F458622
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 329 | 502 | 164 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2515154155|2515853823 |
| Length | 184 |
| Sequence | GLFGPYGELRHANPLDLGRTDRVSLYDIPLHTLTGKPGTLGDLAGKTLLVVNVASKCGLTPQYTGLERLQERYADQGFSVVGFPCNQFGGQEPGTAEEIQEFCSTTYGVTFPMFEKIEVNGPGRHPIYTELTATPDADGEAGDIQWNFEKFLIASDGTVINRFRPRTEPEDAAVVAAIEANLPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 5 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 6 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 7 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 8 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 9 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 10 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 11 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 12 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 13 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 14 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 15 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 16 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 17 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 18 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 19 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 22 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 108 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 173 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 304 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 1.54 |
| Isolates | 3.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.69 |
| Nodule | 0 |
| Rhizoplane | 5.77 |
| Rhizosphere | 85.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1032784 | 3300001978 | Bacteria | 598 |
| 2 | JGI24740J21852_10099037 | 3300001979 | Bacteria | 743 |
| 3 | JGI24743J22301_10044772 | 3300001991 | Bacteria | 893 |
| 4 | JGI24745J21846_1042702 | 3300002073 | Bacteria | 564 |
| 5 | JGI24744J21845_10035094 | 3300002077 | Bacteria | 950 |
| 6 | rootH2_10059946 | 3300003320 | Bacteria | 3835 |
| 7 | Ga0070658_10185495 | 3300005327 | Bacteria | 1752 |
| 8 | Ga0070676_10178240 | 3300005328 | Bacteria | 1380 |
| 9 | Ga0070683_100010691 | 3300005329 | Bacteria | 7891 |
| 10 | Ga0070690_100157638 | 3300005330 | Bacteria | 1553 |
| 11 | Ga0068869_100273727 | 3300005334 | Bacteria | 1355 |
| 12 | Ga0070666_10009723 | 3300005335 | Bacteria | 6008 |
| 13 | Ga0070680_100075244 | 3300005336 | Bacteria | 2779 |
| 14 | Ga0070682_100078446 | 3300005337 | Bacteria | 2130 |
| 15 | Ga0068868_100139057 | 3300005338 | Bacteria | 1992 |
| 16 | Ga0070660_100087569 | 3300005339 | Bacteria | 2451 |
| 17 | Ga0070691_10025510 | 3300005341 | Bacteria | 2752 |
| 18 | Ga0070661_100160380 | 3300005344 | Bacteria | 1703 |
| 19 | Ga0070661_100236388 | 3300005344 | Bacteria | 1405 |
| 20 | Ga0070668_100559205 | 3300005347 | Bacteria | 997 |
| 21 | Ga0070675_100040688 | 3300005354 | Bacteria | 3795 |
| 22 | Ga0070674_100129431 | 3300005356 | Bacteria | 1880 |
| 23 | Ga0070673_100108404 | 3300005364 | Bacteria | 2299 |
| 24 | Ga0070659_100150807 | 3300005366 | Bacteria | 1896 |
| 25 | Ga0070667_100226641 | 3300005367 | Bacteria | 1665 |
| 26 | Ga0070667_100502473 | 3300005367 | Bacteria | 1111 |
| 27 | Ga0070714_100038216 | 3300005435 | Bacteria | 4036 |
| 28 | Ga0070714_101156748 | 3300005435 | Bacteria | 754 |
| 29 | Ga0070714_101228460 | 3300005435 | Bacteria | 731 |
| 30 | Ga0070713_100062171 | 3300005436 | Bacteria | 3127 |
| 31 | Ga0070713_100186538 | 3300005436 | Bacteria | 1867 |
| 32 | Ga0070713_100218132 | 3300005436 | Bacteria | 1730 |
| 33 | Ga0070710_10185113 | 3300005437 | Bacteria | 1306 |
| 34 | Ga0070710_10243312 | 3300005437 | Bacteria | 1153 |
| 35 | Ga0070710_10294223 | 3300005437 | Bacteria | 1058 |
| 36 | Ga0070701_10003907 | 3300005438 | Bacteria | 5951 |
| 37 | Ga0070711_100036343 | 3300005439 | Bacteria | 3300 |
| 38 | Ga0070705_100019573 | 3300005440 | Bacteria | 3564 |
| 39 | Ga0070700_100092717 | 3300005441 | Bacteria | 1974 |
| 40 | Ga0070708_100294645 | 3300005445 | Bacteria | 1528 |
| 41 | Ga0070708_100297924 | 3300005445 | Bacteria | 1518 |
| 42 | Ga0070708_100624575 | 3300005445 | Bacteria | 1016 |
| 43 | Ga0070663_100004385 | 3300005455 | Bacteria | 8285 |
| 44 | Ga0070663_100088531 | 3300005455 | Bacteria | 2289 |
| 45 | Ga0070663_100351212 | 3300005455 | Bacteria | 1194 |
| 46 | Ga0070663_101041467 | 3300005455 | Bacteria | 713 |
| 47 | Ga0070678_100354498 | 3300005456 | Bacteria | 1262 |
| 48 | Ga0070662_100168674 | 3300005457 | Bacteria | 1717 |
| 49 | Ga0070681_10147646 | 3300005458 | Bacteria | 2279 |
| 50 | Ga0070681_11224222 | 3300005458 | Bacteria | 673 |
| 51 | Ga0070685_10147211 | 3300005466 | Bacteria | 1489 |
| 52 | Ga0070685_10790194 | 3300005466 | Bacteria | 699 |
| 53 | Ga0070706_100010288 | 3300005467 | Bacteria | 8691 |
| 54 | Ga0070706_100140518 | 3300005467 | Bacteria | 2254 |
| 55 | Ga0070706_100486944 | 3300005467 | Bacteria | 1148 |
| 56 | Ga0070707_100310916 | 3300005468 | Bacteria | 1531 |
| 57 | Ga0070707_100398903 | 3300005468 | Bacteria | 1335 |
| 58 | Ga0070698_100015097 | 3300005471 | Bacteria | 8165 |
| 59 | Ga0070698_100033811 | 3300005471 | Bacteria | 5296 |
| 60 | Ga0070698_100298504 | 3300005471 | Bacteria | 1542 |
| 61 | Ga0070699_100125465 | 3300005518 | Bacteria | 2259 |
| 62 | Ga0070679_100014169 | 3300005530 | Bacteria | 7650 |
| 63 | Ga0070684_100055569 | 3300005535 | Bacteria | 3452 |
| 64 | Ga0070684_100331080 | 3300005535 | Bacteria | 1399 |
| 65 | Ga0068853_100123332 | 3300005539 | Bacteria | 2314 |
| 66 | Ga0070672_100039666 | 3300005543 | Bacteria | 3608 |
| 67 | Ga0070686_100018252 | 3300005544 | Bacteria | 4113 |
| 68 | Ga0070695_100042959 | 3300005545 | Bacteria | 2872 |
| 69 | Ga0070696_100032530 | 3300005546 | Bacteria | 3578 |
| 70 | Ga0070693_100128722 | 3300005547 | Bacteria | 1579 |
| 71 | Ga0070665_100021205 | 3300005548 | Bacteria | 6532 |
| 72 | Ga0070665_100111257 | 3300005548 | Bacteria | 2741 |
| 73 | Ga0070665_100826008 | 3300005548 | Bacteria | 940 |
| 74 | Ga0070664_100004731 | 3300005564 | Bacteria | 10915 |
| 75 | Ga0070664_100511166 | 3300005564 | Bacteria | 1108 |
| 76 | Ga0068857_100049915 | 3300005577 | Bacteria | 3712 |
| 77 | Ga0068857_100551503 | 3300005577 | Bacteria | 1086 |
| 78 | Ga0068854_100123257 | 3300005578 | Bacteria | 1970 |
| 79 | Ga0068856_100193149 | 3300005614 | Bacteria | 2049 |
| 80 | Ga0068856_101152774 | 3300005614 | Bacteria | 792 |
| 81 | Ga0068852_100057339 | 3300005616 | Bacteria | 3370 |
| 82 | Ga0068852_100468324 | 3300005616 | Bacteria | 1250 |
| 83 | Ga0068852_100758872 | 3300005616 | Bacteria | 982 |
| 84 | Ga0068864_100205279 | 3300005618 | Bacteria | 1812 |
| 85 | Ga0068864_100333654 | 3300005618 | Bacteria | 1427 |
| 86 | Ga0068866_10090570 | 3300005718 | Bacteria | 1664 |
| 87 | Ga0068861_100252515 | 3300005719 | Bacteria | 1505 |
| 88 | Ga0068861_100702197 | 3300005719 | Bacteria | 940 |
| 89 | Ga0068851_10094111 | 3300005834 | Bacteria | 1582 |
| 90 | Ga0068870_10022978 | 3300005840 | Bacteria | 3070 |
| 91 | Ga0068863_100222610 | 3300005841 | Bacteria | 1818 |
| 92 | Ga0068863_100299162 | 3300005841 | Bacteria | 1561 |
| 93 | Ga0068858_100340492 | 3300005842 | Bacteria | 1435 |
| 94 | Ga0068860_100158977 | 3300005843 | Bacteria | 2178 |
| 95 | Ga0068860_100218742 | 3300005843 | Bacteria | 1849 |
| 96 | Ga0068862_100296463 | 3300005844 | Bacteria | 1486 |
| 97 | Ga0068862_100445344 | 3300005844 | Bacteria | 1220 |
| 98 | Ga0081455_10184341 | 3300005937 | Bacteria | 1578 |
| 99 | Ga0081455_10564639 | 3300005937 | Bacteria | 749 |
| 100 | Ga0081539_10000173 | 3300005985 | Bacteria | 151356 |
| 101 | Ga0070717_10006637 | 3300006028 | Bacteria | 8527 |
| 102 | Ga0070717_10010777 | 3300006028 | Bacteria | 6919 |
| 103 | Ga0070717_10277113 | 3300006028 | Bacteria | 1487 |
| 104 | Ga0075363_100002126 | 3300006048 | Bacteria | 7959 |
| 105 | Ga0070715_10046792 | 3300006163 | Bacteria | 1841 |
| 106 | Ga0070715_10130635 | 3300006163 | Bacteria | 1208 |
| 107 | Ga0070716_100140893 | 3300006173 | Bacteria | 1537 |
| 108 | Ga0070712_100003399 | 3300006175 | Bacteria | 9791 |
| 109 | Ga0075367_10277460 | 3300006178 | Bacteria | 1053 |
| 110 | Ga0075369_10169729 | 3300006186 | Bacteria | 1001 |
| 111 | Ga0075370_10024270 | 3300006353 | Bacteria | 3348 |
| 112 | Ga0068871_100114378 | 3300006358 | Bacteria | 2273 |
| 113 | Ga0068871_100515832 | 3300006358 | Bacteria | 1079 |
| 114 | Ga0075428_100015235 | 3300006844 | Bacteria | 8529 |
| 115 | Ga0075434_100255138 | 3300006871 | Bacteria | 1772 |
| 116 | Ga0075434_101121876 | 3300006871 | Bacteria | 799 |
| 117 | Ga0099794_10128885 | 3300007265 | Bacteria | 1276 |
| 118 | Ga0099795_10023434 | 3300007788 | Bacteria | 2049 |
| 119 | Ga0105251_10145479 | 3300009011 | Bacteria | 1072 |
| 120 | Ga0105250_10045362 | 3300009092 | Bacteria | 1762 |
| 121 | Ga0105247_10005195 | 3300009101 | Bacteria | 8231 |
