149 3300022467 Bacteria 1608
148 Ga0207656_10216315 3300025321 Bacteria 930
149 Ga0207692_10042711 3300025898 Bacteria 2252
150 Ga0207710_10013062 3300025900 Bacteria 3498
151 Ga0207688_10003159 3300025901 Bacteria 8988
152 Ga0207688_10059082 3300025901 Bacteria 2159
153 Ga0207680_10076775 3300025903 Bacteria 2087
154 Ga0207647_10018984 3300025904 Bacteria 4632
155 Ga0207699_10058598 3300025906 Bacteria 2304
156 Ga0207699_10116238 3300025906 Bacteria 1722
157 Ga0207643_10021986 3300025908 Bacteria 3510
158 Ga0207684_10009113 3300025910 Bacteria 8790
159 Ga0207684_10067359 3300025910 Bacteria 3043
160 Ga0207684_10261560 3300025910 Bacteria 1493
161 Ga0207654_10149709 3300025911 Bacteria 1497
162 Ga0207707_10025142 3300025912 Bacteria 5208
163 Ga0207707_10974110 3300025912 Bacteria 697
164 Ga0207671_10009509 3300025914 Bacteria 8120
165 Ga0207671_10270906 3300025914 Bacteria 1338
166 Ga0207693_10003995 3300025915 Bacteria 12535
167 Ga0207693_10006476 3300025915 Bacteria 9702
168 Ga0207693_10344097 3300025915 Bacteria 1167
169 Ga0207663_10040694 3300025916 Bacteria 2827
170 Ga0207663_10179348 3300025916 Bacteria 1511
171 Ga0207663_10290731 3300025916 Bacteria 1217
172 Ga0207662_10019679 3300025918 Bacteria 3845
173 Ga0207657_10100966 3300025919 Bacteria 2395
174 Ga0207646_10032714 3300025922 Bacteria 4705
175 Ga0207694_10096038 3300025924 Bacteria 2344
176 Ga0207694_10315505 3300025924 Bacteria 1289
177 Ga0207650_10251321 3300025925 Bacteria 1431
178 Ga0207659_10219597 3300025926 Bacteria 1527
179 Ga0207700_10024898 3300025928 Bacteria 4148
180 Ga0207700_10491374 3300025928 Bacteria 1085
181 Ga0207700_11081911 3300025928 Bacteria 717
182 Ga0207664_10006014 3300025929 Bacteria 8306
183 Ga0207664_10182491 3300025929 Bacteria 1802
184 Ga0207664_10311352 3300025929 Bacteria 1387
185 Ga0207664_10495711 3300025929 Bacteria 1093
186 Ga0207664_10559610 3300025929 Bacteria 1026
187 Ga0207644_10301427 3300025931 Bacteria 1291
188 Ga0207644_10579853 3300025931 Bacteria 930
189 Ga0207644_10719944 3300025931 Bacteria 833
190 Ga0207706_10232900 3300025933 Bacteria 1611
191 Ga0207691_10127428 3300025940 Bacteria 2251
192 Ga0207711_10264647 3300025941 Bacteria 1581
193 Ga0207689_10001334 3300025942 Bacteria 23807
194 Ga0207661_10286909 3300025944 Bacteria 1472
195 Ga0207679_10028423 3300025945 Bacteria 3880
196 Ga0207679_10385291 3300025945 Bacteria 1230
197 Ga0207667_10452628 3300025949 Bacteria 1304
198 Ga0207651_10255801 3300025960 Bacteria 1435
199 Ga0207712_10362689 3300025961 Bacteria 1208
200 Ga0207658_10196268 3300025986 Bacteria 1681
201 Ga0207677_10266549 3300026023 Bacteria 1399
202 Ga0207703_10626107 3300026035 Bacteria 1019
203 Ga0207639_10218364 3300026041 Bacteria 1645
204 Ga0207678_10002306 3300026067 Bacteria 17276
205 Ga0207678_10092312 3300026067 Bacteria 2588
206 Ga0207708_10011592 3300026075 Bacteria 6568
207 Ga0207708_10561166 3300026075 Bacteria 964
208 Ga0207708_10975175 3300026075 Bacteria 736
209 Ga0207702_10010214 3300026078 Bacteria 7859
210 Ga0207648_10113673 3300026089 Bacteria 2378
211 Ga0207676_10235363 3300026095 Bacteria 1640
212 Ga0207676_10521145 3300026095 Bacteria 1131
213 Ga0207674_10002042 3300026116 Bacteria 25622
214 Ga0207675_100014426 3300026118 Bacteria 7367
215 Ga0207675_100398089 3300026118 Bacteria 1357
216 Ga0207683_10009865 3300026121 Bacteria 8146
217 Ga0207683_10203526 3300026121 Bacteria 1800
218 Ga0207698_10162280 3300026142 Bacteria 1956
219 Ga0207698_10531178 3300026142 Bacteria 1150
220 Ga0268266_10080953 3300028379 Bacteria 2830
221 Ga0268266_10710078 3300028379 Bacteria 969
222 Ga0268266_11588408 3300028379 Bacteria 629
223 Ga0268265_10135390 3300028380 Bacteria 2054
224 Ga0268264_11601556 3300028381 Bacteria 662
225 Ga0307512_10038727 3300030522 Bacteria 4006
226 Ga0265762_1018174 3300030760 Bacteria 1282
227 Ga0265762_1041744 3300030760 Bacteria 899
228 Ga0307513_10698931 3300031456 Bacteria 720
229 Ga0307516_10864686 3300031730 Bacteria 569
230 Ga0307518_10047197 3300031838 Bacteria 3132
231 Ga0307518_10307597 3300031838 Bacteria 958
232 Ga0307406_10181706 3300031901 Bacteria 1532
233 Ga0307415_101836625 3300032126 Bacteria 587
234 Ga0307507_10004082 3300033179 Bacteria 26692
235 Ga0307510_10226632 3300033180 Bacteria 1375
236 Ga0316214_1011115 3300033545 Bacteria 1224
237 Ga0373930_0038965 3300034816 Bacteria 1006
238 Ga0373950_0050602 3300034818 Bacteria 815
239 Ga0373959_0036199 3300034820 Bacteria 1018
240 Ga0373926_0000876 3300035083 Bacteria 8614
241 Ga0373928_0049077 3300035084 Bacteria 991
242 Ga0373934_0118423 3300035086 Bacteria 1076
243 Ga0373940_0018506 3300035088 Bacteria 1749
244 Ga0373944_0002208 3300035089 Bacteria 4946
245 Ga0373923_0036761 3300035111 Bacteria 2000
246 Ga0373936_0000314 3300035113 Bacteria 16354
247 Ga0373936_0524074 3300035113 Bacteria 552
248 Ga0373945_0000066 3300035116 Bacteria 23678
249 Ga0373945_0031512 3300035116 Bacteria 1874
250 Ga0373953_0023786 3300035117 Bacteria 2322
251 Ga0373957_0009452 3300035120 Bacteria 3191
252 Ga0373957_0029031 3300035120 Bacteria 2018
253 Ga0373960_0012068 3300035121 Bacteria 2140
254 Ga0373943_0001292 3300035170 Bacteria 11237
255 Ga0373943_0013688 3300035170 Bacteria 3666
256 Ga0373946_0000073 3300035171 Bacteria 26844
257 Ga0373955_0009329 3300035172 Bacteria 4595
258 Ga0373955_0058527 3300035172 Bacteria 2121
259 Ga0373955_0154546 3300035172 Bacteria 1351
260 Ga0373955_0222144 3300035172 Bacteria 1128
261 Ga0373942_0007228 3300035207 Bacteria 2573
262 Ga0373961_0034880 3300035241 Bacteria 1425
263 Ga0373962_0090566 3300035242 Bacteria 941
264 Ga0373924_0069050 3300035410 Bacteria 1488
265 Ga0373931_0014904 3300035691 Bacteria 3808
266 Ga0373935_0000371 3300035692 Bacteria 23010
267 Ga0373927_0001071 3300035695 Bacteria 20930
268 Ga0373947_0000582 3300035725 Bacteria 21425
269 Ga0373937_0060448 3300036401 Bacteria 3482
270 Ga0373925_0059088 3300037068 Bacteria 2875
271 Ga0373925_0083644 3300037068 Bacteria 2431
272 Ga0436364_0875940 3300037853 Bacteria 990
273 Ga0436364_0897023 3300037853 Bacteria 831
274 Ga0436364_1341515 3300037853 Bacteria 6365
275 Ga0436360_0796707 3300039438 Bacteria 1597
276 Ga0436362_0875852 3300039453 Bacteria 826
277 Ga0439466_0019022 3300041411 Bacteria 2460
278 Ga0439465_0037284 3300041413 Bacteria 1563