| 122 | Ga0105243_10140680 | 3300009148 | Bacteria | 2059 |
| 123 | Ga0105242_11629610 | 3300009176 | Bacteria | 680 |
| 124 | Ga0105237_10004429 | 3300009545 | Bacteria | 16276 |
| 125 | Ga0105238_10052473 | 3300009551 | Bacteria | 4099 |
| 126 | Ga0105239_10007880 | 3300010375 | Bacteria | 12176 |
| 127 | Ga0105239_10954837 | 3300010375 | Bacteria | 985 |
| 128 | Ga0105246_10416534 | 3300011119 | Bacteria | 1120 |
| 129 | Ga0105246_10477644 | 3300011119 | Bacteria | 1054 |
| 130 | Ga0157335_1002836 | 3300012492 | Bacteria | 1073 |
| 131 | Ga0157342_1005110 | 3300012507 | Bacteria | 1195 |
| 132 | Ga0157338_1006795 | 3300012515 | Bacteria | 1068 |
| 133 | Ga0157373_10455186 | 3300013100 | Bacteria | 921 |
| 134 | Ga0157369_10195563 | 3300013105 | Bacteria | 2124 |
| 135 | Ga0157374_10007942 | 3300013296 | Bacteria | 9063 |
| 136 | Ga0163162_10305082 | 3300013306 | Bacteria | 1724 |
| 137 | Ga0157372_10731192 | 3300013307 | Bacteria | 1151 |
| 138 | Ga0163163_10216195 | 3300014325 | Bacteria | 1965 |
| 139 | Ga0163163_10382478 | 3300014325 | Bacteria | 1465 |
| 140 | Ga0157377_10020243 | 3300014745 | Bacteria | 3484 |
| 141 | Ga0157379_10271451 | 3300014968 | Bacteria | 1542 |
| 142 | Ga0182005_1200156 | 3300015265 | Bacteria | 600 |
| 143 | Ga0197907_10830985 | 3300020069 | Bacteria | 1163 |
| 144 | Ga0206356_11507630 | 3300020070 | Bacteria | 1100 |
| 145 | Ga0206350_10314167 | 3300020080 | Bacteria | 1075 |
| 146 | Ga0206353_10134612 | 3300020082 | Bacteria | 2135 |
| 147 | Ga0224712_10051149 | 3300022467 | Bacteria | 1608 |
| 148 | Ga0207656_10216315 | 3300025321 | Bacteria | 930 |
| 149 | Ga0207692_10042711 | 3300025898 | Bacteria | 2252 |
| 150 | Ga0207710_10013062 | 3300025900 | Bacteria | 3498 |
| 151 | Ga0207688_10003159 | 3300025901 | Bacteria | 8988 |
| 152 | Ga0207688_10059082 | 3300025901 | Bacteria | 2159 |
| 153 | Ga0207680_10076775 | 3300025903 | Bacteria | 2087 |
| 154 | Ga0207647_10018984 | 3300025904 | Bacteria | 4632 |
| 155 | Ga0207699_10058598 | 3300025906 | Bacteria | 2304 |
| 156 | Ga0207699_10116238 | 3300025906 | Bacteria | 1722 |
| 157 | Ga0207643_10021986 | 3300025908 | Bacteria | 3510 |
| 158 | Ga0207684_10009113 | 3300025910 | Bacteria | 8790 |
| 159 | Ga0207684_10067359 | 3300025910 | Bacteria | 3043 |
| 160 | Ga0207684_10261560 | 3300025910 | Bacteria | 1493 |
| 161 | Ga0207654_10149709 | 3300025911 | Bacteria | 1497 |
| 162 | Ga0207707_10025142 | 3300025912 | Bacteria | 5208 |
| 163 | Ga0207707_10974110 | 3300025912 | Bacteria | 697 |
| 164 | Ga0207671_10009509 | 3300025914 | Bacteria | 8120 |
| 165 | Ga0207671_10270906 | 3300025914 | Bacteria | 1338 |
| 166 | Ga0207693_10003995 | 3300025915 | Bacteria | 12535 |
| 167 | Ga0207693_10006476 | 3300025915 | Bacteria | 9702 |
| 168 | Ga0207693_10344097 | 3300025915 | Bacteria | 1167 |
| 169 | Ga0207663_10040694 | 3300025916 | Bacteria | 2827 |
| 170 | Ga0207663_10179348 | 3300025916 | Bacteria | 1511 |
| 171 | Ga0207663_10290731 | 3300025916 | Bacteria | 1217 |
| 172 | Ga0207662_10019679 | 3300025918 | Bacteria | 3845 |
| 173 | Ga0207657_10100966 | 3300025919 | Bacteria | 2395 |
| 174 | Ga0207646_10032714 | 3300025922 | Bacteria | 4705 |
| 175 | Ga0207694_10096038 | 3300025924 | Bacteria | 2344 |
| 176 | Ga0207694_10315505 | 3300025924 | Bacteria | 1289 |
| 177 | Ga0207650_10251321 | 3300025925 | Bacteria | 1431 |
| 178 | Ga0207659_10219597 | 3300025926 | Bacteria | 1527 |
| 179 | Ga0207700_10024898 | 3300025928 | Bacteria | 4148 |
| 180 | Ga0207700_10491374 | 3300025928 | Bacteria | 1085 |
| 181 | Ga0207700_11081911 | 3300025928 | Bacteria | 717 |
| 182 | Ga0207664_10006014 | 3300025929 | Bacteria | 8306 |
| 183 | Ga0207664_10182491 | 3300025929 | Bacteria | 1802 |
| 184 | Ga0207664_10311352 | 3300025929 | Bacteria | 1387 |
| 185 | Ga0207664_10495711 | 3300025929 | Bacteria | 1093 |
| 186 | Ga0207664_10559610 | 3300025929 | Bacteria | 1026 |
| 187 | Ga0207644_10301427 | 3300025931 | Bacteria | 1291 |
| 188 | Ga0207644_10579853 | 3300025931 | Bacteria | 930 |
| 189 | Ga0207644_10719944 | 3300025931 | Bacteria | 833 |
| 190 | Ga0207706_10232900 | 3300025933 | Bacteria | 1611 |
| 191 | Ga0207691_10127428 | 3300025940 | Bacteria | 2251 |
| 192 | Ga0207711_10264647 | 3300025941 | Bacteria | 1581 |
| 193 | Ga0207689_10001334 | 3300025942 | Bacteria | 23807 |
| 194 | Ga0207661_10286909 | 3300025944 | Bacteria | 1472 |
| 195 | Ga0207679_10028423 | 3300025945 | Bacteria | 3880 |
| 196 | Ga0207679_10385291 | 3300025945 | Bacteria | 1230 |
| 197 | Ga0207667_10452628 | 3300025949 | Bacteria | 1304 |
| 198 | Ga0207651_10255801 | 3300025960 | Bacteria | 1435 |
| 199 | Ga0207712_10362689 | 3300025961 | Bacteria | 1208 |
| 200 | Ga0207658_10196268 | 3300025986 | Bacteria | 1681 |
| 201 | Ga0207677_10266549 | 3300026023 | Bacteria | 1399 |
| 202 | Ga0207703_10626107 | 3300026035 | Bacteria | 1019 |
| 203 | Ga0207639_10218364 | 3300026041 | Bacteria | 1645 |
| 204 | Ga0207678_10002306 | 3300026067 | Bacteria | 17276 |
| 205 | Ga0207678_10092312 | 3300026067 | Bacteria | 2588 |
| 206 | Ga0207708_10011592 | 3300026075 | Bacteria | 6568 |
| 207 | Ga0207708_10561166 | 3300026075 | Bacteria | 964 |
| 208 | Ga0207708_10975175 | 3300026075 | Bacteria | 736 |
| 209 | Ga0207702_10010214 | 3300026078 | Bacteria | 7859 |
| 210 | Ga0207648_10113673 | 3300026089 | Bacteria | 2378 |
| 211 | Ga0207676_10235363 | 3300026095 | Bacteria | 1640 |
| 212 | Ga0207676_10521145 | 3300026095 | Bacteria | 1131 |
| 213 | Ga0207674_10002042 | 3300026116 | Bacteria | 25622 |
| 214 | Ga0207675_100014426 | 3300026118 | Bacteria | 7367 |
| 215 | Ga0207675_100398089 | 3300026118 | Bacteria | 1357 |
| 216 | Ga0207683_10009865 | 3300026121 | Bacteria | 8146 |
| 217 | Ga0207683_10203526 | 3300026121 | Bacteria | 1800 |
| 218 | Ga0207698_10162280 | 3300026142 | Bacteria | 1956 |
| 219 | Ga0207698_10531178 | 3300026142 | Bacteria | 1150 |
| 220 | Ga0268266_10080953 | 3300028379 | Bacteria | 2830 |
| 221 | Ga0268266_10710078 | 3300028379 | Bacteria | 969 |
| 222 | Ga0268266_11588408 | 3300028379 | Bacteria | 629 |
| 223 | Ga0268265_10135390 | 3300028380 | Bacteria | 2054 |
| 224 | Ga0268264_11601556 | 3300028381 | Bacteria | 662 |
| 225 | Ga0307512_10038727 | 3300030522 | Bacteria | 4006 |
| 226 | Ga0265762_1018174 | 3300030760 | Bacteria | 1282 |
| 227 | Ga0265762_1041744 | 3300030760 | Bacteria | 899 |
| 228 | Ga0307513_10698931 | 3300031456 | Bacteria | 720 |
| 229 | Ga0307516_10864686 | 3300031730 | Bacteria | 569 |
| 230 | Ga0307518_10047197 | 3300031838 | Bacteria | 3132 |
| 231 | Ga0307518_10307597 | 3300031838 | Bacteria | 958 |
| 232 | Ga0307406_10181706 | 3300031901 | Bacteria | 1532 |
| 233 | Ga0307415_101836625 | 3300032126 | Bacteria | 587 |
| 234 | Ga0307507_10004082 | 3300033179 | Bacteria | 26692 |
| 235 | Ga0307510_10226632 | 3300033180 | Bacteria | 1375 |
| 236 | Ga0316214_1011115 | 3300033545 | Bacteria | 1224 |
| 237 | Ga0373930_0038965 | 3300034816 | Bacteria | 1006 |
| 238 | Ga0373950_0050602 | 3300034818 | Bacteria | 815 |
| 239 | Ga0373959_0036199 | 3300034820 | Bacteria | 1018 |
| 240 | Ga0373926_0000876 | 3300035083 | Bacteria | 8614 |
| 241 | Ga0373928_0049077 | 3300035084 | Bacteria | 991 |
| 242 | Ga0373934_0118423 | 3300035086 | Bacteria | 1076 |
| 243 | Ga0373940_0018506 | 3300035088 | Bacteria | 1749 |
| 244 | Ga0373944_0002208 | 3300035089 | Bacteria | 4946 |
| 245 | Ga0373923_0036761 | 3300035111 | Bacteria | 2000 |
| 246 | Ga0373936_0000314 | 3300035113 | Bacteria | 16354 |
| 247 | Ga0373936_0524074 | 3300035113 | Bacteria | 552 |
| 248 | Ga0373945_0000066 | 3300035116 | Bacteria | 23678 |
| 249 | Ga0373945_0031512 | 3300035116 | Bacteria | 1874 |
| 250 | Ga0373953_0023786 | 3300035117 | Bacteria | 2322 |
| 251 | Ga0373957_0009452 | 3300035120 | Bacteria | 3191 |
| 252 | Ga0373957_0029031 | 3300035120 | Bacteria | 2018 |
| 253 | Ga0373960_0012068 | 3300035121 | Bacteria | 2140 |
| 254 | Ga0373943_0001292 | 3300035170 | Bacteria | 11237 |
| 255 | Ga0373943_0013688 | 3300035170 | Bacteria | 3666 |
| 256 | Ga0373946_0000073 | 3300035171 | Bacteria | 26844 |
| 257 | Ga0373955_0009329 | 3300035172 | Bacteria | 4595 |
| 258 | Ga0373955_0058527 | 3300035172 | Bacteria | 2121 |
| 259 | Ga0373955_0154546 | 3300035172 | Bacteria | 1351 |
| 260 | Ga0373955_0222144 | 3300035172 | Bacteria | 1128 |
| 261 | Ga0373942_0007228 | 3300035207 | Bacteria | 2573 |
| 262 | Ga0373961_0034880 | 3300035241 | Bacteria | 1425 |
| 263 | Ga0373962_0090566 | 3300035242 | Bacteria | 941 |
| 264 | Ga0373924_0069050 | 3300035410 | Bacteria | 1488 |
| 265 | Ga0373931_0014904 | 3300035691 | Bacteria | 3808 |
| 266 | Ga0373935_0000371 | 3300035692 | Bacteria | 23010 |
| 267 | Ga0373927_0001071 | 3300035695 | Bacteria | 20930 |
| 268 | Ga0373947_0000582 | 3300035725 | Bacteria | 21425 |
| 269 | Ga0373937_0060448 | 3300036401 | Bacteria | 3482 |
| 270 | Ga0373925_0059088 | 3300037068 | Bacteria | 2875 |
| 271 | Ga0373925_0083644 | 3300037068 | Bacteria | 2431 |
| 272 | Ga0436364_0875940 | 3300037853 | Bacteria | 990 |
| 273 | Ga0436364_0897023 | 3300037853 | Bacteria | 831 |
| 274 | Ga0436364_1341515 | 3300037853 | Bacteria | 6365 |
| 275 | Ga0436360_0796707 | 3300039438 | Bacteria | 1597 |
| 276 | Ga0436362_0875852 | 3300039453 | Bacteria | 826 |
| 277 | Ga0439466_0019022 | 3300041411 | Bacteria | 2460 |
| 278 | Ga0439465_0037284 | 3300041413 | Bacteria | 1563 |
| 279 | Ga0451791_0476237 | 3300041451 | Bacteria | 1426 |
| 280 | Ga0451853_1426811 | 3300041512 | Bacteria | 2445 |
| 281 | Ga0439442_005512 | 3300042002 | Bacteria | 2530 |
| 282 | Ga0466969_0059370 | 3300044656 | Bacteria | 1860 |
| 283 | Ga0466972_0013402 | 3300044658 | Bacteria | 4116 |
| 284 | Ga0466965_0005462 | 3300044683 | Bacteria | 5730 |
| 285 | Ga0466966_0029856 | 3300044684 | Bacteria | 3545 |
| 286 | Ga0466961_0021530 | 3300044693 | Bacteria | 4149 |
| 287 | Ga0466963_0259703 | 3300044694 | Bacteria | 1219 |
| 288 | Ga0466971_0057834 | 3300044719 | Bacteria | 1750 |
| 289 | Ga0466968_0003285 | 3300044735 | Bacteria | 5960 |
| 290 | Ga0466968_0014027 | 3300044735 | Bacteria | 3161 |
| 291 | Ga0466970_0038510 | 3300044765 | Bacteria | 2536 |
| 292 | Ga0466970_0082898 | 3300044765 | Bacteria | 1734 |
| 293 | Ga0466957_0088950 | 3300044842 | Bacteria | 1932 |
| 294 | Ga0466960_0000170 | 3300044901 | Bacteria | 22220 |
| 295 | Ga0466960_0034568 | 3300044901 | Bacteria | 2356 |
| 296 | Ga0466959_0098190 | 3300045049 | Bacteria | 2098 |
| 297 | Ga0466958_0037721 | 3300045836 | Bacteria | 2896 |
| 298 | Ga0466967_0220963 | 3300045976 | Bacteria | 1800 |
| 299 | Ga0466967_0274115 | 3300045976 | Bacteria | 1617 |
| 300 | Ga0466967_0561681 | 3300045976 | Bacteria | 1124 |
| 301 | Ga0495592_0005532 | 3300046454 | Bacteria | 9345 |
| 302 | Ga0495592_0034388 | 3300046454 | Bacteria | 3820 |
| 303 | Ga0495592_0078082 | 3300046454 | Bacteria | 2398 |
| 304 | Ga0495592_0395848 | 3300046454 | Bacteria | 876 |
| 305 | Ga0495603_0026525 | 3300046455 | Bacteria | 3499 |
| 306 | Ga0495629_0002241 | 3300046459 | Bacteria | 14904 |
| 307 | Ga0495629_0016388 | 3300046459 | Bacteria | 5319 |
| 308 | Ga0495638_0548958 | 3300046460 | Bacteria | 575 |
| 309 | Ga0495641_0003923 | 3300046461 | Bacteria | 10814 |
| 310 | Ga0495641_0033237 | 3300046461 | Bacteria | 2450 |
| 311 | Ga0495651_0022926 | 3300046462 | Bacteria | 4855 |
| 312 | Ga0495651_0028169 | 3300046462 | Bacteria | 4378 |
| 313 | Ga0495653_0001878 | 3300046463 | Bacteria | 16577 |
| 314 | Ga0495653_0008502 | 3300046463 | Bacteria | 8416 |
| 315 | Ga0495653_0011320 | 3300046463 | Bacteria | 7290 |
| 316 | Ga0495653_0016202 | 3300046463 | Bacteria | 6072 |
| 317 | Ga0495653_0115139 | 3300046463 | Bacteria | 1925 |
| 318 | Ga0495580_0013472 | 3300046472 | Bacteria | 6238 |
| 319 | Ga0495582_0150503 | 3300046473 | Bacteria | 1321 |
| 320 | Ga0495639_0018899 | 3300046475 | Bacteria | 3004 |
| 321 | Ga0495662_0001974 | 3300046476 | Bacteria | 10288 |
| 322 | Ga0495662_0088177 | 3300046476 | Bacteria | 1511 |
| 323 | Ga0495664_0002993 | 3300046477 | Bacteria | 9133 |
| 324 | Ga0495664_0007786 | 3300046477 | Bacteria | 5962 |
| 325 | Ga0495664_0032559 | 3300046477 | Bacteria | 3060 |
| 326 | Ga0495664_0041402 | 3300046477 | Unclassified | 2726 |
| 327 | Ga0495585_0046650 | 3300046492 | Bacteria | 2416 |
| 328 | Ga0495594_0000322 | 3300046499 | Bacteria | 23676 |
| 329 | Ga0495606_0026353 | 3300046507 | Bacteria | 4145 |
| 330 | Ga0495608_0002211 | 3300046511 | Bacteria | 14042 |
| 331 | Ga0495608_0025924 | 3300046511 | Bacteria | 4001 |
| 332 | Ga0495608_0073878 | 3300046511 | Bacteria | 2223 |
| 333 | Ga0495608_0333229 | 3300046511 | Bacteria | 936 |
| 334 | Ga0495608_0378983 | 3300046511 | Bacteria | 867 |
| 335 | Ga0495618_0038990 | 3300046514 | Bacteria | 2987 |
| 336 | Ga0495618_0066664 | 3300046514 | Bacteria | 2288 |
| 337 | Ga0495618_0155129 | 3300046514 | Bacteria | 1461 |
| 338 | Ga0495628_0011178 | 3300046516 | Bacteria | 7597 |
| 339 | Ga0495628_0020885 | 3300046516 | Bacteria | 5393 |
| 340 | Ga0495628_0050138 | 3300046516 | Bacteria | 3303 |
| 341 | Ga0495628_0057729 | 3300046516 | Bacteria | 3053 |
| 342 | Ga0495630_0016079 | 3300046517 | Bacteria | 5469 |
| 343 | Ga0495630_0075192 | 3300046517 | Bacteria | 2545 |
| 344 | Ga0495630_0139305 | 3300046517 | Bacteria | 1844 |
| 345 | Ga0495630_0314281 | 3300046517 | Bacteria | 1197 |
| 346 | Ga0495666_0000590 | 3300046526 | Bacteria | 16240 |
| 347 | Ga0495652_0004467 | 3300046529 | Bacteria | 13357 |
| 348 | Ga0495652_0037454 | 3300046529 | Bacteria | 4208 |
| 349 | Ga0495652_0069654 | 3300046529 | Bacteria | 2943 |
| 350 | Ga0495652_0398409 | 3300046529 | Bacteria | 975 |
| 351 | Ga0495665_0004853 | 3300046531 | Bacteria | 7254 |
| 352 | Ga0495665_0010069 | 3300046531 | Bacteria | 5122 |
| 353 | Ga0495665_0114249 | 3300046531 | Bacteria | 1415 |
| 354 | Ga0495640_0012620 | 3300046533 | Bacteria | 6449 |
| 355 | Ga0495640_0019173 | 3300046533 | Bacteria | 5053 |
| 356 | Ga0495640_0034135 | 3300046533 | Bacteria | 3612 |
| 357 | Ga0495640_0091047 | 3300046533 | Bacteria | 2012 |
| 358 | Ga0495586_0161230 | 3300046535 | Bacteria | 1265 |
| 359 | Ga0495587_0002970 | 3300046536 | Bacteria | 11338 |
| 360 | Ga0495587_0004915 | 3300046536 | Bacteria | 8764 |
| 361 | Ga0495645_0003904 | 3300046543 | Bacteria | 10164 |
| 362 | Ga0495645_0008482 | 3300046543 | Bacteria | 7175 |
| 363 | Ga0495645_0042103 | 3300046543 | Bacteria | 3330 |
| 364 | Ga0495645_0073758 | 3300046543 | Bacteria | 2458 |
| 365 | Ga0495645_0128263 | 3300046543 | Bacteria | 1780 |
| 366 | Ga0495633_0088623 | 3300046558 | Bacteria | 1439 |
| 367 | Ga0495667_0001289 | 3300046559 | Bacteria | 16420 |
| 368 | Ga0495667_0006211 | 3300046559 | Bacteria | 8094 |
| 369 | Ga0495667_0022489 | 3300046559 | Bacteria | 4247 |
| 370 | Ga0495667_0078634 | 3300046559 | Bacteria | 2144 |
| 371 | Ga0495668_0044252 | 3300046616 | Bacteria | 2474 |
| 372 | Ga0495668_0620011 | 3300046616 | Bacteria | 598 |
| 373 | Ga0495634_0005432 | 3300046642 | Bacteria | 9817 |
| 374 | Ga0495634_0005789 | 3300046642 | Bacteria | 9434 |
| 375 | Ga0495634_0357637 | 3300046642 | Bacteria | 873 |
| 376 | Ga0495634_0530124 | 3300046642 | Bacteria | 688 |
| 377 | Ga0495635_0000941 | 3300046663 | Bacteria | 19199 |
| 378 | Ga0495635_0007582 | 3300046663 | Bacteria | 7571 |
| 379 | Ga0495588_0022161 | 3300046674 | Bacteria | 3138 |
| 380 | Ga0495657_0001206 | 3300046675 | Bacteria | 22653 |
| 381 | Ga0495657_0090163 | 3300046675 | Bacteria | 1968 |
| 382 | Ga0495657_0231870 | 3300046675 | Bacteria | 1116 |
| 383 | Ga0495599_0002708 | 3300046678 | Bacteria | 10339 |
| 384 | Ga0495599_0047957 | 3300046678 | Bacteria | 2677 |
| 385 | Ga0495599_0059659 | 3300046678 | Bacteria | 2386 |
| 386 | Ga0495599_0177521 | 3300046678 | Bacteria | 1313 |
| 387 | Ga0495623_0023430 | 3300046679 | Bacteria | 3985 |
| 388 | Ga0495646_0020157 | 3300046680 | Bacteria | 4216 |
| 389 | Ga0495646_0068141 | 3300046680 | Bacteria | 2101 |
| 390 | Ga0495647_0012282 | 3300046681 | Bacteria | 2947 |
| 391 | Ga0495658_0033288 | 3300046683 | Bacteria | 2821 |
| 392 | Ga0495658_0296889 | 3300046683 | Bacteria | 1021 |
| 393 | Ga0495613_0002883 | 3300046689 | Bacteria | 12877 |
| 394 | Ga0495613_0003064 | 3300046689 | Bacteria | 12484 |
| 395 | Ga0495613_0072201 | 3300046689 | Bacteria | 2516 |
| 396 | Ga0495624_0017260 | 3300046690 | Bacteria | 4850 |
| 397 | Ga0495624_0113121 | 3300046690 | Bacteria | 1669 |
| 398 | Ga0495624_0130184 | 3300046690 | Bacteria | 1543 |
| 399 | Ga0495600_0001737 | 3300046809 | Bacteria | 12180 |
| 400 | Ga0495600_0040226 | 3300046809 | Bacteria | 3044 |
| 401 | Ga0495600_0415431 | 3300046809 | Bacteria | 835 |
| 402 | Ga0495581_0029973 | 3300047315 | Bacteria | 3154 |
| 403 | Ga0495581_0132372 | 3300047315 | Bacteria | 1453 |
| 404 | Ga0495604_0000482 | 3300047317 | Bacteria | 35034 |
| 405 | Ga0495604_0008179 | 3300047317 | Bacteria | 8277 |
| 406 | Ga0495674_0001678 | 3300047319 | Bacteria | 21774 |
| 407 | Ga0495674_0002739 | 3300047319 | Bacteria | 17109 |
| 408 | Ga0495674_0017961 | 3300047319 | Bacteria | 6585 |
| 409 | Ga0495674_0095653 | 3300047319 | Bacteria | 2532 |
| 410 | Ga0495674_0154852 | 3300047319 | Bacteria | 1920 |
| 411 | Ga0495674_0650777 | 3300047319 | Bacteria | 831 |
| 412 | Ga0495672_0002524 | 3300047320 | Bacteria | 16717 |
| 413 | Ga0495676_0032879 | 3300047321 | Bacteria | 4373 |
| 414 | Ga0495676_0040569 | 3300047321 | Bacteria | 3839 |
| 415 | Ga0495676_0105512 | 3300047321 | Bacteria | 2077 |
| 416 | Ga0495680_0008559 | 3300047322 | Bacteria | 9289 |
| 417 | Ga0495680_0010913 | 3300047322 | Bacteria | 8072 |
| 418 | Ga0495675_0020373 | 3300047444 | Bacteria | 4217 |
| 419 | Ga0495675_0042581 | 3300047444 | Bacteria | 2892 |
| 420 | Ga0495675_0365846 | 3300047444 | Bacteria | 846 |
| 421 | Ga0495673_0001014 | 3300047469 | Bacteria | 24774 |