279 Ga0451791_0476237 3300041451 Bacteria 1426
280 Ga0451853_1426811 3300041512 Bacteria 2445
281 Ga0439442_005512 3300042002 Bacteria 2530
282 Ga0466969_0059370 3300044656 Bacteria 1860
283 Ga0466972_0013402 3300044658 Bacteria 4116
284 Ga0466965_0005462 3300044683 Bacteria 5730
285 Ga0466966_0029856 3300044684 Bacteria 3545
286 Ga0466961_0021530 3300044693 Bacteria 4149
287 Ga0466963_0259703 3300044694 Bacteria 1219
288 Ga0466971_0057834 3300044719 Bacteria 1750
289 Ga0466968_0003285 3300044735 Bacteria 5960
290 Ga0466968_0014027 3300044735 Bacteria 3161
291 Ga0466970_0038510 3300044765 Bacteria 2536
292 Ga0466970_0082898 3300044765 Bacteria 1734
293 Ga0466957_0088950 3300044842 Bacteria 1932
294 Ga0466960_0000170 3300044901 Bacteria 22220
295 Ga0466960_0034568 3300044901 Bacteria 2356
296 Ga0466959_0098190 3300045049 Bacteria 2098
297 Ga0466958_0037721 3300045836 Bacteria 2896
298 Ga0466967_0220963 3300045976 Bacteria 1800
299 Ga0466967_0274115 3300045976 Bacteria 1617
300 Ga0466967_0561681 3300045976 Bacteria 1124
301 Ga0495592_0005532 3300046454 Bacteria 9345
302 Ga0495592_0034388 3300046454 Bacteria 3820
303 Ga0495592_0078082 3300046454 Bacteria 2398
304 Ga0495592_0395848 3300046454 Bacteria 876
305 Ga0495603_0026525 3300046455 Bacteria 3499
306 Ga0495629_0002241 3300046459 Bacteria 14904
307 Ga0495629_0016388 3300046459 Bacteria 5319
308 Ga0495638_0548958 3300046460 Bacteria 575
309 Ga0495641_0003923 3300046461 Bacteria 10814
310 Ga0495641_0033237 3300046461 Bacteria 2450
311 Ga0495651_0022926 3300046462 Bacteria 4855
312 Ga0495651_0028169 3300046462 Bacteria 4378
313 Ga0495653_0001878 3300046463 Bacteria 16577
314 Ga0495653_0008502 3300046463 Bacteria 8416
315 Ga0495653_0011320 3300046463 Bacteria 7290
316 Ga0495653_0016202 3300046463 Bacteria 6072
317 Ga0495653_0115139 3300046463 Bacteria 1925
318 Ga0495580_0013472 3300046472 Bacteria 6238
319 Ga0495582_0150503 3300046473 Bacteria 1321
320 Ga0495639_0018899 3300046475 Bacteria 3004
321 Ga0495662_0001974 3300046476 Bacteria 10288
322 Ga0495662_0088177 3300046476 Bacteria 1511
323 Ga0495664_0002993 3300046477 Bacteria 9133
324 Ga0495664_0007786 3300046477 Bacteria 5962
325 Ga0495664_0032559 3300046477 Bacteria 3060
326 Ga0495664_0041402 3300046477 Unclassified 2726
327 Ga0495585_0046650 3300046492 Bacteria 2416
328 Ga0495594_0000322 3300046499 Bacteria 23676
329 Ga0495606_0026353 3300046507 Bacteria 4145
330 Ga0495608_0002211 3300046511 Bacteria 14042
331 Ga0495608_0025924 3300046511 Bacteria 4001
332 Ga0495608_0073878 3300046511 Bacteria 2223
333 Ga0495608_0333229 3300046511 Bacteria 936
334 Ga0495608_0378983 3300046511 Bacteria 867
335 Ga0495618_0038990 3300046514 Bacteria 2987
336 Ga0495618_0066664 3300046514 Bacteria 2288
337 Ga0495618_0155129 3300046514 Bacteria 1461
338 Ga0495628_0011178 3300046516 Bacteria 7597
339 Ga0495628_0020885 3300046516 Bacteria 5393
340 Ga0495628_0050138 3300046516 Bacteria 3303
341 Ga0495628_0057729 3300046516 Bacteria 3053
342 Ga0495630_0016079 3300046517 Bacteria 5469
343 Ga0495630_0075192 3300046517 Bacteria 2545
344 Ga0495630_0139305 3300046517 Bacteria 1844
345 Ga0495630_0314281 3300046517 Bacteria 1197
346 Ga0495666_0000590 3300046526 Bacteria 16240
347 Ga0495652_0004467 3300046529 Bacteria 13357
348 Ga0495652_0037454 3300046529 Bacteria 4208
349 Ga0495652_0069654 3300046529 Bacteria 2943
350 Ga0495652_0398409 3300046529 Bacteria 975
351 Ga0495665_0004853 3300046531 Bacteria 7254
352 Ga0495665_0010069 3300046531 Bacteria 5122
353 Ga0495665_0114249 3300046531 Bacteria 1415
354 Ga0495640_0012620 3300046533 Bacteria 6449
355 Ga0495640_0019173 3300046533 Bacteria 5053
356 Ga0495640_0034135 3300046533 Bacteria 3612
357 Ga0495640_0091047 3300046533 Bacteria 2012
358 Ga0495586_0161230 3300046535 Bacteria 1265
359 Ga0495587_0002970 3300046536 Bacteria 11338
360 Ga0495587_0004915 3300046536 Bacteria 8764
361 Ga0495645_0003904 3300046543 Bacteria 10164
362 Ga0495645_0008482 3300046543 Bacteria 7175
363 Ga0495645_0042103 3300046543 Bacteria 3330
364 Ga0495645_0073758 3300046543 Bacteria 2458
365 Ga0495645_0128263 3300046543 Bacteria 1780
366 Ga0495633_0088623 3300046558 Bacteria 1439
367 Ga0495667_0001289 3300046559 Bacteria 16420
368 Ga0495667_0006211 3300046559 Bacteria 8094
369 Ga0495667_0022489 3300046559 Bacteria 4247
370 Ga0495667_0078634 3300046559 Bacteria 2144
371 Ga0495668_0044252 3300046616 Bacteria 2474
372 Ga0495668_0620011 3300046616 Bacteria 598
373 Ga0495634_0005432 3300046642 Bacteria 9817
374 Ga0495634_0005789 3300046642 Bacteria 9434
375 Ga0495634_0357637 3300046642 Bacteria 873
376 Ga0495634_0530124 3300046642 Bacteria 688
377 Ga0495635_0000941 3300046663 Bacteria 19199
378 Ga0495635_0007582 3300046663 Bacteria 7571
379 Ga0495588_0022161 3300046674 Bacteria 3138
380 Ga0495657_0001206 3300046675 Bacteria 22653
381 Ga0495657_0090163 3300046675 Bacteria 1968
382 Ga0495657_0231870 3300046675 Bacteria 1116
383 Ga0495599_0002708 3300046678 Bacteria 10339
384 Ga0495599_0047957 3300046678 Bacteria 2677
385 Ga0495599_0059659 3300046678 Bacteria 2386
386 Ga0495599_0177521 3300046678 Bacteria 1313
387 Ga0495623_0023430 3300046679 Bacteria 3985
388 Ga0495646_0020157 3300046680 Bacteria 4216
389 Ga0495646_0068141 3300046680 Bacteria 2101
390 Ga0495647_0012282 3300046681 Bacteria 2947
391 Ga0495658_0033288 3300046683 Bacteria 2821
392 Ga0495658_0296889 3300046683 Bacteria 1021
393 Ga0495613_0002883 3300046689 Bacteria 12877
394 Ga0495613_0003064 3300046689 Bacteria 12484
395 Ga0495613_0072201 3300046689 Bacteria 2516
396 Ga0495624_0017260 3300046690 Bacteria 4850
397 Ga0495624_0113121 3300046690 Bacteria 1669
398 Ga0495624_0130184 3300046690 Bacteria 1543
399 Ga0495600_0001737 3300046809 Bacteria 12180
400 Ga0495600_0040226 3300046809 Bacteria 3044
401 Ga0495600_0415431 3300046809 Bacteria 835
402 Ga0495581_0029973 3300047315 Bacteria 3154
403 Ga0495581_0132372 3300047315 Bacteria 1453
404 Ga0495604_0000482 3300047317 Bacteria 35034
405 Ga0495604_0008179 3300047317 Bacteria 8277
406 Ga0495674_0001678 3300047319 Bacteria 21774
407 Ga0495674_0002739 3300047319 Bacteria 17109
408 Ga0495674_0017961 3300047319 Bacteria 6585
409 Ga0495674_0095653 3300047319 Bacteria 2532
410 Ga0495674_0154852 3300047319 Bacteria 1920