| 422 | Ga0495684_0001504 | 3300047471 | Bacteria | 18649 |
| 423 | Ga0495684_0003168 | 3300047471 | Bacteria | 12896 |
| 424 | Ga0495684_0634435 | 3300047471 | Bacteria | 716 |
| 425 | Ga0495602_0048691 | 3300048088 | Bacteria | 3805 |
| 426 | Ga0495602_0075791 | 3300048088 | Bacteria | 2853 |
| 427 | Ga0495602_0123523 | 3300048088 | Bacteria | 2078 |
| 428 | Ga0495602_0357105 | 3300048088 | Bacteria | 1053 |
| 429 | Ga0495614_0001264 | 3300048089 | Bacteria | 10860 |
| 430 | Ga0496100_0000780 | 3300048903 | Bacteria | 15181 |
| 431 | Ga0496100_0127055 | 3300048903 | Bacteria | 1790 |
| 432 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 433 | Ga0496101_0077571 | 3300048904 | Bacteria | 2448 |
| 434 | Ga0496102_0000065 | 3300048905 | Bacteria | 161370 |
| 435 | Ga0496103_0000048 | 3300048906 | Bacteria | 160911 |
| 436 | Ga0496103_0027107 | 3300048906 | Bacteria | 3470 |
| 437 | Ga0496103_0209553 | 3300048906 | Bacteria | 1253 |
| 438 | Ga0496103_0702428 | 3300048906 | Bacteria | 641 |
| 439 | Ga0496104_0446464 | 3300048907 | Bacteria | 1205 |
| 440 | Ga0496105_0699531 | 3300048908 | Bacteria | 778 |
| 441 | Ga0496106_0107807 | 3300048909 | Bacteria | 2166 |
| 442 | Ga0496106_0441598 | 3300048909 | Bacteria | 1045 |
| 443 | Ga0496107_0034691 | 3300048910 | Bacteria | 3614 |
| 444 | Ga0496108_0499384 | 3300048911 | Bacteria | 1062 |
| 445 | Ga0496108_0874224 | 3300048911 | Bacteria | 772 |
| 446 | Ga0496109_0002787 | 3300048912 | Bacteria | 14644 |
| 447 | Ga0496109_0004328 | 3300048912 | Bacteria | 11860 |
| 448 | Ga0496109_0313667 | 3300048912 | Bacteria | 1479 |
| 449 | Ga0496110_0041545 | 3300048913 | Bacteria | 4013 |
| 450 | Ga0496110_0385935 | 3300048913 | Bacteria | 1276 |
| 451 | Ga0496111_0057185 | 3300048914 | Bacteria | 2823 |
| 452 | Ga0496112_0034944 | 3300048915 | Bacteria | 4892 |
| 453 | Ga0496113_0119346 | 3300048916 | Bacteria | 2060 |
| 454 | Ga0496113_1075812 | 3300048916 | Bacteria | 631 |
| 455 | Ga0496113_1292290 | 3300048916 | Bacteria | 568 |
| 456 | Ga0496114_0280359 | 3300048917 | Bacteria | 1469 |
| 457 | Ga0496115_0018107 | 3300048918 | Bacteria | 5399 |
| 458 | Ga0496115_0099897 | 3300048918 | Bacteria | 2378 |
| 459 | Ga0496116_0000125 | 3300048919 | Bacteria | 160885 |
| 460 | Ga0496117_0000111 | 3300048920 | Bacteria | 184570 |
| 461 | Ga0496118_0000083 | 3300048921 | Bacteria | 184570 |
| 462 | Ga0496121_0000728 | 3300048924 | Bacteria | 60874 |
| 463 | Ga0496125_0021933 | 3300048928 | Bacteria | 5939 |
| 464 | Ga0496126_0000220 | 3300048929 | Bacteria | 124547 |
| 465 | Ga0496126_0202277 | 3300048929 | Bacteria | 1676 |
| 466 | Ga0496126_0368779 | 3300048929 | Bacteria | 1171 |
| 467 | Ga0496126_0430768 | 3300048929 | Bacteria | 1065 |
| 468 | Ga0501031_0093871 | 3300049568 | Bacteria | 1958 |
| 469 | Ga0501032_0088532 | 3300049569 | Bacteria | 2055 |
| 470 | Ga0501033_0038007 | 3300049570 | Bacteria | 3601 |
| 471 | Ga0501034_0018238 | 3300049571 | Bacteria | 7200 |
| 472 | Ga0501034_0222620 | 3300049571 | Bacteria | 1839 |
| 473 | Ga0501036_0040078 | 3300049572 | Bacteria | 3962 |
| 474 | Ga0501038_0047264 | 3300049574 | Bacteria | 3728 |
| 475 | Ga0501042_0651929 | 3300049578 | Bacteria | 765 |
| 476 | Ga0501043_0027916 | 3300049579 | Bacteria | 4430 |
| 477 | Ga0501047_0108804 | 3300049581 | Bacteria | 2654 |
| 478 | Ga0501047_0160967 | 3300049581 | Bacteria | 2116 |
| 479 | Ga0501035_0121899 | 3300049822 | Bacteria | 2278 |
| 480 | Ga0501044_0042444 | 3300049823 | Bacteria | 4730 |
| 481 | Ga0501044_0389204 | 3300049823 | Bacteria | 1308 |
| 482 | Ga0501044_1278175 | 3300049823 | Bacteria | 601 |
| 483 | nmdc:mga03n38_246265_c1 | 3300050490 | Bacteria | 942 |
| 484 | nmdc:mga03n38_5266_c1 | 3300050490 | Bacteria | 4387 |
| 485 | nmdc:mga00v17_198405_c1 | 3300050491 | Bacteria | 1297 |
| 486 | nmdc:mga06z11_347191_c1 | 3300050494 | Bacteria | 888 |
| 487 | nmdc:mga07m45_14241_c1 | 3300050496 | Bacteria | 4232 |
| 488 | nmdc:mga07m45_17940_c1 | 3300050496 | Bacteria | 3809 |
| 489 | nmdc:mga0n895_622806_c1 | 3300050512 | Bacteria | 1080 |
| 490 | nmdc:mga0n895_762952_c1 | 3300050512 | Bacteria | 960 |
| 491 | Ga0495601_0005227 | 3300053077 | Bacteria | 7552 |
| 492 | Ga0495601_0009816 | 3300053077 | Bacteria | 5665 |
| 493 | Ga0495601_0249368 | 3300053077 | Bacteria | 1159 |
| 494 | Ga0495612_0137423 | 3300053078 | Bacteria | 1059 |
| 495 | Ga0495619_0011017 | 3300053085 | Bacteria | 5690 |
| 496 | Ga0495619_0101872 | 3300053085 | Bacteria | 1955 |
| 497 | Ga0500643_003652 | 3300053087 | Bacteria | 7271 |
| 498 | Ga0500559_0010239 | 3300053136 | Bacteria | 4031 |
| 499 | Ga0500585_137618 | 3300053144 | Bacteria | 861 |
| 500 | Ga0500616_0000116 | 3300053153 | Bacteria | 145790 |
| 501 | Ga0587106_099375 | 3300059605 | Bacteria | 592 |
| 502 | Ga0501082_0455401 | 3300060353 | Bacteria | 1118 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046642 | Ga0495634_0530124 | Ga0495634_0530124_236_670 | 139 |
| 2 | 3300048916 | Ga0496113_1292290 | Ga0496113_1292290_105_557 | 149 |
| 3 | 3300006186 | Ga0075369_10169729 | Ga0075369_101697291 | 150 |
| 4 | 3300006844 | Ga0075428_100015235 | Ga0075428_1000152353 | 150 |
| 5 | 3300048929 | Ga0496126_0202277 | Ga0496126_0202277_1052_1540 | 150 |
| 6 | 3300005436 | Ga0070713_100218132 | Ga0070713_1002181322 | 152 |
| 7 | 3300046531 | Ga0495665_0114249 | Ga0495665_0114249_828_1289 | 152 |
| 8 | iso_pu_bacteria | 2643221587 | 2643942534 | 155 |
| 9 | iso_pu_bacteria | 2643221677 | 2644429993 | 155 |
| 10 | 3300015265 | Ga0182005_1200156 | Ga0182005_12001561 | 156 |
| 11 | 3300044694 | Ga0466963_0259703 | Ga0466963_0259703_266_736 | 156 |
| 12 | iso_pu_bacteria | 2899359706 | 2899362126 | 156 |
| 13 | iso_pu_bacteria | 2582581312 | 2585297659 | 157 |
| 14 | iso_pu_bacteria | 2616644941 | 2616902812 | 157 |
| 15 | iso_pu_bacteria | 2862290372 | 2862296506 | 157 |
| 16 | iso_pu_bacteria | 3006486233 | 3006488060 | 157 |
| 17 | 3300003320 | rootH2_10059946 | rootH2_100599464 | 158 |
| 18 | 3300005937 | Ga0081455_10564639 | Ga0081455_105646392 | 158 |
| 19 | 3300032126 | Ga0307415_101836625 | Ga0307415_1018366251 | 158 |
| 20 | 3300049568 | Ga0501031_0093871 | Ga0501031_0093871_394_885 | 158 |
| 21 | 3300049569 | Ga0501032_0088532 | Ga0501032_0088532_219_710 | 158 |
| 22 | 3300049570 | Ga0501033_0038007 | Ga0501033_0038007_2177_2668 | 158 |
| 23 | 3300049571 | Ga0501034_0018238 | Ga0501034_0018238_3396_3887 | 158 |
| 24 | 3300049572 | Ga0501036_0040078 | Ga0501036_0040078_2152_2643 | 158 |
| 25 | 3300049574 | Ga0501038_0047264 | Ga0501038_0047264_2614_3105 | 158 |
| 26 | 3300049579 | Ga0501043_0027916 | Ga0501043_0027916_3293_3784 | 158 |
| 27 | 3300049581 | Ga0501047_0160967 | Ga0501047_0160967_32_523 | 158 |
| 28 | 3300049822 | Ga0501035_0121899 | Ga0501035_0121899_594_1085 | 158 |
| 29 | 3300049823 | Ga0501044_0042444 | Ga0501044_0042444_2614_3105 | 158 |
| 30 | iso_pu_bacteria | 2902792274 | 2902797188 | 158 |
| 31 | iso_pu_bacteria | 2917736166 | 2917743470 | 158 |
| 32 | iso_pu_bacteria | 2932398195 | 2932401600 | 158 |
| 33 | 3300005338 | Ga0068868_100139057 | Ga0068868_1001390572 | 159 |
| 34 | 3300005344 | Ga0070661_100160380 | Ga0070661_1001603802 | 159 |
| 35 | 3300005445 | Ga0070708_100297924 | Ga0070708_1002979242 | 159 |
| 36 | 3300005455 | Ga0070663_100351212 | Ga0070663_1003512122 | 159 |
| 37 | 3300005535 | Ga0070684_100055569 | Ga0070684_1000555692 | 159 |
| 38 | 3300005548 | Ga0070665_100826008 | Ga0070665_1008260082 | 159 |
| 39 | 3300005564 | Ga0070664_100511166 | Ga0070664_1005111662 | 159 |
| 40 | 3300005577 | Ga0068857_100551503 | Ga0068857_1005515032 | 159 |
| 41 | 3300005616 | Ga0068852_100057339 | Ga0068852_1000573394 | 159 |
| 42 | 3300005618 | Ga0068864_100205279 | Ga0068864_1002052792 | 159 |
| 43 | 3300005719 | Ga0068861_100702197 | Ga0068861_1007021972 | 159 |
| 44 | 3300005844 | Ga0068862_100445344 | Ga0068862_1004453442 | 159 |
| 45 | 3300013307 | Ga0157372_10731192 | Ga0157372_107311922 | 159 |
| 46 | 3300025944 | Ga0207661_10286909 | Ga0207661_102869092 | 159 |
| 47 | 3300025945 | Ga0207679_10385291 | Ga0207679_103852912 | 159 |
| 48 | 3300026023 | Ga0207677_10266549 | Ga0207677_102665492 | 159 |
| 49 | 3300026075 | Ga0207708_10561166 | Ga0207708_105611662 | 159 |
| 50 | 3300026095 | Ga0207676_10235363 | Ga0207676_102353632 | 159 |
| 51 | 3300028379 | Ga0268266_10710078 | Ga0268266_107100782 | 159 |
| 52 | 3300031838 | Ga0307518_10047197 | Ga0307518_100471973 | 159 |
| 53 | 3300037853 | Ga0436364_0875940 | Ga0436364_0875940_334_816 | 159 |
| 54 | 3300044901 | Ga0466960_0000170 | Ga0466960_0000170_10068_10556 | 159 |
| 55 | 3300053136 | Ga0500559_0010239 | Ga0500559_0010239_1225_1707 | 159 |
| 56 | 3300053144 | Ga0500585_137618 | Ga0500585_137618_254_736 | 159 |
| 57 | iso_pu_bacteria | 2738543005 | 2739204609 | 159 |
| 58 | iso_pu_bacteria | 2928142448 | 2928145448 | 159 |
| 59 | 3300005367 | Ga0070667_100226641 | Ga0070667_1002266412 | 160 |
| 60 | 3300005445 | Ga0070708_100294645 | Ga0070708_1002946452 | 160 |
| 61 | 3300005467 | Ga0070706_100486944 | Ga0070706_1004869441 | 160 |
| 62 | 3300005471 | Ga0070698_100015097 | Ga0070698_1000150977 | 160 |
| 63 | 3300005937 | Ga0081455_10184341 | Ga0081455_101843412 | 160 |
| 64 | 3300005985 | Ga0081539_10000173 | Ga0081539_1000017374 | 160 |
| 65 | 3300006178 | Ga0075367_10277460 | Ga0075367_102774602 | 160 |
| 66 | 3300025910 | Ga0207684_10067359 | Ga0207684_100673592 | 160 |
| 67 | 3300025986 | Ga0207658_10196268 | Ga0207658_101962682 | 160 |
| 68 | 3300028381 | Ga0268264_11601556 | Ga0268264_116015561 | 160 |
| 69 | 3300035086 | Ga0373934_0118423 | Ga0373934_0118423_532_1017 | 160 |
| 70 | 3300035117 | Ga0373953_0023786 | Ga0373953_0023786_1557_2042 | 160 |
| 71 | 3300035120 | Ga0373957_0009452 | Ga0373957_0009452_1459_1944 | 160 |
| 72 | 3300035172 | Ga0373955_0009329 | Ga0373955_0009329_2715_3200 | 160 |
| 73 | 3300036401 | Ga0373937_0060448 | Ga0373937_0060448_295_780 | 160 |
| 74 | 3300037068 | Ga0373925_0059088 | Ga0373925_0059088_1743_2228 | 160 |
| 75 | 3300046454 | Ga0495592_0005532 | Ga0495592_0005532_3758_4243 | 160 |
| 76 | 3300046463 | Ga0495653_0008502 | Ga0495653_0008502_1658_2143 | 160 |
| 77 | 3300046511 | Ga0495608_0002211 | Ga0495608_0002211_9611_10096 | 160 |
| 78 | 3300046514 | Ga0495618_0155129 | Ga0495618_0155129_349_834 | 160 |
| 79 | 3300046516 | Ga0495628_0011178 | Ga0495628_0011178_1092_1577 | 160 |
| 80 | 3300046529 | Ga0495652_0004467 | Ga0495652_0004467_7420_7905 | 160 |
| 81 | 3300046533 | Ga0495640_0012620 | Ga0495640_0012620_2062_2547 | 160 |
| 82 | 3300046536 | Ga0495587_0002970 | Ga0495587_0002970_10366_10851 | 160 |
| 83 | 3300046543 | Ga0495645_0008482 | Ga0495645_0008482_1193_1678 | 160 |
| 84 | 3300046559 | Ga0495667_0001289 | Ga0495667_0001289_4583_5068 | 160 |
| 85 | 3300046642 | Ga0495634_0357637 | Ga0495634_0357637_129_614 | 160 |
| 86 | 3300046663 | Ga0495635_0007582 | Ga0495635_0007582_1815_2300 | 160 |
| 87 | 3300046675 | Ga0495657_0001206 | Ga0495657_0001206_3995_4480 | 160 |
| 88 | 3300046678 | Ga0495599_0002708 | Ga0495599_0002708_7095_7580 | 160 |
| 89 | 3300046679 | Ga0495623_0023430 | Ga0495623_0023430_3223_3708 | 160 |
| 90 | 3300046680 | Ga0495646_0020157 | Ga0495646_0020157_2062_2547 | 160 |
| 91 | 3300046809 | Ga0495600_0001737 | Ga0495600_0001737_3411_3896 | 160 |
| 92 | 3300047317 | Ga0495604_0008179 | Ga0495604_0008179_6159_6644 | 160 |
| 93 | 3300047319 | Ga0495674_0017961 | Ga0495674_0017961_1906_2391 | 160 |
| 94 | 3300047319 | Ga0495674_0650777 | Ga0495674_0650777_295_780 | 160 |
| 95 | 3300047322 | Ga0495680_0008559 | Ga0495680_0008559_684_1169 | 160 |
| 96 | 3300047444 | Ga0495675_0020373 | Ga0495675_0020373_2559_3044 | 160 |
| 97 | 3300047471 | Ga0495684_0001504 | Ga0495684_0001504_8788_9273 | 160 |
| 98 | 3300048088 | Ga0495602_0075791 | Ga0495602_0075791_1623_2108 | 160 |
| 99 | 3300050494 | nmdc:mga06z11_347191_c1 | nmdc:mga06z11_347191_c1_108_593 | 160 |
| 100 | 3300053085 | Ga0495619_0011017 | Ga0495619_0011017_3760_4245 | 160 |
| 101 | 3300053153 | Ga0500616_0000116 | Ga0500616_0000116_82411_82896 | 160 |
| 102 | iso_pu_bacteria | 2565956761 | 2566996177 | 160 |
| 103 | iso_pu_bacteria | 2868088558 | 2868090213 | 160 |
| 104 | iso_pu_bacteria | 2904535858 | 2904540813 | 160 |
| 105 | iso_pu_bacteria | 2922554459 | 2922554904 | 160 |
| 106 | 3300002073 | JGI24745J21846_1042702 | JGI24745J21846_10427021 | 161 |
| 107 | 3300002077 | JGI24744J21845_10035094 | JGI24744J21845_100350942 | 161 |
| 108 | 3300005435 | Ga0070714_101156748 | Ga0070714_1011567481 | 161 |
| 109 | 3300005436 | Ga0070713_100062171 | Ga0070713_1000621712 | 161 |
| 110 | 3300005436 | Ga0070713_100186538 | Ga0070713_1001865383 | 161 |
| 111 | 3300005445 | Ga0070708_100624575 | Ga0070708_1006245752 | 161 |
| 112 | 3300005455 | Ga0070663_100088531 | Ga0070663_1000885312 | 161 |
| 113 | 3300005455 | Ga0070663_101041467 | Ga0070663_1010414671 | 161 |
| 114 | 3300005458 | Ga0070681_11224222 | Ga0070681_112242221 | 161 |
| 115 | 3300005466 | Ga0070685_10790194 | Ga0070685_107901941 | 161 |
| 116 | 3300005468 | Ga0070707_100398903 | Ga0070707_1003989032 | 161 |
| 117 | 3300005518 | Ga0070699_100125465 | Ga0070699_1001254652 | 161 |
| 118 | 3300005539 | Ga0068853_100123332 | Ga0068853_1001233322 | 161 |
| 119 | 3300005548 | Ga0070665_100021205 | Ga0070665_1000212055 | 161 |
| 120 | 3300005614 | Ga0068856_101152774 | Ga0068856_1011527741 | 161 |
| 121 | 3300005616 | Ga0068852_100468324 | Ga0068852_1004683241 | 161 |
| 122 | 3300005843 | Ga0068860_100218742 | Ga0068860_1002187423 | 161 |
| 123 | 3300005844 | Ga0068862_100296463 | Ga0068862_1002964631 | 161 |
| 124 | 3300006871 | Ga0075434_101121876 | Ga0075434_1011218762 | 161 |
| 125 | 3300007265 | Ga0099794_10128885 | Ga0099794_101288852 | 161 |
| 126 | 3300007788 | Ga0099795_10023434 | Ga0099795_100234342 | 161 |
| 127 | 3300009101 | Ga0105247_10005195 | Ga0105247_100051959 | 161 |
| 128 | 3300009148 | Ga0105243_10140680 | Ga0105243_101406802 | 161 |
| 129 | 3300009176 | Ga0105242_11629610 | Ga0105242_116296101 | 161 |
| 130 | 3300009545 | Ga0105237_10004429 | Ga0105237_100044299 | 161 |
| 131 | 3300009551 | Ga0105238_10052473 | Ga0105238_100524732 | 161 |
| 132 | 3300010375 | Ga0105239_10007880 | Ga0105239_100078806 | 161 |
| 133 | 3300010375 | Ga0105239_10954837 | Ga0105239_109548371 | 161 |
| 134 | 3300011119 | Ga0105246_10416534 | Ga0105246_104165342 | 161 |
| 135 | 3300012492 | Ga0157335_1002836 | Ga0157335_10028362 | 161 |
| 136 | 3300012507 | Ga0157342_1005110 | Ga0157342_10051102 | 161 |
| 137 | 3300012515 | Ga0157338_1006795 | Ga0157338_10067952 | 161 |
| 138 | 3300013296 | Ga0157374_10007942 | Ga0157374_100079424 | 161 |
| 139 | 3300013306 | Ga0163162_10305082 | Ga0163162_103050822 | 161 |
| 140 | 3300014325 | Ga0163163_10382478 | Ga0163163_103824782 | 161 |
| 141 | 3300014745 | Ga0157377_10020243 | Ga0157377_100202431 | 161 |
| 142 | 3300025901 | Ga0207688_10003159 | Ga0207688_100031595 | 161 |
| 143 | 3300025904 | Ga0207647_10018984 | Ga0207647_100189844 | 161 |
| 144 | 3300025912 | Ga0207707_10974110 | Ga0207707_109741101 | 161 |
| 145 | 3300025914 | Ga0207671_10009509 | Ga0207671_100095098 | 161 |
| 146 | 3300025924 | Ga0207694_10096038 | Ga0207694_100960382 | 161 |
| 147 | 3300025928 | Ga0207700_10491374 | Ga0207700_104913741 | 161 |
| 148 | 3300025928 | Ga0207700_11081911 | Ga0207700_110819111 | 161 |
| 149 | 3300025929 | Ga0207664_10006014 | Ga0207664_100060142 | 161 |
| 150 | 3300025931 | Ga0207644_10579853 | Ga0207644_105798532 | 161 |
| 151 | 3300025940 | Ga0207691_10127428 | Ga0207691_101274283 | 161 |
| 152 | 3300026041 | Ga0207639_10218364 | Ga0207639_102183642 | 161 |
| 153 | 3300026067 | Ga0207678_10092312 | Ga0207678_100923123 | 161 |
| 154 | 3300026075 | Ga0207708_10975175 | Ga0207708_109751751 | 161 |
| 155 | 3300026118 | Ga0207675_100398089 | Ga0207675_1003980891 | 161 |
| 156 | 3300026121 | Ga0207683_10203526 | Ga0207683_102035262 | 161 |
| 157 | 3300026142 | Ga0207698_10531178 | Ga0207698_105311782 | 161 |
| 158 | 3300028379 | Ga0268266_10080953 | Ga0268266_100809533 | 161 |
| 159 | 3300028380 | Ga0268265_10135390 | Ga0268265_101353902 | 161 |
| 160 | 3300030522 | Ga0307512_10038727 | Ga0307512_100387273 | 161 |
| 161 | 3300030760 | Ga0265762_1018174 | Ga0265762_10181742 | 161 |
| 162 | 3300030760 | Ga0265762_1041744 | Ga0265762_10417441 | 161 |
| 163 | 3300031456 | Ga0307513_10698931 | Ga0307513_106989311 | 161 |
| 164 | 3300031730 | Ga0307516_10864686 | Ga0307516_108646861 | 161 |
| 165 | 3300031838 | Ga0307518_10307597 | Ga0307518_103075971 | 161 |
| 166 | 3300031901 | Ga0307406_10181706 | Ga0307406_101817062 | 161 |
| 167 | 3300033179 | Ga0307507_10004082 | Ga0307507_1000408212 | 161 |
| 168 | 3300033180 | Ga0307510_10226632 | Ga0307510_102266322 | 161 |
| 169 | 3300033545 | Ga0316214_1011115 | Ga0316214_10111152 | 161 |
| 170 | 3300035113 | Ga0373936_0524074 | Ga0373936_0524074_38_526 | 161 |
| 171 | 3300035116 | Ga0373945_0031512 | Ga0373945_0031512_374_862 | 161 |
| 172 | 3300035170 | Ga0373943_0013688 | Ga0373943_0013688_823_1311 | 161 |
| 173 | 3300035207 | Ga0373942_0007228 | Ga0373942_0007228_933_1418 | 161 |
| 174 | 3300037068 | Ga0373925_0083644 | Ga0373925_0083644_916_1404 | 161 |
| 175 | 3300037853 | Ga0436364_1341515 | Ga0436364_1341515_4853_5341 | 161 |
| 176 | 3300039438 | Ga0436360_0796707 | Ga0436360_0796707_262_750 | 161 |
| 177 | 3300041411 | Ga0439466_0019022 | Ga0439466_0019022_808_1305 | 161 |
| 178 | 3300041413 | Ga0439465_0037284 | Ga0439465_0037284_560_1057 | 161 |
| 179 | 3300041451 | Ga0451791_0476237 | Ga0451791_0476237_389_877 | 161 |
| 180 | 3300041512 | Ga0451853_1426811 | Ga0451853_1426811_719_1213 | 161 |
| 181 | 3300042002 | Ga0439442_005512 | Ga0439442_005512_1280_1777 | 161 |
| 182 | 3300044656 | Ga0466969_0059370 | Ga0466969_0059370_1010_1498 | 161 |