411 Ga0495674_0650777 3300047319 Bacteria 831
412 Ga0495672_0002524 3300047320 Bacteria 16717
413 Ga0495676_0032879 3300047321 Bacteria 4373
414 Ga0495676_0040569 3300047321 Bacteria 3839
415 Ga0495676_0105512 3300047321 Bacteria 2077
416 Ga0495680_0008559 3300047322 Bacteria 9289
417 Ga0495680_0010913 3300047322 Bacteria 8072
418 Ga0495675_0020373 3300047444 Bacteria 4217
419 Ga0495675_0042581 3300047444 Bacteria 2892
420 Ga0495675_0365846 3300047444 Bacteria 846
421 Ga0495673_0001014 3300047469 Bacteria 24774
422 Ga0495684_0001504 3300047471 Bacteria 18649
423 Ga0495684_0003168 3300047471 Bacteria 12896
424 Ga0495684_0634435 3300047471 Bacteria 716
425 Ga0495602_0048691 3300048088 Bacteria 3805
426 Ga0495602_0075791 3300048088 Bacteria 2853
427 Ga0495602_0123523 3300048088 Bacteria 2078
428 Ga0495602_0357105 3300048088 Bacteria 1053
429 Ga0495614_0001264 3300048089 Bacteria 10860
430 Ga0496100_0000780 3300048903 Bacteria 15181
431 Ga0496100_0127055 3300048903 Bacteria 1790
432 Ga0496101_0000031 3300048904 Bacteria 195195
433 Ga0496101_0077571 3300048904 Bacteria 2448
434 Ga0496102_0000065 3300048905 Bacteria 161370
435 Ga0496103_0000048 3300048906 Bacteria 160911
436 Ga0496103_0027107 3300048906 Bacteria 3470
437 Ga0496103_0209553 3300048906 Bacteria 1253
438 Ga0496103_0702428 3300048906 Bacteria 641
439 Ga0496104_0446464 3300048907 Bacteria 1205
440 Ga0496105_0699531 3300048908 Bacteria 778
441 Ga0496106_0107807 3300048909 Bacteria 2166
442 Ga0496106_0441598 3300048909 Bacteria 1045
443 Ga0496107_0034691 3300048910 Bacteria 3614
444 Ga0496108_0499384 3300048911 Bacteria 1062
445 Ga0496108_0874224 3300048911 Bacteria 772
446 Ga0496109_0002787 3300048912 Bacteria 14644
447 Ga0496109_0004328 3300048912 Bacteria 11860
448 Ga0496109_0313667 3300048912 Bacteria 1479
449 Ga0496110_0041545 3300048913 Bacteria 4013
450 Ga0496110_0385935 3300048913 Bacteria 1276
451 Ga0496111_0057185 3300048914 Bacteria 2823
452 Ga0496112_0034944 3300048915 Bacteria 4892
453 Ga0496113_0119346 3300048916 Bacteria 2060
454 Ga0496113_1075812 3300048916 Bacteria 631
455 Ga0496113_1292290 3300048916 Bacteria 568
456 Ga0496114_0280359 3300048917 Bacteria 1469
457 Ga0496115_0018107 3300048918 Bacteria 5399
458 Ga0496115_0099897 3300048918 Bacteria 2378
459 Ga0496116_0000125 3300048919 Bacteria 160885
460 Ga0496117_0000111 3300048920 Bacteria 184570
461 Ga0496118_0000083 3300048921 Bacteria 184570
462 Ga0496121_0000728 3300048924 Bacteria 60874
463 Ga0496125_0021933 3300048928 Bacteria 5939
464 Ga0496126_0000220 3300048929 Bacteria 124547
465 Ga0496126_0202277 3300048929 Bacteria 1676
466 Ga0496126_0368779 3300048929 Bacteria 1171
467 Ga0496126_0430768 3300048929 Bacteria 1065
468 Ga0501031_0093871 3300049568 Bacteria 1958
469 Ga0501032_0088532 3300049569 Bacteria 2055
470 Ga0501033_0038007 3300049570 Bacteria 3601
471 Ga0501034_0018238 3300049571 Bacteria 7200
472 Ga0501034_0222620 3300049571 Bacteria 1839
473 Ga0501036_0040078 3300049572 Bacteria 3962
474 Ga0501038_0047264 3300049574 Bacteria 3728
475 Ga0501042_0651929 3300049578 Bacteria 765
476 Ga0501043_0027916 3300049579 Bacteria 4430
477 Ga0501047_0108804 3300049581 Bacteria 2654
478 Ga0501047_0160967 3300049581 Bacteria 2116
479 Ga0501035_0121899 3300049822 Bacteria 2278
480 Ga0501044_0042444 3300049823 Bacteria 4730
481 Ga0501044_0389204 3300049823 Bacteria 1308
482 Ga0501044_1278175 3300049823 Bacteria 601
483 nmdc:mga03n38_246265_c1 3300050490 Bacteria 942
484 nmdc:mga03n38_5266_c1 3300050490 Bacteria 4387
485 nmdc:mga00v17_198405_c1 3300050491 Bacteria 1297
486 nmdc:mga06z11_347191_c1 3300050494 Bacteria 888
487 nmdc:mga07m45_14241_c1 3300050496 Bacteria 4232
488 nmdc:mga07m45_17940_c1 3300050496 Bacteria 3809
489 nmdc:mga0n895_622806_c1 3300050512 Bacteria 1080
490 nmdc:mga0n895_762952_c1 3300050512 Bacteria 960
491 Ga0495601_0005227 3300053077 Bacteria 7552
492 Ga0495601_0009816 3300053077 Bacteria 5665
493 Ga0495601_0249368 3300053077 Bacteria 1159
494 Ga0495612_0137423 3300053078 Bacteria 1059
495 Ga0495619_0011017 3300053085 Bacteria 5690
496 Ga0495619_0101872 3300053085 Bacteria 1955
497 Ga0500643_003652 3300053087 Bacteria 7271
498 Ga0500559_0010239 3300053136 Bacteria 4031
499 Ga0500585_137618 3300053144 Bacteria 861
500 Ga0500616_0000116 3300053153 Bacteria 145790
501 Ga0587106_099375 3300059605 Bacteria 592
502 Ga0501082_0455401 3300060353 Bacteria 1118

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0530124 Ga0495634_0530124_236_670 139
2 3300048916 Ga0496113_1292290 Ga0496113_1292290_105_557 149
3 3300006186 Ga0075369_10169729 Ga0075369_101697291 150
4 3300006844 Ga0075428_100015235 Ga0075428_1000152353 150
5 3300048929 Ga0496126_0202277 Ga0496126_0202277_1052_1540 150
6 3300005436 Ga0070713_100218132 Ga0070713_1002181322 152
7 3300046531 Ga0495665_0114249 Ga0495665_0114249_828_1289 152
8 iso_pu_bacteria 2643221587 2643942534 155
9 iso_pu_bacteria 2643221677 2644429993 155
10 3300015265 Ga0182005_1200156 Ga0182005_12001561 156
11 3300044694 Ga0466963_0259703 Ga0466963_0259703_266_736 156
12 iso_pu_bacteria 2899359706 2899362126 156
13 iso_pu_bacteria 2582581312 2585297659 157
14 iso_pu_bacteria 2616644941 2616902812 157
15 iso_pu_bacteria 2862290372 2862296506 157
16 iso_pu_bacteria 3006486233 3006488060 157
17 3300003320 rootH2_10059946 rootH2_100599464 158
18 3300005937 Ga0081455_10564639 Ga0081455_105646392 158
19 3300032126 Ga0307415_101836625 Ga0307415_1018366251 158
20 3300049568 Ga0501031_0093871 Ga0501031_0093871_394_885 158
21 3300049569 Ga0501032_0088532 Ga0501032_0088532_219_710 158
22 3300049570 Ga0501033_0038007 Ga0501033_0038007_2177_2668 158
23 3300049571 Ga0501034_0018238 Ga0501034_0018238_3396_3887 158
24 3300049572 Ga0501036_0040078 Ga0501036_0040078_2152_2643 158
25 3300049574 Ga0501038_0047264 Ga0501038_0047264_2614_3105 158
26 3300049579 Ga0501043_0027916 Ga0501043_0027916_3293_3784 158
27 3300049581 Ga0501047_0160967 Ga0501047_0160967_32_523 158
28 3300049822 Ga0501035_0121899 Ga0501035_0121899_594_1085 158
29 3300049823 Ga0501044_0042444 Ga0501044_0042444_2614_3105 158
30 iso_pu_bacteria 2902792274 2902797188 158
31 iso_pu_bacteria 2917736166 2917743470 158
32 iso_pu_bacteria 2932398195 2932401600 158
33 3300005338 Ga0068868_100139057 Ga0068868_1001390572 159