| 183 | 3300044658 | Ga0466972_0013402 | Ga0466972_0013402_2398_2895 | 161 |
| 184 | 3300044683 | Ga0466965_0005462 | Ga0466965_0005462_2008_2505 | 161 |
| 185 | 3300044684 | Ga0466966_0029856 | Ga0466966_0029856_275_763 | 161 |
| 186 | 3300044693 | Ga0466961_0021530 | Ga0466961_0021530_2932_3420 | 161 |
| 187 | 3300044719 | Ga0466971_0057834 | Ga0466971_0057834_889_1377 | 161 |
| 188 | 3300044735 | Ga0466968_0003285 | Ga0466968_0003285_3917_4405 | 161 |
| 189 | 3300044735 | Ga0466968_0014027 | Ga0466968_0014027_44_541 | 161 |
| 190 | 3300044765 | Ga0466970_0038510 | Ga0466970_0038510_1096_1584 | 161 |
| 191 | 3300044765 | Ga0466970_0082898 | Ga0466970_0082898_96_593 | 161 |
| 192 | 3300044842 | Ga0466957_0088950 | Ga0466957_0088950_911_1408 | 161 |
| 193 | 3300044901 | Ga0466960_0034568 | Ga0466960_0034568_123_620 | 161 |
| 194 | 3300045049 | Ga0466959_0098190 | Ga0466959_0098190_1031_1519 | 161 |
| 195 | 3300045836 | Ga0466958_0037721 | Ga0466958_0037721_541_1038 | 161 |
| 196 | 3300045976 | Ga0466967_0220963 | Ga0466967_0220963_1241_1729 | 161 |
| 197 | 3300045976 | Ga0466967_0274115 | Ga0466967_0274115_873_1370 | 161 |
| 198 | 3300045976 | Ga0466967_0561681 | Ga0466967_0561681_489_977 | 161 |
| 199 | 3300046454 | Ga0495592_0078082 | Ga0495592_0078082_1189_1677 | 161 |
| 200 | 3300046454 | Ga0495592_0395848 | Ga0495592_0395848_158_646 | 161 |
| 201 | 3300046455 | Ga0495603_0026525 | Ga0495603_0026525_2010_2498 | 161 |
| 202 | 3300046459 | Ga0495629_0002241 | Ga0495629_0002241_93_614 | 161 |
| 203 | 3300046459 | Ga0495629_0016388 | Ga0495629_0016388_1847_2335 | 161 |
| 204 | 3300046460 | Ga0495638_0548958 | Ga0495638_0548958_64_552 | 161 |
| 205 | 3300046462 | Ga0495651_0028169 | Ga0495651_0028169_24_512 | 161 |
| 206 | 3300046463 | Ga0495653_0011320 | Ga0495653_0011320_1898_2386 | 161 |
| 207 | 3300046463 | Ga0495653_0115139 | Ga0495653_0115139_513_1001 | 161 |
| 208 | 3300046472 | Ga0495580_0013472 | Ga0495580_0013472_1079_1567 | 161 |
| 209 | 3300046476 | Ga0495662_0001974 | Ga0495662_0001974_2454_2942 | 161 |
| 210 | 3300046476 | Ga0495662_0088177 | Ga0495662_0088177_808_1296 | 161 |
| 211 | 3300046477 | Ga0495664_0002993 | Ga0495664_0002993_7924_8412 | 161 |
| 212 | 3300046477 | Ga0495664_0032559 | Ga0495664_0032559_1660_2148 | 161 |
| 213 | 3300046492 | Ga0495585_0046650 | Ga0495585_0046650_197_685 | 161 |
| 214 | 3300046499 | Ga0495594_0000322 | Ga0495594_0000322_2423_2911 | 161 |
| 215 | 3300046507 | Ga0495606_0026353 | Ga0495606_0026353_1483_1974 | 161 |
| 216 | 3300046511 | Ga0495608_0025924 | Ga0495608_0025924_2325_2813 | 161 |
| 217 | 3300046516 | Ga0495628_0020885 | Ga0495628_0020885_940_1428 | 161 |
| 218 | 3300046517 | Ga0495630_0016079 | Ga0495630_0016079_4907_5395 | 161 |
| 219 | 3300046517 | Ga0495630_0314281 | Ga0495630_0314281_152_640 | 161 |
| 220 | 3300046526 | Ga0495666_0000590 | Ga0495666_0000590_3578_4066 | 161 |
| 221 | 3300046529 | Ga0495652_0069654 | Ga0495652_0069654_1898_2386 | 161 |
| 222 | 3300046529 | Ga0495652_0398409 | Ga0495652_0398409_425_913 | 161 |
| 223 | 3300046531 | Ga0495665_0010069 | Ga0495665_0010069_2569_3057 | 161 |
| 224 | 3300046533 | Ga0495640_0019173 | Ga0495640_0019173_923_1411 | 161 |
| 225 | 3300046533 | Ga0495640_0091047 | Ga0495640_0091047_803_1291 | 161 |
| 226 | 3300046535 | Ga0495586_0161230 | Ga0495586_0161230_760_1248 | 161 |
| 227 | 3300046536 | Ga0495587_0004915 | Ga0495587_0004915_7109_7597 | 161 |
| 228 | 3300046543 | Ga0495645_0003904 | Ga0495645_0003904_1847_2335 | 161 |
| 229 | 3300046543 | Ga0495645_0042103 | Ga0495645_0042103_2618_3106 | 161 |
| 230 | 3300046558 | Ga0495633_0088623 | Ga0495633_0088623_671_1159 | 161 |
| 231 | 3300046559 | Ga0495667_0006211 | Ga0495667_0006211_5649_6137 | 161 |
| 232 | 3300046616 | Ga0495668_0620011 | Ga0495668_0620011_70_561 | 161 |
| 233 | 3300046642 | Ga0495634_0005432 | Ga0495634_0005432_9038_9526 | 161 |
| 234 | 3300046674 | Ga0495588_0022161 | Ga0495588_0022161_599_1087 | 161 |
| 235 | 3300046675 | Ga0495657_0090163 | Ga0495657_0090163_292_780 | 161 |
| 236 | 3300046678 | Ga0495599_0047957 | Ga0495599_0047957_1189_1677 | 161 |
| 237 | 3300046678 | Ga0495599_0177521 | Ga0495599_0177521_537_1025 | 161 |
| 238 | 3300046680 | Ga0495646_0068141 | Ga0495646_0068141_1056_1544 | 161 |
| 239 | 3300046689 | Ga0495613_0002883 | Ga0495613_0002883_4907_5395 | 161 |
| 240 | 3300046689 | Ga0495613_0003064 | Ga0495613_0003064_11755_12276 | 161 |
| 241 | 3300046690 | Ga0495624_0113121 | Ga0495624_0113121_697_1185 | 161 |
| 242 | 3300047315 | Ga0495581_0132372 | Ga0495581_0132372_35_523 | 161 |
| 243 | 3300047317 | Ga0495604_0000482 | Ga0495604_0000482_21354_21842 | 161 |
| 244 | 3300047319 | Ga0495674_0002739 | Ga0495674_0002739_12533_13021 | 161 |
| 245 | 3300047320 | Ga0495672_0002524 | Ga0495672_0002524_8743_9234 | 161 |
| 246 | 3300047321 | Ga0495676_0040569 | Ga0495676_0040569_2138_2626 | 161 |
| 247 | 3300047321 | Ga0495676_0105512 | Ga0495676_0105512_1495_2016 | 161 |
| 248 | 3300047444 | Ga0495675_0042581 | Ga0495675_0042581_1847_2335 | 161 |
| 249 | 3300047469 | Ga0495673_0001014 | Ga0495673_0001014_13901_14392 | 161 |
| 250 | 3300047471 | Ga0495684_0634435 | Ga0495684_0634435_164_652 | 161 |
| 251 | 3300048088 | Ga0495602_0048691 | Ga0495602_0048691_2888_3376 | 161 |
| 252 | 3300048088 | Ga0495602_0357105 | Ga0495602_0357105_42_530 | 161 |
| 253 | 3300048089 | Ga0495614_0001264 | Ga0495614_0001264_10094_10615 | 161 |
| 254 | 3300048903 | Ga0496100_0000780 | Ga0496100_0000780_4300_4791 | 161 |
| 255 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_40269_40760 | 161 |
| 256 | 3300048905 | Ga0496102_0000065 | Ga0496102_0000065_86832_87323 | 161 |
| 257 | 3300048906 | Ga0496103_0000048 | Ga0496103_0000048_86373_86864 | 161 |
| 258 | 3300048906 | Ga0496103_0209553 | Ga0496103_0209553_479_976 | 161 |
| 259 | 3300048906 | Ga0496103_0702428 | Ga0496103_0702428_124_612 | 161 |
| 260 | 3300048907 | Ga0496104_0446464 | Ga0496104_0446464_460_957 | 161 |
| 261 | 3300048908 | Ga0496105_0699531 | Ga0496105_0699531_198_689 | 161 |
| 262 | 3300048909 | Ga0496106_0441598 | Ga0496106_0441598_197_694 | 161 |
| 263 | 3300048911 | Ga0496108_0874224 | Ga0496108_0874224_241_726 | 161 |
| 264 | 3300048912 | Ga0496109_0002787 | Ga0496109_0002787_2656_3144 | 161 |
| 265 | 3300048912 | Ga0496109_0004328 | Ga0496109_0004328_4954_5451 | 161 |
| 266 | 3300048913 | Ga0496110_0385935 | Ga0496110_0385935_161_658 | 161 |
| 267 | 3300048915 | Ga0496112_0034944 | Ga0496112_0034944_164_661 | 161 |
| 268 | 3300048916 | Ga0496113_1075812 | Ga0496113_1075812_13_510 | 161 |
| 269 | 3300048917 | Ga0496114_0280359 | Ga0496114_0280359_83_568 | 161 |
| 270 | 3300048918 | Ga0496115_0099897 | Ga0496115_0099897_1512_1997 | 161 |
| 271 | 3300048919 | Ga0496116_0000125 | Ga0496116_0000125_74048_74539 | 161 |
| 272 | 3300048920 | Ga0496117_0000111 | Ga0496117_0000111_74048_74539 | 161 |
| 273 | 3300048921 | Ga0496118_0000083 | Ga0496118_0000083_74048_74539 | 161 |
| 274 | 3300048924 | Ga0496121_0000728 | Ga0496121_0000728_17430_17921 | 161 |
| 275 | 3300048929 | Ga0496126_0000220 | Ga0496126_0000220_44305_44796 | 161 |
| 276 | 3300049571 | Ga0501034_0222620 | Ga0501034_0222620_68_556 | 161 |
| 277 | 3300049578 | Ga0501042_0651929 | Ga0501042_0651929_236_724 | 161 |
| 278 | 3300049581 | Ga0501047_0108804 | Ga0501047_0108804_1870_2358 | 161 |
| 279 | 3300049823 | Ga0501044_0389204 | Ga0501044_0389204_26_520 | 161 |
| 280 | 3300049823 | Ga0501044_1278175 | Ga0501044_1278175_17_529 | 161 |
| 281 | 3300050496 | nmdc:mga07m45_17940_c1 | nmdc:mga07m45_17940_c1_213_707 | 161 |
| 282 | 3300050512 | nmdc:mga0n895_622806_c1 | nmdc:mga0n895_622806_c1_365_850 | 161 |
| 283 | 3300050512 | nmdc:mga0n895_762952_c1 | nmdc:mga0n895_762952_c1_372_860 | 161 |
| 284 | 3300053077 | Ga0495601_0005227 | Ga0495601_0005227_2270_2758 | 161 |
| 285 | 3300053078 | Ga0495612_0137423 | Ga0495612_0137423_507_995 | 161 |
| 286 | 3300053085 | Ga0495619_0101872 | Ga0495619_0101872_1444_1932 | 161 |
| 287 | 3300053087 | Ga0500643_003652 | Ga0500643_003652_2875_3366 | 161 |
| 288 | 3300059605 | Ga0587106_099375 | Ga0587106_099375_19_513 | 161 |
| 289 | 3300060353 | Ga0501082_0455401 | Ga0501082_0455401_130_618 | 161 |
| 290 | iso_pu_bacteria | 2515154155 | 2515853823 | 161 |
| 291 | 3300005356 | Ga0070674_100129431 | Ga0070674_1001294312 | 162 |
| 292 | 3300005435 | Ga0070714_101228460 | Ga0070714_1012284602 | 162 |
| 293 | 3300005467 | Ga0070706_100010288 | Ga0070706_1000102884 | 162 |
| 294 | 3300005471 | Ga0070698_100033811 | Ga0070698_1000338113 | 162 |
| 295 | 3300005614 | Ga0068856_100193149 | Ga0068856_1001931493 | 162 |
| 296 | 3300005841 | Ga0068863_100299162 | Ga0068863_1002991622 | 162 |
| 297 | 3300006028 | Ga0070717_10006637 | Ga0070717_100066373 | 162 |
| 298 | 3300006048 | Ga0075363_100002126 | Ga0075363_1000021262 | 162 |
| 299 | 3300006353 | Ga0075370_10024270 | Ga0075370_100242702 | 162 |
| 300 | 3300006358 | Ga0068871_100515832 | Ga0068871_1005158322 | 162 |
| 301 | 3300009011 | Ga0105251_10145479 | Ga0105251_101454792 | 162 |
| 302 | 3300025910 | Ga0207684_10009113 | Ga0207684_100091133 | 162 |
| 303 | 3300035083 | Ga0373926_0000876 | Ga0373926_0000876_63_551 | 162 |
| 304 | 3300035089 | Ga0373944_0002208 | Ga0373944_0002208_2669_3157 | 162 |
| 305 | 3300035111 | Ga0373923_0036761 | Ga0373923_0036761_1461_1949 | 162 |
| 306 | 3300035113 | Ga0373936_0000314 | Ga0373936_0000314_12290_12778 | 162 |
| 307 | 3300035116 | Ga0373945_0000066 | Ga0373945_0000066_5784_6272 | 162 |
| 308 | 3300035170 | Ga0373943_0001292 | Ga0373943_0001292_3588_4076 | 162 |
| 309 | 3300035171 | Ga0373946_0000073 | Ga0373946_0000073_21208_21696 | 162 |
| 310 | 3300035172 | Ga0373955_0154546 | Ga0373955_0154546_657_1145 | 162 |
| 311 | 3300035410 | Ga0373924_0069050 | Ga0373924_0069050_383_871 | 162 |
| 312 | 3300035692 | Ga0373935_0000371 | Ga0373935_0000371_7795_8283 | 162 |
| 313 | 3300035695 | Ga0373927_0001071 | Ga0373927_0001071_7754_8242 | 162 |
| 314 | 3300035725 | Ga0373947_0000582 | Ga0373947_0000582_19175_19663 | 162 |
| 315 | 3300046461 | Ga0495641_0003923 | Ga0495641_0003923_5343_5831 | 162 |
| 316 | 3300046463 | Ga0495653_0001878 | Ga0495653_0001878_4825_5313 | 162 |
| 317 | 3300046473 | Ga0495582_0150503 | Ga0495582_0150503_62_550 | 162 |
| 318 | 3300046475 | Ga0495639_0018899 | Ga0495639_0018899_1162_1650 | 162 |
| 319 | 3300046477 | Ga0495664_0007786 | Ga0495664_0007786_4339_4827 | 162 |
| 320 | 3300046511 | Ga0495608_0378983 | Ga0495608_0378983_262_750 | 162 |
| 321 | 3300046517 | Ga0495630_0139305 | Ga0495630_0139305_573_1061 | 162 |
| 322 | 3300046531 | Ga0495665_0004853 | Ga0495665_0004853_6430_6918 | 162 |
| 323 | 3300046543 | Ga0495645_0073758 | Ga0495645_0073758_1681_2169 | 162 |
| 324 | 3300046559 | Ga0495667_0022489 | Ga0495667_0022489_99_587 | 162 |
| 325 | 3300046616 | Ga0495668_0044252 | Ga0495668_0044252_84_581 | 162 |
| 326 | 3300046642 | Ga0495634_0005789 | Ga0495634_0005789_5283_5771 | 162 |
| 327 | 3300046663 | Ga0495635_0000941 | Ga0495635_0000941_11164_11652 | 162 |
| 328 | 3300046675 | Ga0495657_0231870 | Ga0495657_0231870_241_729 | 162 |
| 329 | 3300046678 | Ga0495599_0059659 | Ga0495599_0059659_1609_2097 | 162 |
| 330 | 3300046683 | Ga0495658_0296889 | Ga0495658_0296889_428_916 | 162 |
| 331 | 3300046690 | Ga0495624_0017260 | Ga0495624_0017260_2298_2786 | 162 |
| 332 | 3300046809 | Ga0495600_0415431 | Ga0495600_0415431_298_786 | 162 |
| 333 | 3300047315 | Ga0495581_0029973 | Ga0495581_0029973_2226_2714 | 162 |
| 334 | 3300047319 | Ga0495674_0001678 | Ga0495674_0001678_13642_14130 | 162 |
| 335 | 3300047321 | Ga0495676_0032879 | Ga0495676_0032879_3451_3939 | 162 |
| 336 | 3300047322 | Ga0495680_0010913 | Ga0495680_0010913_4898_5386 | 162 |
| 337 | 3300047471 | Ga0495684_0003168 | Ga0495684_0003168_7141_7629 | 162 |
| 338 | 3300048928 | Ga0496125_0021933 | Ga0496125_0021933_1566_2063 | 162 |
| 339 | 3300050490 | nmdc:mga03n38_246265_c1 | nmdc:mga03n38_246265_c1_56_553 | 162 |
| 340 | 3300050490 | nmdc:mga03n38_5266_c1 | nmdc:mga03n38_5266_c1_1497_1994 | 162 |
| 341 | 3300050491 | nmdc:mga00v17_198405_c1 | nmdc:mga00v17_198405_c1_745_1242 | 162 |
| 342 | 3300050496 | nmdc:mga07m45_14241_c1 | nmdc:mga07m45_14241_c1_1436_1933 | 162 |
| 343 | iso_pu_bacteria | 2738541308 | 2738888727 | 162 |
| 344 | 3300013105 | Ga0157369_10195563 | Ga0157369_101955632 | 163 |
| 345 | 3300025929 | Ga0207664_10495711 | Ga0207664_104957112 | 163 |
| 346 | 3300035120 | Ga0373957_0029031 | Ga0373957_0029031_1306_1797 | 163 |
| 347 | 3300035172 | Ga0373955_0058527 | Ga0373955_0058527_1415_1924 | 163 |
| 348 | 3300035172 | Ga0373955_0222144 | Ga0373955_0222144_550_1041 | 163 |
| 349 | 3300046454 | Ga0495592_0034388 | Ga0495592_0034388_1286_1795 | 163 |
| 350 | 3300046461 | Ga0495641_0033237 | Ga0495641_0033237_77_586 | 163 |
| 351 | 3300046462 | Ga0495651_0022926 | Ga0495651_0022926_3782_4273 | 163 |
| 352 | 3300046463 | Ga0495653_0016202 | Ga0495653_0016202_4000_4491 | 163 |
| 353 | 3300046511 | Ga0495608_0073878 | Ga0495608_0073878_533_1024 | 163 |
| 354 | 3300046511 | Ga0495608_0333229 | Ga0495608_0333229_263_772 | 163 |
| 355 | 3300046514 | Ga0495618_0038990 | Ga0495618_0038990_1530_2021 | 163 |
| 356 | 3300046514 | Ga0495618_0066664 | Ga0495618_0066664_586_1095 | 163 |
| 357 | 3300046516 | Ga0495628_0050138 | Ga0495628_0050138_1652_2143 | 163 |
| 358 | 3300046516 | Ga0495628_0057729 | Ga0495628_0057729_606_1115 | 163 |
| 359 | 3300046517 | Ga0495630_0075192 | Ga0495630_0075192_1833_2342 | 163 |
| 360 | 3300046529 | Ga0495652_0037454 | Ga0495652_0037454_3595_4104 | 163 |
| 361 | 3300046533 | Ga0495640_0034135 | Ga0495640_0034135_2614_3123 | 163 |
| 362 | 3300046543 | Ga0495645_0128263 | Ga0495645_0128263_792_1301 | 163 |
| 363 | 3300046559 | Ga0495667_0078634 | Ga0495667_0078634_577_1068 | 163 |
| 364 | 3300046681 | Ga0495647_0012282 | Ga0495647_0012282_881_1390 | 163 |
| 365 | 3300046683 | Ga0495658_0033288 | Ga0495658_0033288_245_754 | 163 |
| 366 | 3300046689 | Ga0495613_0072201 | Ga0495613_0072201_31_540 | 163 |
| 367 | 3300046690 | Ga0495624_0130184 | Ga0495624_0130184_973_1482 | 163 |
| 368 | 3300046809 | Ga0495600_0040226 | Ga0495600_0040226_1928_2419 | 163 |
| 369 | 3300047319 | Ga0495674_0095653 | Ga0495674_0095653_1342_1851 | 163 |
| 370 | 3300047319 | Ga0495674_0154852 | Ga0495674_0154852_342_833 | 163 |
| 371 | 3300047444 | Ga0495675_0365846 | Ga0495675_0365846_293_802 | 163 |
| 372 | 3300048088 | Ga0495602_0123523 | Ga0495602_0123523_1201_1710 | 163 |
| 373 | 3300048918 | Ga0496115_0018107 | Ga0496115_0018107_3250_3759 | 163 |
| 374 | 3300048929 | Ga0496126_0430768 | Ga0496126_0430768_249_758 | 163 |
| 375 | 3300053077 | Ga0495601_0009816 | Ga0495601_0009816_2078_2587 | 163 |
| 376 | 3300053077 | Ga0495601_0249368 | Ga0495601_0249368_410_919 | 163 |
| 377 | 3300005435 | Ga0070714_100038216 | Ga0070714_1000382164 | 164 |
| 378 | 3300005437 | Ga0070710_10185113 | Ga0070710_101851132 | 164 |
| 379 | 3300005437 | Ga0070710_10243312 | Ga0070710_102433122 | 164 |
| 380 | 3300005437 | Ga0070710_10294223 | Ga0070710_102942231 | 164 |
| 381 | 3300006028 | Ga0070717_10010777 | Ga0070717_100107776 | 164 |
| 382 | 3300006163 | Ga0070715_10046792 | Ga0070715_100467922 | 164 |
| 383 | 3300025898 | Ga0207692_10042711 | Ga0207692_100427111 | 164 |
| 384 | 3300025915 | Ga0207693_10003995 | Ga0207693_100039955 | 164 |
| 385 | 3300025916 | Ga0207663_10040694 | Ga0207663_100406942 | 164 |
| 386 | 3300025929 | Ga0207664_10182491 | Ga0207664_101824912 | 164 |
| 387 | 3300025929 | Ga0207664_10559610 | Ga0207664_105596102 | 164 |
| 388 | 3300025931 | Ga0207644_10719944 | Ga0207644_107199442 | 164 |
| 389 | 3300039453 | Ga0436362_0875852 | Ga0436362_0875852_170_682 | 164 |
| 390 | 3300046477 | Ga0495664_0041402 | Ga0495664_0041402_221_733 | 164 |
| 391 | 3300005467 | Ga0070706_100140518 | Ga0070706_1001405183 | 167 |
| 392 | 3300025910 | Ga0207684_10261560 | Ga0207684_102615602 | 167 |
| 393 | 3300001978 | JGI24747J21853_1032784 | JGI24747J21853_10327841 | 168 |
| 394 | 3300001979 | JGI24740J21852_10099037 | JGI24740J21852_100990371 | 168 |
| 395 | 3300001991 | JGI24743J22301_10044772 | JGI24743J22301_100447722 | 168 |
| 396 | 3300005327 | Ga0070658_10185495 | Ga0070658_101854952 | 168 |
| 397 | 3300005328 | Ga0070676_10178240 | Ga0070676_101782402 | 168 |
| 398 | 3300005329 | Ga0070683_100010691 | Ga0070683_1000106917 | 168 |
| 399 | 3300005330 | Ga0070690_100157638 | Ga0070690_1001576382 | 168 |
| 400 | 3300005334 | Ga0068869_100273727 | Ga0068869_1002737272 | 168 |
| 401 | 3300005335 | Ga0070666_10009723 | Ga0070666_100097235 | 168 |
| 402 | 3300005336 | Ga0070680_100075244 | Ga0070680_1000752442 | 168 |
| 403 | 3300005337 | Ga0070682_100078446 | Ga0070682_1000784462 | 168 |
| 404 | 3300005339 | Ga0070660_100087569 | Ga0070660_1000875693 | 168 |
| 405 | 3300005341 | Ga0070691_10025510 | Ga0070691_100255102 | 168 |
| 406 | 3300005344 | Ga0070661_100236388 | Ga0070661_1002363882 | 168 |
| 407 | 3300005347 | Ga0070668_100559205 | Ga0070668_1005592052 | 168 |
| 408 | 3300005354 | Ga0070675_100040688 | Ga0070675_1000406883 | 168 |
| 409 | 3300005364 | Ga0070673_100108404 | Ga0070673_1001084042 | 168 |
| 410 | 3300005366 | Ga0070659_100150807 | Ga0070659_1001508072 | 168 |
| 411 | 3300005367 | Ga0070667_100502473 | Ga0070667_1005024732 | 168 |
| 412 | 3300005438 | Ga0070701_10003907 | Ga0070701_100039072 | 168 |
| 413 | 3300005439 | Ga0070711_100036343 | Ga0070711_1000363432 | 168 |
| 414 | 3300005440 | Ga0070705_100019573 | Ga0070705_1000195734 | 168 |
| 415 | 3300005441 | Ga0070700_100092717 | Ga0070700_1000927172 | 168 |
| 416 | 3300005455 | Ga0070663_100004385 | Ga0070663_1000043851 | 168 |
| 417 | 3300005456 | Ga0070678_100354498 | Ga0070678_1003544981 | 168 |
| 418 | 3300005457 | Ga0070662_100168674 | Ga0070662_1001686742 | 168 |
| 419 | 3300005458 | Ga0070681_10147646 | Ga0070681_101476462 | 168 |