34 3300005344 Ga0070661_100160380 Ga0070661_1001603802 159
35 3300005445 Ga0070708_100297924 Ga0070708_1002979242 159
36 3300005455 Ga0070663_100351212 Ga0070663_1003512122 159
37 3300005535 Ga0070684_100055569 Ga0070684_1000555692 159
38 3300005548 Ga0070665_100826008 Ga0070665_1008260082 159
39 3300005564 Ga0070664_100511166 Ga0070664_1005111662 159
40 3300005577 Ga0068857_100551503 Ga0068857_1005515032 159
41 3300005616 Ga0068852_100057339 Ga0068852_1000573394 159
42 3300005618 Ga0068864_100205279 Ga0068864_1002052792 159
43 3300005719 Ga0068861_100702197 Ga0068861_1007021972 159
44 3300005844 Ga0068862_100445344 Ga0068862_1004453442 159
45 3300013307 Ga0157372_10731192 Ga0157372_107311922 159
46 3300025944 Ga0207661_10286909 Ga0207661_102869092 159
47 3300025945 Ga0207679_10385291 Ga0207679_103852912 159
48 3300026023 Ga0207677_10266549 Ga0207677_102665492 159
49 3300026075 Ga0207708_10561166 Ga0207708_105611662 159
50 3300026095 Ga0207676_10235363 Ga0207676_102353632 159
51 3300028379 Ga0268266_10710078 Ga0268266_107100782 159
52 3300031838 Ga0307518_10047197 Ga0307518_100471973 159
53 3300037853 Ga0436364_0875940 Ga0436364_0875940_334_816 159
54 3300044901 Ga0466960_0000170 Ga0466960_0000170_10068_10556 159
55 3300053136 Ga0500559_0010239 Ga0500559_0010239_1225_1707 159
56 3300053144 Ga0500585_137618 Ga0500585_137618_254_736 159
57 iso_pu_bacteria 2738543005 2739204609 159
58 iso_pu_bacteria 2928142448 2928145448 159
59 3300005367 Ga0070667_100226641 Ga0070667_1002266412 160
60 3300005445 Ga0070708_100294645 Ga0070708_1002946452 160
61 3300005467 Ga0070706_100486944 Ga0070706_1004869441 160
62 3300005471 Ga0070698_100015097 Ga0070698_1000150977 160
63 3300005937 Ga0081455_10184341 Ga0081455_101843412 160
64 3300005985 Ga0081539_10000173 Ga0081539_1000017374 160
65 3300006178 Ga0075367_10277460 Ga0075367_102774602 160
66 3300025910 Ga0207684_10067359 Ga0207684_100673592 160
67 3300025986 Ga0207658_10196268 Ga0207658_101962682 160
68 3300028381 Ga0268264_11601556 Ga0268264_116015561 160
69 3300035086 Ga0373934_0118423 Ga0373934_0118423_532_1017 160
70 3300035117 Ga0373953_0023786 Ga0373953_0023786_1557_2042 160
71 3300035120 Ga0373957_0009452 Ga0373957_0009452_1459_1944 160
72 3300035172 Ga0373955_0009329 Ga0373955_0009329_2715_3200 160
73 3300036401 Ga0373937_0060448 Ga0373937_0060448_295_780 160
74 3300037068 Ga0373925_0059088 Ga0373925_0059088_1743_2228 160
75 3300046454 Ga0495592_0005532 Ga0495592_0005532_3758_4243 160
76 3300046463 Ga0495653_0008502 Ga0495653_0008502_1658_2143 160
77 3300046511 Ga0495608_0002211 Ga0495608_0002211_9611_10096 160
78 3300046514 Ga0495618_0155129 Ga0495618_0155129_349_834 160
79 3300046516 Ga0495628_0011178 Ga0495628_0011178_1092_1577 160
80 3300046529 Ga0495652_0004467 Ga0495652_0004467_7420_7905 160
81 3300046533 Ga0495640_0012620 Ga0495640_0012620_2062_2547 160
82 3300046536 Ga0495587_0002970 Ga0495587_0002970_10366_10851 160
83 3300046543 Ga0495645_0008482 Ga0495645_0008482_1193_1678 160
84 3300046559 Ga0495667_0001289 Ga0495667_0001289_4583_5068 160
85 3300046642 Ga0495634_0357637 Ga0495634_0357637_129_614 160
86 3300046663 Ga0495635_0007582 Ga0495635_0007582_1815_2300 160
87 3300046675 Ga0495657_0001206 Ga0495657_0001206_3995_4480 160
88 3300046678 Ga0495599_0002708 Ga0495599_0002708_7095_7580 160
89 3300046679 Ga0495623_0023430 Ga0495623_0023430_3223_3708 160
90 3300046680 Ga0495646_0020157 Ga0495646_0020157_2062_2547 160
91 3300046809 Ga0495600_0001737 Ga0495600_0001737_3411_3896 160
92 3300047317 Ga0495604_0008179 Ga0495604_0008179_6159_6644 160
93 3300047319 Ga0495674_0017961 Ga0495674_0017961_1906_2391 160
94 3300047319 Ga0495674_0650777 Ga0495674_0650777_295_780 160
95 3300047322 Ga0495680_0008559 Ga0495680_0008559_684_1169 160
96 3300047444 Ga0495675_0020373 Ga0495675_0020373_2559_3044 160
97 3300047471 Ga0495684_0001504 Ga0495684_0001504_8788_9273 160
98 3300048088 Ga0495602_0075791 Ga0495602_0075791_1623_2108 160
99 3300050494 nmdc:mga06z11_347191_c1 nmdc:mga06z11_347191_c1_108_593 160
100 3300053085 Ga0495619_0011017 Ga0495619_0011017_3760_4245 160
101 3300053153 Ga0500616_0000116 Ga0500616_0000116_82411_82896 160
102 iso_pu_bacteria 2565956761 2566996177 160
103 iso_pu_bacteria 2868088558 2868090213 160
104 iso_pu_bacteria 2904535858 2904540813 160
105 iso_pu_bacteria 2922554459 2922554904 160
106 3300002073 JGI24745J21846_1042702 JGI24745J21846_10427021 161
107 3300002077 JGI24744J21845_10035094 JGI24744J21845_100350942 161
108 3300005435 Ga0070714_101156748 Ga0070714_1011567481 161
109 3300005436 Ga0070713_100062171 Ga0070713_1000621712 161
110 3300005436 Ga0070713_100186538 Ga0070713_1001865383 161
111 3300005445 Ga0070708_100624575 Ga0070708_1006245752 161
112 3300005455 Ga0070663_100088531 Ga0070663_1000885312 161
113 3300005455 Ga0070663_101041467 Ga0070663_1010414671 161
114 3300005458 Ga0070681_11224222 Ga0070681_112242221 161
115 3300005466 Ga0070685_10790194 Ga0070685_107901941 161
116 3300005468 Ga0070707_100398903 Ga0070707_1003989032 161
117 3300005518 Ga0070699_100125465 Ga0070699_1001254652 161
118 3300005539 Ga0068853_100123332 Ga0068853_1001233322 161
119 3300005548 Ga0070665_100021205 Ga0070665_1000212055 161
120 3300005614 Ga0068856_101152774 Ga0068856_1011527741 161
121 3300005616 Ga0068852_100468324 Ga0068852_1004683241 161
122 3300005843 Ga0068860_100218742 Ga0068860_1002187423 161
123 3300005844 Ga0068862_100296463 Ga0068862_1002964631 161
124 3300006871 Ga0075434_101121876 Ga0075434_1011218762 161
125 3300007265 Ga0099794_10128885 Ga0099794_101288852 161
126 3300007788 Ga0099795_10023434 Ga0099795_100234342 161
127 3300009101 Ga0105247_10005195 Ga0105247_100051959 161
128 3300009148 Ga0105243_10140680 Ga0105243_101406802 161
129 3300009176 Ga0105242_11629610 Ga0105242_116296101 161
130 3300009545 Ga0105237_10004429 Ga0105237_100044299 161
131 3300009551 Ga0105238_10052473 Ga0105238_100524732 161
132 3300010375 Ga0105239_10007880 Ga0105239_100078806 161
133 3300010375 Ga0105239_10954837 Ga0105239_109548371 161
134 3300011119 Ga0105246_10416534 Ga0105246_104165342 161
135 3300012492 Ga0157335_1002836 Ga0157335_10028362 161
136 3300012507 Ga0157342_1005110 Ga0157342_10051102 161
137 3300012515 Ga0157338_1006795 Ga0157338_10067952 161
138 3300013296 Ga0157374_10007942 Ga0157374_100079424 161
139 3300013306 Ga0163162_10305082 Ga0163162_103050822 161
140 3300014325 Ga0163163_10382478 Ga0163163_103824782 161
141 3300014745 Ga0157377_10020243 Ga0157377_100202431 161
142 3300025901 Ga0207688_10003159 Ga0207688_100031595 161
143 3300025904 Ga0207647_10018984 Ga0207647_100189844 161
144 3300025912 Ga0207707_10974110 Ga0207707_109741101 161
145 3300025914 Ga0207671_10009509 Ga0207671_100095098 161
146 3300025924 Ga0207694_10096038 Ga0207694_100960382 161
147 3300025928 Ga0207700_10491374 Ga0207700_104913741 161
148 3300025928 Ga0207700_11081911 Ga0207700_110819111 161
149 3300025929 Ga0207664_10006014 Ga0207664_100060142 161
150 3300025931 Ga0207644_10579853 Ga0207644_105798532 161
151 3300025940 Ga0207691_10127428 Ga0207691_101274283 161
152 3300026041 Ga0207639_10218364 Ga0207639_102183642 161
153 3300026067 Ga0207678_10092312 Ga0207678_100923123 161
154 3300026075 Ga0207708_10975175 Ga0207708_109751751 161
155 3300026118 Ga0207675_100398089 Ga0207675_1003980891 161
156 3300026121 Ga0207683_10203526 Ga0207683_102035262 161
157 3300026142 Ga0207698_10531178 Ga0207698_105311782 161
158 3300028379 Ga0268266_10080953 Ga0268266_100809533 161
159 3300028380 Ga0268265_10135390 Ga0268265_101353902 161
160 3300030522 Ga0307512_10038727 Ga0307512_100387273 161
161 3300030760 Ga0265762_1018174 Ga0265762_10181742 161
162 3300030760 Ga0265762_1041744 Ga0265762_10417441 161
163 3300031456 Ga0307513_10698931 Ga0307513_106989311 161
164 3300031730 Ga0307516_10864686 Ga0307516_108646861 161
165 3300031838 Ga0307518_10307597 Ga0307518_103075971 161
166 3300031901 Ga0307406_10181706 Ga0307406_101817062 161
167 3300033179 Ga0307507_10004082 Ga0307507_1000408212 161
168 3300033180 Ga0307510_10226632 Ga0307510_102266322 161
169 3300033545 Ga0316214_1011115 Ga0316214_10111152 161
170 3300035113 Ga0373936_0524074 Ga0373936_0524074_38_526 161
171 3300035116 Ga0373945_0031512 Ga0373945_0031512_374_862 161
172 3300035170 Ga0373943_0013688 Ga0373943_0013688_823_1311 161
173 3300035207 Ga0373942_0007228 Ga0373942_0007228_933_1418 161
174 3300037068 Ga0373925_0083644 Ga0373925_0083644_916_1404 161
175 3300037853 Ga0436364_1341515 Ga0436364_1341515_4853_5341 161
176 3300039438 Ga0436360_0796707 Ga0436360_0796707_262_750 161
177 3300041411 Ga0439466_0019022 Ga0439466_0019022_808_1305 161
178 3300041413 Ga0439465_0037284 Ga0439465_0037284_560_1057 161
179 3300041451 Ga0451791_0476237 Ga0451791_0476237_389_877 161
180 3300041512 Ga0451853_1426811 Ga0451853_1426811_719_1213 161
181 3300042002 Ga0439442_005512 Ga0439442_005512_1280_1777 161
182 3300044656 Ga0466969_0059370 Ga0466969_0059370_1010_1498 161
183 3300044658 Ga0466972_0013402 Ga0466972_0013402_2398_2895 161
184 3300044683 Ga0466965_0005462 Ga0466965_0005462_2008_2505 161
185 3300044684 Ga0466966_0029856 Ga0466966_0029856_275_763 161
186 3300044693 Ga0466961_0021530 Ga0466961_0021530_2932_3420 161
187 3300044719 Ga0466971_0057834 Ga0466971_0057834_889_1377 161
188 3300044735 Ga0466968_0003285 Ga0466968_0003285_3917_4405 161
189 3300044735 Ga0466968_0014027 Ga0466968_0014027_44_541 161
190 3300044765 Ga0466970_0038510 Ga0466970_0038510_1096_1584 161
191 3300044765 Ga0466970_0082898 Ga0466970_0082898_96_593 161
192 3300044842 Ga0466957_0088950 Ga0466957_0088950_911_1408 161
193 3300044901 Ga0466960_0034568 Ga0466960_0034568_123_620 161
194 3300045049 Ga0466959_0098190 Ga0466959_0098190_1031_1519 161
195 3300045836 Ga0466958_0037721 Ga0466958_0037721_541_1038 161
196 3300045976 Ga0466967_0220963 Ga0466967_0220963_1241_1729 161
197 3300045976 Ga0466967_0274115 Ga0466967_0274115_873_1370 161
198 3300045976 Ga0466967_0561681 Ga0466967_0561681_489_977 161
199 3300046454 Ga0495592_0078082 Ga0495592_0078082_1189_1677 161
200 3300046454 Ga0495592_0395848 Ga0495592_0395848_158_646 161
201 3300046455 Ga0495603_0026525 Ga0495603_0026525_2010_2498 161
202 3300046459 Ga0495629_0002241 Ga0495629_0002241_93_614 161
203 3300046459 Ga0495629_0016388 Ga0495629_0016388_1847_2335 161
204 3300046460 Ga0495638_0548958 Ga0495638_0548958_64_552 161
205 3300046462 Ga0495651_0028169 Ga0495651_0028169_24_512 161
206 3300046463 Ga0495653_0011320 Ga0495653_0011320_1898_2386 161
207 3300046463 Ga0495653_0115139 Ga0495653_0115139_513_1001 161
208 3300046472 Ga0495580_0013472 Ga0495580_0013472_1079_1567 161
209 3300046476 Ga0495662_0001974 Ga0495662_0001974_2454_2942 161
210 3300046476 Ga0495662_0088177 Ga0495662_0088177_808_1296 161
211 3300046477 Ga0495664_0002993 Ga0495664_0002993_7924_8412 161
212 3300046477 Ga0495664_0032559 Ga0495664_0032559_1660_2148 161
213 3300046492 Ga0495585_0046650 Ga0495585_0046650_197_685 161
214 3300046499 Ga0495594_0000322 Ga0495594_0000322_2423_2911 161
215 3300046507 Ga0495606_0026353 Ga0495606_0026353_1483_1974 161
216 3300046511 Ga0495608_0025924 Ga0495608_0025924_2325_2813 161
217 3300046516 Ga0495628_0020885 Ga0495628_0020885_940_1428 161
218 3300046517 Ga0495630_0016079 Ga0495630_0016079_4907_5395 161
219 3300046517 Ga0495630_0314281 Ga0495630_0314281_152_640 161
220 3300046526 Ga0495666_0000590 Ga0495666_0000590_3578_4066 161
221 3300046529 Ga0495652_0069654 Ga0495652_0069654_1898_2386 161
222 3300046529 Ga0495652_0398409 Ga0495652_0398409_425_913 161
223 3300046531 Ga0495665_0010069 Ga0495665_0010069_2569_3057 161
224 3300046533 Ga0495640_0019173 Ga0495640_0019173_923_1411 161
225 3300046533 Ga0495640_0091047 Ga0495640_0091047_803_1291 161
226 3300046535 Ga0495586_0161230 Ga0495586_0161230_760_1248 161
227 3300046536 Ga0495587_0004915 Ga0495587_0004915_7109_7597 161
228 3300046543 Ga0495645_0003904 Ga0495645_0003904_1847_2335 161
229 3300046543 Ga0495645_0042103 Ga0495645_0042103_2618_3106 161
230 3300046558 Ga0495633_0088623 Ga0495633_0088623_671_1159 161
231 3300046559 Ga0495667_0006211 Ga0495667_0006211_5649_6137 161
232 3300046616 Ga0495668_0620011 Ga0495668_0620011_70_561 161
233 3300046642 Ga0495634_0005432 Ga0495634_0005432_9038_9526 161
234 3300046674 Ga0495588_0022161 Ga0495588_0022161_599_1087 161
235 3300046675 Ga0495657_0090163 Ga0495657_0090163_292_780 161
236 3300046678 Ga0495599_0047957 Ga0495599_0047957_1189_1677 161
237 3300046678 Ga0495599_0177521 Ga0495599_0177521_537_1025 161
238 3300046680 Ga0495646_0068141 Ga0495646_0068141_1056_1544 161
239 3300046689 Ga0495613_0002883 Ga0495613_0002883_4907_5395 161
240 3300046689 Ga0495613_0003064 Ga0495613_0003064_11755_12276 161
241 3300046690 Ga0495624_0113121 Ga0495624_0113121_697_1185 161
242 3300047315 Ga0495581_0132372 Ga0495581_0132372_35_523 161
243 3300047317 Ga0495604_0000482 Ga0495604_0000482_21354_21842 161
244 3300047319 Ga0495674_0002739 Ga0495674_0002739_12533_13021 161
245 3300047320 Ga0495672_0002524 Ga0495672_0002524_8743_9234 161
246 3300047321 Ga0495676_0040569 Ga0495676_0040569_2138_2626 161
247 3300047321 Ga0495676_0105512 Ga0495676_0105512_1495_2016 161
248 3300047444 Ga0495675_0042581 Ga0495675_0042581_1847_2335 161
249 3300047469 Ga0495673_0001014 Ga0495673_0001014_13901_14392 161
250 3300047471 Ga0495684_0634435 Ga0495684_0634435_164_652 161
251 3300048088 Ga0495602_0048691 Ga0495602_0048691_2888_3376 161
252 3300048088 Ga0495602_0357105 Ga0495602_0357105_42_530 161
253 3300048089 Ga0495614_0001264 Ga0495614_0001264_10094_10615 161
254 3300048903 Ga0496100_0000780 Ga0496100_0000780_4300_4791 161
255 3300048904 Ga0496101_0000031 Ga0496101_0000031_40269_40760 161
256 3300048905 Ga0496102_0000065 Ga0496102_0000065_86832_87323 161
257 3300048906 Ga0496103_0000048 Ga0496103_0000048_86373_86864 161
258 3300048906 Ga0496103_0209553 Ga0496103_0209553_479_976 161
259 3300048906 Ga0496103_0702428 Ga0496103_0702428_124_612 161
260 3300048907 Ga0496104_0446464 Ga0496104_0446464_460_957 161
261 3300048908 Ga0496105_0699531 Ga0496105_0699531_198_689 161
262 3300048909 Ga0496106_0441598 Ga0496106_0441598_197_694 161
263 3300048911 Ga0496108_0874224 Ga0496108_0874224_241_726 161
264 3300048912 Ga0496109_0002787 Ga0496109_0002787_2656_3144 161
265 3300048912 Ga0496109_0004328 Ga0496109_0004328_4954_5451 161
266 3300048913 Ga0496110_0385935 Ga0496110_0385935_161_658 161
267 3300048915 Ga0496112_0034944 Ga0496112_0034944_164_661 161
268 3300048916 Ga0496113_1075812 Ga0496113_1075812_13_510 161
269 3300048917 Ga0496114_0280359 Ga0496114_0280359_83_568 161
270 3300048918 Ga0496115_0099897 Ga0496115_0099897_1512_1997 161
271 3300048919 Ga0496116_0000125 Ga0496116_0000125_74048_74539 161
272 3300048920 Ga0496117_0000111 Ga0496117_0000111_74048_74539 161
273 3300048921 Ga0496118_0000083 Ga0496118_0000083_74048_74539 161
274 3300048924 Ga0496121_0000728 Ga0496121_0000728_17430_17921 161
275 3300048929 Ga0496126_0000220 Ga0496126_0000220_44305_44796 161
276 3300049571 Ga0501034_0222620 Ga0501034_0222620_68_556 161
277 3300049578 Ga0501042_0651929 Ga0501042_0651929_236_724 161
278 3300049581 Ga0501047_0108804 Ga0501047_0108804_1870_2358 161
279 3300049823 Ga0501044_0389204 Ga0501044_0389204_26_520 161
280 3300049823 Ga0501044_1278175 Ga0501044_1278175_17_529 161
281 3300050496 nmdc:mga07m45_17940_c1 nmdc:mga07m45_17940_c1_213_707 161
282 3300050512 nmdc:mga0n895_622806_c1 nmdc:mga0n895_622806_c1_365_850 161
283 3300050512 nmdc:mga0n895_762952_c1 nmdc:mga0n895_762952_c1_372_860 161
284 3300053077 Ga0495601_0005227 Ga0495601_0005227_2270_2758 161
285 3300053078 Ga0495612_0137423 Ga0495612_0137423_507_995 161
286 3300053085 Ga0495619_0101872 Ga0495619_0101872_1444_1932 161
287 3300053087 Ga0500643_003652 Ga0500643_003652_2875_3366 161
288 3300059605 Ga0587106_099375 Ga0587106_099375_19_513 161
289 3300060353 Ga0501082_0455401 Ga0501082_0455401_130_618 161
290 iso_pu_bacteria 2515154155 2515853823 161
291 3300005356 Ga0070674_100129431 Ga0070674_1001294312 162
292 3300005435 Ga0070714_101228460 Ga0070714_1012284602 162
293 3300005467 Ga0070706_100010288 Ga0070706_1000102884 162
294 3300005471 Ga0070698_100033811 Ga0070698_1000338113 162
295 3300005614 Ga0068856_100193149 Ga0068856_1001931493 162
296 3300005841 Ga0068863_100299162 Ga0068863_1002991622 162
297 3300006028 Ga0070717_10006637 Ga0070717_100066373 162
298 3300006048 Ga0075363_100002126 Ga0075363_1000021262 162
299 3300006353 Ga0075370_10024270 Ga0075370_100242702 162
300 3300006358 Ga0068871_100515832 Ga0068871_1005158322 162
301 3300009011 Ga0105251_10145479 Ga0105251_101454792 162
302 3300025910 Ga0207684_10009113 Ga0207684_100091133 162
303 3300035083 Ga0373926_0000876 Ga0373926_0000876_63_551 162
304 3300035089 Ga0373944_0002208 Ga0373944_0002208_2669_3157 162
305 3300035111 Ga0373923_0036761 Ga0373923_0036761_1461_1949 162
306 3300035113 Ga0373936_0000314 Ga0373936_0000314_12290_12778 162
307 3300035116 Ga0373945_0000066 Ga0373945_0000066_5784_6272 162
308 3300035170 Ga0373943_0001292 Ga0373943_0001292_3588_4076 162
309 3300035171 Ga0373946_0000073 Ga0373946_0000073_21208_21696 162
310 3300035172 Ga0373955_0154546 Ga0373955_0154546_657_1145 162
311 3300035410 Ga0373924_0069050 Ga0373924_0069050_383_871 162
312 3300035692 Ga0373935_0000371 Ga0373935_0000371_7795_8283 162
313 3300035695 Ga0373927_0001071 Ga0373927_0001071_7754_8242 162
314 3300035725 Ga0373947_0000582 Ga0373947_0000582_19175_19663 162
315 3300046461 Ga0495641_0003923 Ga0495641_0003923_5343_5831 162
316 3300046463 Ga0495653_0001878 Ga0495653_0001878_4825_5313 162
317 3300046473 Ga0495582_0150503 Ga0495582_0150503_62_550 162
318 3300046475 Ga0495639_0018899 Ga0495639_0018899_1162_1650 162
319 3300046477 Ga0495664_0007786 Ga0495664_0007786_4339_4827 162
320 3300046511 Ga0495608_0378983 Ga0495608_0378983_262_750 162
321 3300046517 Ga0495630_0139305 Ga0495630_0139305_573_1061 162
322 3300046531 Ga0495665_0004853 Ga0495665_0004853_6430_6918 162
323 3300046543 Ga0495645_0073758 Ga0495645_0073758_1681_2169 162
324 3300046559 Ga0495667_0022489 Ga0495667_0022489_99_587 162
325 3300046616 Ga0495668_0044252 Ga0495668_0044252_84_581 162
326 3300046642 Ga0495634_0005789 Ga0495634_0005789_5283_5771 162
327 3300046663 Ga0495635_0000941 Ga0495635_0000941_11164_11652 162
328 3300046675 Ga0495657_0231870 Ga0495657_0231870_241_729 162
329 3300046678 Ga0495599_0059659 Ga0495599_0059659_1609_2097 162
330 3300046683 Ga0495658_0296889 Ga0495658_0296889_428_916 162
331 3300046690 Ga0495624_0017260 Ga0495624_0017260_2298_2786 162
332 3300046809 Ga0495600_0415431 Ga0495600_0415431_298_786 162
333 3300047315 Ga0495581_0029973 Ga0495581_0029973_2226_2714 162
334 3300047319 Ga0495674_0001678 Ga0495674_0001678_13642_14130 162
335 3300047321 Ga0495676_0032879 Ga0495676_0032879_3451_3939 162
336 3300047322 Ga0495680_0010913 Ga0495680_0010913_4898_5386 162
337 3300047471 Ga0495684_0003168 Ga0495684_0003168_7141_7629 162
338 3300048928 Ga0496125_0021933 Ga0496125_0021933_1566_2063 162
339 3300050490 nmdc:mga03n38_246265_c1 nmdc:mga03n38_246265_c1_56_553 162
340 3300050490 nmdc:mga03n38_5266_c1 nmdc:mga03n38_5266_c1_1497_1994 162
341 3300050491 nmdc:mga00v17_198405_c1 nmdc:mga00v17_198405_c1_745_1242 162
342 3300050496 nmdc:mga07m45_14241_c1 nmdc:mga07m45_14241_c1_1436_1933 162
343 iso_pu_bacteria 2738541308 2738888727 162
344 3300013105 Ga0157369_10195563 Ga0157369_101955632 163
345 3300025929 Ga0207664_10495711 Ga0207664_104957112 163
346 3300035120 Ga0373957_0029031 Ga0373957_0029031_1306_1797 163
347 3300035172 Ga0373955_0058527 Ga0373955_0058527_1415_1924 163
348 3300035172 Ga0373955_0222144 Ga0373955_0222144_550_1041 163
349 3300046454 Ga0495592_0034388 Ga0495592_0034388_1286_1795 163
350 3300046461 Ga0495641_0033237 Ga0495641_0033237_77_586 163
351 3300046462 Ga0495651_0022926 Ga0495651_0022926_3782_4273 163
352 3300046463 Ga0495653_0016202 Ga0495653_0016202_4000_4491 163
353 3300046511 Ga0495608_0073878 Ga0495608_0073878_533_1024 163
354 3300046511 Ga0495608_0333229 Ga0495608_0333229_263_772 163
355 3300046514 Ga0495618_0038990 Ga0495618_0038990_1530_2021 163
356 3300046514 Ga0495618_0066664 Ga0495618_0066664_586_1095 163
357 3300046516 Ga0495628_0050138 Ga0495628_0050138_1652_2143 163
358 3300046516 Ga0495628_0057729 Ga0495628_0057729_606_1115 163
359 3300046517 Ga0495630_0075192 Ga0495630_0075192_1833_2342 163
360 3300046529 Ga0495652_0037454 Ga0495652_0037454_3595_4104 163
361 3300046533 Ga0495640_0034135 Ga0495640_0034135_2614_3123 163
362 3300046543 Ga0495645_0128263 Ga0495645_0128263_792_1301 163
363 3300046559 Ga0495667_0078634 Ga0495667_0078634_577_1068 163
364 3300046681 Ga0495647_0012282 Ga0495647_0012282_881_1390 163
365 3300046683 Ga0495658_0033288 Ga0495658_0033288_245_754 163
366 3300046689 Ga0495613_0072201 Ga0495613_0072201_31_540 163
367 3300046690 Ga0495624_0130184 Ga0495624_0130184_973_1482 163
368 3300046809 Ga0495600_0040226 Ga0495600_0040226_1928_2419 163
369 3300047319 Ga0495674_0095653 Ga0495674_0095653_1342_1851 163
370 3300047319 Ga0495674_0154852 Ga0495674_0154852_342_833 163
371 3300047444 Ga0495675_0365846 Ga0495675_0365846_293_802 163
372 3300048088 Ga0495602_0123523 Ga0495602_0123523_1201_1710 163
373 3300048918 Ga0496115_0018107 Ga0496115_0018107_3250_3759 163
374 3300048929 Ga0496126_0430768 Ga0496126_0430768_249_758 163
375 3300053077 Ga0495601_0009816 Ga0495601_0009816_2078_2587 163
376 3300053077 Ga0495601_0249368 Ga0495601_0249368_410_919 163
377 3300005435 Ga0070714_100038216 Ga0070714_1000382164 164
378 3300005437 Ga0070710_10185113 Ga0070710_101851132 164
379 3300005437 Ga0070710_10243312 Ga0070710_102433122 164
380 3300005437 Ga0070710_10294223 Ga0070710_102942231 164
381 3300006028 Ga0070717_10010777 Ga0070717_100107776 164
382 3300006163 Ga0070715_10046792 Ga0070715_100467922 164
383 3300025898 Ga0207692_10042711 Ga0207692_100427111 164
384 3300025915 Ga0207693_10003995 Ga0207693_100039955 164
385 3300025916 Ga0207663_10040694 Ga0207663_100406942 164
386 3300025929 Ga0207664_10182491 Ga0207664_101824912 164
387 3300025929 Ga0207664_10559610 Ga0207664_105596102 164
388 3300025931 Ga0207644_10719944 Ga0207644_107199442 164
389 3300039453 Ga0436362_0875852 Ga0436362_0875852_170_682 164
390 3300046477 Ga0495664_0041402 Ga0495664_0041402_221_733 164
391 3300005467 Ga0070706_100140518 Ga0070706_1001405183 167
392 3300025910 Ga0207684_10261560 Ga0207684_102615602 167
393 3300001978 JGI24747J21853_1032784 JGI24747J21853_10327841 168
394 3300001979 JGI24740J21852_10099037 JGI24740J21852_100990371 168
395 3300001991 JGI24743J22301_10044772 JGI24743J22301_100447722 168
396 3300005327 Ga0070658_10185495 Ga0070658_101854952 168
397 3300005328 Ga0070676_10178240 Ga0070676_101782402 168
398 3300005329 Ga0070683_100010691 Ga0070683_1000106917 168
399 3300005330 Ga0070690_100157638 Ga0070690_1001576382 168
400 3300005334 Ga0068869_100273727 Ga0068869_1002737272 168
401 3300005335 Ga0070666_10009723 Ga0070666_100097235 168
402 3300005336 Ga0070680_100075244 Ga0070680_1000752442 168
403 3300005337 Ga0070682_100078446 Ga0070682_1000784462 168
404 3300005339 Ga0070660_100087569 Ga0070660_1000875693 168
405 3300005341 Ga0070691_10025510 Ga0070691_100255102 168
406 3300005344 Ga0070661_100236388 Ga0070661_1002363882 168
407 3300005347 Ga0070668_100559205 Ga0070668_1005592052 168
408 3300005354 Ga0070675_100040688 Ga0070675_1000406883 168
409 3300005364 Ga0070673_100108404 Ga0070673_1001084042 168
410 3300005366 Ga0070659_100150807 Ga0070659_1001508072 168
411 3300005367 Ga0070667_100502473 Ga0070667_1005024732 168
412 3300005438 Ga0070701_10003907 Ga0070701_100039072 168
413 3300005439 Ga0070711_100036343 Ga0070711_1000363432 168
414 3300005440 Ga0070705_100019573 Ga0070705_1000195734 168
415 3300005441 Ga0070700_100092717 Ga0070700_1000927172 168
416 3300005455 Ga0070663_100004385 Ga0070663_1000043851 168
417 3300005456 Ga0070678_100354498 Ga0070678_1003544981 168
418 3300005457 Ga0070662_100168674 Ga0070662_1001686742 168
419 3300005458 Ga0070681_10147646 Ga0070681_101476462 168
420 3300005466 Ga0070685_10147211 Ga0070685_101472111 168
421 3300005468 Ga0070707_100310916 Ga0070707_1003109161 168
422 3300005471 Ga0070698_100298504 Ga0070698_1002985041 168
423 3300005530 Ga0070679_100014169 Ga0070679_1000141696 168
424 3300005535 Ga0070684_100331080 Ga0070684_1003310802 168
425 3300005543 Ga0070672_100039666 Ga0070672_1000396662 168
426 3300005544 Ga0070686_100018252 Ga0070686_1000182521 168
427 3300005545 Ga0070695_100042959 Ga0070695_1000429593 168
428 3300005546 Ga0070696_100032530 Ga0070696_1000325302 168
429 3300005547 Ga0070693_100128722 Ga0070693_1001287222 168
430 3300005548 Ga0070665_100111257 Ga0070665_1001112574 168
431 3300005564 Ga0070664_100004731 Ga0070664_1000047311 168
432 3300005577 Ga0068857_100049915 Ga0068857_1000499152 168
433 3300005578 Ga0068854_100123257 Ga0068854_1001232572 168
434 3300005616 Ga0068852_100758872 Ga0068852_1007588722 168
435 3300005618 Ga0068864_100333654 Ga0068864_1003336542 168
436 3300005718 Ga0068866_10090570 Ga0068866_100905702 168
437 3300005719 Ga0068861_100252515 Ga0068861_1002525152 168
438 3300005834 Ga0068851_10094111 Ga0068851_100941112 168
439 3300005840 Ga0068870_10022978 Ga0068870_100229782 168
440 3300005841 Ga0068863_100222610 Ga0068863_1002226102 168
441 3300005842 Ga0068858_100340492 Ga0068858_1003404922 168
442 3300005843 Ga0068860_100158977 Ga0068860_1001589773 168
443 3300006028 Ga0070717_10277113 Ga0070717_102771132 168
444 3300006163 Ga0070715_10130635 Ga0070715_101306352 168
445 3300006173 Ga0070716_100140893 Ga0070716_1001408932 168
446 3300006175 Ga0070712_100003399 Ga0070712_1000033992 168
447 3300006358 Ga0068871_100114378 Ga0068871_1001143782 168
448 3300006871 Ga0075434_100255138 Ga0075434_1002551382 168
449 3300009092 Ga0105250_10045362 Ga0105250_100453622 168
450 3300011119 Ga0105246_10477644 Ga0105246_104776442 168
451 3300013100 Ga0157373_10455186 Ga0157373_104551862 168
452 3300014325 Ga0163163_10216195 Ga0163163_102161951 168
453 3300014968 Ga0157379_10271451 Ga0157379_102714512 168
454 3300020069 Ga0197907_10830985 Ga0197907_108309852 168
455 3300020070 Ga0206356_11507630 Ga0206356_115076302 168
456 3300020080 Ga0206350_10314167 Ga0206350_103141672 168
457 3300020082 Ga0206353_10134612 Ga0206353_101346122 168
458 3300022467 Ga0224712_10051149 Ga0224712_100511492 168
459 3300025321 Ga0207656_10216315 Ga0207656_102163151 168
460 3300025900 Ga0207710_10013062 Ga0207710_100130623 168
461 3300025901 Ga0207688_10059082 Ga0207688_100590822 168
462 3300025903 Ga0207680_10076775 Ga0207680_100767752 168
463 3300025906 Ga0207699_10058598 Ga0207699_100585981 168
464 3300025906 Ga0207699_10116238 Ga0207699_101162382 168
465 3300025908 Ga0207643_10021986 Ga0207643_100219863 168
466 3300025911 Ga0207654_10149709 Ga0207654_101497092 168
467 3300025912 Ga0207707_10025142 Ga0207707_100251425 168
468 3300025914 Ga0207671_10270906 Ga0207671_102709062 168
469 3300025915 Ga0207693_10006476 Ga0207693_100064762 168
470 3300025915 Ga0207693_10344097 Ga0207693_103440972 168
471 3300025916 Ga0207663_10179348 Ga0207663_101793482 168
472 3300025916 Ga0207663_10290731 Ga0207663_102907312 168
473 3300025918 Ga0207662_10019679 Ga0207662_100196794 168
474 3300025919 Ga0207657_10100966 Ga0207657_101009663 168
475 3300025922 Ga0207646_10032714 Ga0207646_100327147 168
476 3300025924 Ga0207694_10315505 Ga0207694_103155052 168
477 3300025925 Ga0207650_10251321 Ga0207650_102513211 168
478 3300025926 Ga0207659_10219597 Ga0207659_102195972 168
479 3300025928 Ga0207700_10024898 Ga0207700_100248985 168
480 3300025929 Ga0207664_10311352 Ga0207664_103113522 168
481 3300025931 Ga0207644_10301427 Ga0207644_103014272 168
482 3300025933 Ga0207706_10232900 Ga0207706_102329002 168
483 3300025941 Ga0207711_10264647 Ga0207711_102646472 168
484 3300025942 Ga0207689_10001334 Ga0207689_1000133413 168
485 3300025945 Ga0207679_10028423 Ga0207679_100284232 168
486 3300025949 Ga0207667_10452628 Ga0207667_104526282 168
487 3300025960 Ga0207651_10255801 Ga0207651_102558012 168
488 3300025961 Ga0207712_10362689 Ga0207712_103626892 168
489 3300026035 Ga0207703_10626107 Ga0207703_106261072 168
490 3300026067 Ga0207678_10002306 Ga0207678_100023064 168
491 3300026075 Ga0207708_10011592 Ga0207708_100115923 168
492 3300026078 Ga0207702_10010214 Ga0207702_100102145 168
493 3300026089 Ga0207648_10113673 Ga0207648_101136731 168
494 3300026095 Ga0207676_10521145 Ga0207676_105211452 168
495 3300026116 Ga0207674_10002042 Ga0207674_1000204221 168
496 3300026118 Ga0207675_100014426 Ga0207675_1000144262 168
497 3300026121 Ga0207683_10009865 Ga0207683_100098658 168
498 3300026142 Ga0207698_10162280 Ga0207698_101622801 168
499 3300028379 Ga0268266_11588408 Ga0268266_115884082 168
500 3300034816 Ga0373930_0038965 Ga0373930_0038965_28_534 168
501 3300034818 Ga0373950_0050602 Ga0373950_0050602_187_693 168
502 3300034820 Ga0373959_0036199 Ga0373959_0036199_454_960 168
503 3300035084 Ga0373928_0049077 Ga0373928_0049077_171_677 168
504 3300035088 Ga0373940_0018506 Ga0373940_0018506_949_1455 168
505 3300035121 Ga0373960_0012068 Ga0373960_0012068_230_736 168
506 3300035241 Ga0373961_0034880 Ga0373961_0034880_234_740 168
507 3300035242 Ga0373962_0090566 Ga0373962_0090566_97_603 168
508 3300035691 Ga0373931_0014904 Ga0373931_0014904_3279_3785 168
509 3300037853 Ga0436364_0897023 Ga0436364_0897023_284_793 168
510 3300048903 Ga0496100_0127055 Ga0496100_0127055_268_774 168
511 3300048904 Ga0496101_0077571 Ga0496101_0077571_1897_2403 168
512 3300048906 Ga0496103_0027107 Ga0496103_0027107_1630_2136 168
513 3300048909 Ga0496106_0107807 Ga0496106_0107807_50_556 168
514 3300048910 Ga0496107_0034691 Ga0496107_0034691_2855_3361 168
515 3300048911 Ga0496108_0499384 Ga0496108_0499384_63_569 168
516 3300048912 Ga0496109_0313667 Ga0496109_0313667_730_1236 168
517 3300048913 Ga0496110_0041545 Ga0496110_0041545_3070_3576 168
518 3300048914 Ga0496111_0057185 Ga0496111_0057185_1635_2141 168
519 3300048916 Ga0496113_0119346 Ga0496113_0119346_264_770 168
520 3300048929 Ga0496126_0368779 Ga0496126_0368779_384_890 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

25

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9325 2 161
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9272 1 164
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.9187 1 161
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.917 2 161
7l8r-assembly2.cif.gz_B crystal structure of human gpx4-u46c mutant k48a 0.916 2 161
ID Description Score Start End Superfamily
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9321 2 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9277 3 161 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9273 2 160 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.921 2 164 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9135 1 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1I3XYZ8-F1-model_v4 Glutathione peroxidase 0.9844 1 161 GO:0004601
GO:0034599
AF-A0A7X0EYC3-F1-model_v4 Glutathione peroxidase 0.9836 1 161 GO:0004602
GO:0034599
AF-A0A1A3ID35-F1-model_v4 Glutathione peroxidase 0.9835 1 162 GO:0004601
GO:0034599
AF-A0A429BCQ9-F1-model_v4 Glutathione peroxidase 0.9832 1 161 GO:0004601
GO:0034599
AF-A0A4Y9MQB4-F1-model_v4 Glutathione peroxidase 0.983 1 162 GO:0004601
GO:0034599

Feature Viewer

pLDDT pTM Quality
89.55 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map