| 420 | 3300005466 | Ga0070685_10147211 | Ga0070685_101472111 | 168 |
| 421 | 3300005468 | Ga0070707_100310916 | Ga0070707_1003109161 | 168 |
| 422 | 3300005471 | Ga0070698_100298504 | Ga0070698_1002985041 | 168 |
| 423 | 3300005530 | Ga0070679_100014169 | Ga0070679_1000141696 | 168 |
| 424 | 3300005535 | Ga0070684_100331080 | Ga0070684_1003310802 | 168 |
| 425 | 3300005543 | Ga0070672_100039666 | Ga0070672_1000396662 | 168 |
| 426 | 3300005544 | Ga0070686_100018252 | Ga0070686_1000182521 | 168 |
| 427 | 3300005545 | Ga0070695_100042959 | Ga0070695_1000429593 | 168 |
| 428 | 3300005546 | Ga0070696_100032530 | Ga0070696_1000325302 | 168 |
| 429 | 3300005547 | Ga0070693_100128722 | Ga0070693_1001287222 | 168 |
| 430 | 3300005548 | Ga0070665_100111257 | Ga0070665_1001112574 | 168 |
| 431 | 3300005564 | Ga0070664_100004731 | Ga0070664_1000047311 | 168 |
| 432 | 3300005577 | Ga0068857_100049915 | Ga0068857_1000499152 | 168 |
| 433 | 3300005578 | Ga0068854_100123257 | Ga0068854_1001232572 | 168 |
| 434 | 3300005616 | Ga0068852_100758872 | Ga0068852_1007588722 | 168 |
| 435 | 3300005618 | Ga0068864_100333654 | Ga0068864_1003336542 | 168 |
| 436 | 3300005718 | Ga0068866_10090570 | Ga0068866_100905702 | 168 |
| 437 | 3300005719 | Ga0068861_100252515 | Ga0068861_1002525152 | 168 |
| 438 | 3300005834 | Ga0068851_10094111 | Ga0068851_100941112 | 168 |
| 439 | 3300005840 | Ga0068870_10022978 | Ga0068870_100229782 | 168 |
| 440 | 3300005841 | Ga0068863_100222610 | Ga0068863_1002226102 | 168 |
| 441 | 3300005842 | Ga0068858_100340492 | Ga0068858_1003404922 | 168 |
| 442 | 3300005843 | Ga0068860_100158977 | Ga0068860_1001589773 | 168 |
| 443 | 3300006028 | Ga0070717_10277113 | Ga0070717_102771132 | 168 |
| 444 | 3300006163 | Ga0070715_10130635 | Ga0070715_101306352 | 168 |
| 445 | 3300006173 | Ga0070716_100140893 | Ga0070716_1001408932 | 168 |
| 446 | 3300006175 | Ga0070712_100003399 | Ga0070712_1000033992 | 168 |
| 447 | 3300006358 | Ga0068871_100114378 | Ga0068871_1001143782 | 168 |
| 448 | 3300006871 | Ga0075434_100255138 | Ga0075434_1002551382 | 168 |
| 449 | 3300009092 | Ga0105250_10045362 | Ga0105250_100453622 | 168 |
| 450 | 3300011119 | Ga0105246_10477644 | Ga0105246_104776442 | 168 |
| 451 | 3300013100 | Ga0157373_10455186 | Ga0157373_104551862 | 168 |
| 452 | 3300014325 | Ga0163163_10216195 | Ga0163163_102161951 | 168 |
| 453 | 3300014968 | Ga0157379_10271451 | Ga0157379_102714512 | 168 |
| 454 | 3300020069 | Ga0197907_10830985 | Ga0197907_108309852 | 168 |
| 455 | 3300020070 | Ga0206356_11507630 | Ga0206356_115076302 | 168 |
| 456 | 3300020080 | Ga0206350_10314167 | Ga0206350_103141672 | 168 |
| 457 | 3300020082 | Ga0206353_10134612 | Ga0206353_101346122 | 168 |
| 458 | 3300022467 | Ga0224712_10051149 | Ga0224712_100511492 | 168 |
| 459 | 3300025321 | Ga0207656_10216315 | Ga0207656_102163151 | 168 |
| 460 | 3300025900 | Ga0207710_10013062 | Ga0207710_100130623 | 168 |
| 461 | 3300025901 | Ga0207688_10059082 | Ga0207688_100590822 | 168 |
| 462 | 3300025903 | Ga0207680_10076775 | Ga0207680_100767752 | 168 |
| 463 | 3300025906 | Ga0207699_10058598 | Ga0207699_100585981 | 168 |
| 464 | 3300025906 | Ga0207699_10116238 | Ga0207699_101162382 | 168 |
| 465 | 3300025908 | Ga0207643_10021986 | Ga0207643_100219863 | 168 |
| 466 | 3300025911 | Ga0207654_10149709 | Ga0207654_101497092 | 168 |
| 467 | 3300025912 | Ga0207707_10025142 | Ga0207707_100251425 | 168 |
| 468 | 3300025914 | Ga0207671_10270906 | Ga0207671_102709062 | 168 |
| 469 | 3300025915 | Ga0207693_10006476 | Ga0207693_100064762 | 168 |
| 470 | 3300025915 | Ga0207693_10344097 | Ga0207693_103440972 | 168 |
| 471 | 3300025916 | Ga0207663_10179348 | Ga0207663_101793482 | 168 |
| 472 | 3300025916 | Ga0207663_10290731 | Ga0207663_102907312 | 168 |
| 473 | 3300025918 | Ga0207662_10019679 | Ga0207662_100196794 | 168 |
| 474 | 3300025919 | Ga0207657_10100966 | Ga0207657_101009663 | 168 |
| 475 | 3300025922 | Ga0207646_10032714 | Ga0207646_100327147 | 168 |
| 476 | 3300025924 | Ga0207694_10315505 | Ga0207694_103155052 | 168 |
| 477 | 3300025925 | Ga0207650_10251321 | Ga0207650_102513211 | 168 |
| 478 | 3300025926 | Ga0207659_10219597 | Ga0207659_102195972 | 168 |
| 479 | 3300025928 | Ga0207700_10024898 | Ga0207700_100248985 | 168 |
| 480 | 3300025929 | Ga0207664_10311352 | Ga0207664_103113522 | 168 |
| 481 | 3300025931 | Ga0207644_10301427 | Ga0207644_103014272 | 168 |
| 482 | 3300025933 | Ga0207706_10232900 | Ga0207706_102329002 | 168 |
| 483 | 3300025941 | Ga0207711_10264647 | Ga0207711_102646472 | 168 |
| 484 | 3300025942 | Ga0207689_10001334 | Ga0207689_1000133413 | 168 |
| 485 | 3300025945 | Ga0207679_10028423 | Ga0207679_100284232 | 168 |
| 486 | 3300025949 | Ga0207667_10452628 | Ga0207667_104526282 | 168 |
| 487 | 3300025960 | Ga0207651_10255801 | Ga0207651_102558012 | 168 |
| 488 | 3300025961 | Ga0207712_10362689 | Ga0207712_103626892 | 168 |
| 489 | 3300026035 | Ga0207703_10626107 | Ga0207703_106261072 | 168 |
| 490 | 3300026067 | Ga0207678_10002306 | Ga0207678_100023064 | 168 |
| 491 | 3300026075 | Ga0207708_10011592 | Ga0207708_100115923 | 168 |
| 492 | 3300026078 | Ga0207702_10010214 | Ga0207702_100102145 | 168 |
| 493 | 3300026089 | Ga0207648_10113673 | Ga0207648_101136731 | 168 |
| 494 | 3300026095 | Ga0207676_10521145 | Ga0207676_105211452 | 168 |
| 495 | 3300026116 | Ga0207674_10002042 | Ga0207674_1000204221 | 168 |
| 496 | 3300026118 | Ga0207675_100014426 | Ga0207675_1000144262 | 168 |
| 497 | 3300026121 | Ga0207683_10009865 | Ga0207683_100098658 | 168 |
| 498 | 3300026142 | Ga0207698_10162280 | Ga0207698_101622801 | 168 |
| 499 | 3300028379 | Ga0268266_11588408 | Ga0268266_115884082 | 168 |
| 500 | 3300034816 | Ga0373930_0038965 | Ga0373930_0038965_28_534 | 168 |
| 501 | 3300034818 | Ga0373950_0050602 | Ga0373950_0050602_187_693 | 168 |
| 502 | 3300034820 | Ga0373959_0036199 | Ga0373959_0036199_454_960 | 168 |
| 503 | 3300035084 | Ga0373928_0049077 | Ga0373928_0049077_171_677 | 168 |
| 504 | 3300035088 | Ga0373940_0018506 | Ga0373940_0018506_949_1455 | 168 |
| 505 | 3300035121 | Ga0373960_0012068 | Ga0373960_0012068_230_736 | 168 |
| 506 | 3300035241 | Ga0373961_0034880 | Ga0373961_0034880_234_740 | 168 |
| 507 | 3300035242 | Ga0373962_0090566 | Ga0373962_0090566_97_603 | 168 |
| 508 | 3300035691 | Ga0373931_0014904 | Ga0373931_0014904_3279_3785 | 168 |
| 509 | 3300037853 | Ga0436364_0897023 | Ga0436364_0897023_284_793 | 168 |
| 510 | 3300048903 | Ga0496100_0127055 | Ga0496100_0127055_268_774 | 168 |
| 511 | 3300048904 | Ga0496101_0077571 | Ga0496101_0077571_1897_2403 | 168 |
| 512 | 3300048906 | Ga0496103_0027107 | Ga0496103_0027107_1630_2136 | 168 |
| 513 | 3300048909 | Ga0496106_0107807 | Ga0496106_0107807_50_556 | 168 |
| 514 | 3300048910 | Ga0496107_0034691 | Ga0496107_0034691_2855_3361 | 168 |
| 515 | 3300048911 | Ga0496108_0499384 | Ga0496108_0499384_63_569 | 168 |
| 516 | 3300048912 | Ga0496109_0313667 | Ga0496109_0313667_730_1236 | 168 |
| 517 | 3300048913 | Ga0496110_0041545 | Ga0496110_0041545_3070_3576 | 168 |
| 518 | 3300048914 | Ga0496111_0057185 | Ga0496111_0057185_1635_2141 | 168 |
| 519 | 3300048916 | Ga0496113_0119346 | Ga0496113_0119346_264_770 | 168 |
| 520 | 3300048929 | Ga0496126_0368779 | Ga0496126_0368779_384_890 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7l8l-assembly1.cif.gz_A | crystal structure of human r152h gpx4-u46c | 0.9325 | 2 | 161 |
| 2v1m-assembly1.cif.gz_A | crystal structure of schistosoma mansoni glutathione peroxidase | 0.9272 | 1 | 164 |
| 5l71-assembly1.cif.gz_A | crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) | 0.9187 | 1 | 161 |
| 7l8m-assembly1.cif.gz_A | crystal structure of human gpx4-u46c mutant k48l | 0.917 | 2 | 161 |
| 7l8r-assembly2.cif.gz_B | crystal structure of human gpx4-u46c mutant k48a | 0.916 | 2 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CY93_66_221_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9321 | 2 | 160 | 3.40.30.10 |
| af_O59858_1_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9277 | 3 | 161 | 3.40.30.10 |
| af_P06610_1_183_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9273 | 2 | 160 | 3.40.30.10 |
| af_Q2FUZ6_1_164_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.921 | 2 | 164 | 3.40.30.10 |
| 2p31B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9135 | 1 | 162 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3XYZ8-F1-model_v4 | Glutathione peroxidase | 0.9844 | 1 | 161 |
GO:0004601
GO:0034599 |
| AF-A0A7X0EYC3-F1-model_v4 | Glutathione peroxidase | 0.9836 | 1 | 161 |
GO:0004602
GO:0034599 |
| AF-A0A1A3ID35-F1-model_v4 | Glutathione peroxidase | 0.9835 | 1 | 162 |
GO:0004601
GO:0034599 |
| AF-A0A429BCQ9-F1-model_v4 | Glutathione peroxidase | 0.9832 | 1 | 161 |
GO:0004601
GO:0034599 |
| AF-A0A4Y9MQB4-F1-model_v4 | Glutathione peroxidase | 0.983 | 1 | 162 |
GO:0004601
GO:0034599 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar