F458633

General Info

Members Datasets Scaffolds Average Seq Length
521 376 1042 255

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1006710|JGI25152J39213_10067102
Length 280
Sequence MIERLCGFDLRDCVLRIELYEPLKDKMDTNATDISAPEIERVRHELRRRRLVAESVTDITPGMRRVVLTGEDLADFVSLAPDDHIKVVVPGANGEEQRRDYTPRRYDNAARSLTIDFALHEAGPVTQWAIDAKPGTVLEIGGPRGSAVISDKVRRWLLVGDETALPAIGRRVEECGKGSVITVLGAVAGPREQQSFETAADLTTRWVHRPLDAATDAAPLIAALSGIDIAPQTLVWVAAEASVVRAIRAYLTEERGYPLAWIKASGYWVKGKADTTEKFG

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
218 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
219 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
220 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
221 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
222 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
223 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
224 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
225 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
226 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
227 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
228 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
229 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
230 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
231 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
232 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
233 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
234 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
235 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
236 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
237 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
238 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
239 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
240 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
241 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
242 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
243 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
244 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
245 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
246 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
247 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
248 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
249 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
250 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
251 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
252 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
253 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
254 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
255 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
256 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
257 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
258 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
259 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
260 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
261 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
262 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
263 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
264 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
265 2643221557 Ensifer sp. Root558 Isolate Unclassified
266 2643221610 Ensifer sp. Root74 Isolate Unclassified
267 2643221618 Ensifer sp. Root231 Isolate Unclassified
268 2643221626 Ensifer sp. Root31 Isolate Unclassified
269 2643221655 Ensifer sp. Root1252 Isolate Unclassified
270 2643221659 Ensifer sp. Root127 Isolate Unclassified
271 2643221668 Ensifer sp. Root423 Isolate Unclassified
272 2643221675 Ensifer sp. Root1298 Isolate Unclassified
273 2643221680 Ensifer sp. Root1312 Isolate Unclassified
274 2643221698 Ensifer sp. Root142 Isolate Unclassified
275 2643221712 Ensifer sp. Root258 Isolate Unclassified
276 2643221723 Ensifer sp. Root278 Isolate Unclassified
277 2643221726 Ensifer sp. Root954 Isolate Unclassified
278 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
279 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
280 2718217927 Rhizobium sp. N324 Isolate Nodule
281 2718218423 Rhizobium sp. N941 Isolate Nodule
282 2721755809 Rhizobium sp. N541 Isolate Nodule
283 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
284 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
285 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
286 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
287 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
288 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
289 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
290 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
291 2791355261 Rhizobium sp. J15 Isolate Nodule
292 2791355263 Rhizobium chutanense C5 Isolate Nodule
293 2791355266 Rhizobium sp. L43 Isolate Nodule
294 2791355267 Rhizobium sp. L18 Isolate Nodule
295 2802429633 Rhizobium anhuiense J3 Isolate Nodule
296 2802429634 Rhizobium anhuiense S10 Isolate Nodule
297 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
298 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
299 2802429637 Rhizobium anhuiense C15 Isolate Nodule
300 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
301 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
302 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
303 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
304 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
305 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
306 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
307 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
308 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
309 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
310 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
311 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
312 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
313 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
314 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
315 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
316 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
317 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
318 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
319 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
320 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
321 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
322 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
323 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
324 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
325 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
326 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
327 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
328 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
329 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
330 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
331 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
332 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
333 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
334 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
335 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
336 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
337 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
338 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
339 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
340 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
341 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
342 2844163670 Ensifer sp. 1H6 Isolate Unclassified
343 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
344 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
345 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
346 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
347 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
348 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
349 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
350 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
351 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
352 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
353 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
354 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
355 2936381700 Rhizobium chutanense C16 Isolate Unclassified
356 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
357 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
358 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
359 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
360 8005275841 Rhizobium sp. N4311 Isolate Nodule
361 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
362 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
363 8005382845 Rhizobium sp. R634 Isolate Nodule
364 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
365 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
366 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
367 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
368 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
369 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
370 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
371 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
372 8018176218 Rhizobium sp. N122 Isolate Nodule
373 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
374 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
375 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
376 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.29
Metatranscriptomes 0.19
Isolates 30.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.83
Nodule 17.66
Rhizoplane 2.88
Rhizosphere 29.75
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006710 3300002773 Bacteria 3075
2 JGI25156J39149_1000007 3300002705 Bacteria 252108
3 JGI25162J39368_1000242 3300002737 Bacteria 54533
4 JGI25162J39368_1000288 3300002737 Bacteria 47072
5 JGI25154J39366_1000013 3300002738 Bacteria 268260
6 JGI25158J39367_1000215 3300002739 Bacteria 13642
7 JGI25158J39367_1002212 3300002739 Bacteria 3237
8 JGI25157J39369_1000099 3300002741 Bacteria 73678
9 JGI25152J39213_1005305 3300002773 Bacteria 3801
10 JGI25152J39213_1005428 3300002773 Bacteria 3718
11 JGI25152J39213_1010131 3300002773 Bacteria 2181
12 JGI25150J39212_1016958 3300002774 Bacteria 1184
13 JGI25159J45721_1000046 3300002987 Bacteria 60119
14 JGI25159J45721_1000173 3300002987 Bacteria 29945
15 JGI25151J46595_10001453 3300003187 Bacteria 16074
16 JGI25151J46595_10004395 3300003187 Bacteria 7469
17 JGI25165J46597_1000068 3300003214 Bacteria 196201
18 JGI25165J46597_1000457 3300003214 Bacteria 41036
19 JGI25153J46596_10005014 3300003215 Bacteria 7017
20 JGI25153J46596_10024400 3300003215 Bacteria 2181
21 JGI25153J46596_10024829 3300003215 Bacteria 2153
22 JGI25153J46596_10043339 3300003215 Bacteria 1364
23 rootL2_10003682 3300003322 Bacteria 13402
24 rootH1_10056436 3300003323 Bacteria 16220
25 JGI25160J50197_1000024 3300003354 Bacteria 189526
26 JGI25161J50226_1000130 3300003374 Bacteria 53291
27 JGI25161J50226_1000580 3300003374 Bacteria 15490
28 JGI25161J50226_1004844 3300003374 Bacteria 2747
29 Ga0055526_1001678 3300003771 Bacteria 15532
30 Ga0055526_1002283 3300003771 Bacteria 13096
31 Ga0055526_1007010 3300003771 Bacteria 5973
32 Ga0055524_1000729 3300003775 Bacteria 22568
33 Ga0055536_1032882 3300003781 Bacteria 1333
34 Ga0055528_1000659 3300003790 Bacteria 25113
35 Ga0055528_1001675 3300003790 Bacteria 12949
36 Ga0055528_1004570 3300003790 Bacteria 6637
37 Ga0055530_10010700 3300003791 Bacteria 3359
38 Ga0055540_1006212 3300003792 Bacteria 4799
39 Ga0055531_10059896 3300003794 Bacteria 937
40 Ga0055543_1000013 3300004625 Bacteria 179052
41 Ga0055543_1000045 3300004625 Bacteria 115098
42 Ga0055543_1000329 3300004625 Bacteria 32613
43 Ga0065165_1000098 3300005262 Bacteria 144210
44 Ga0065165_1006693 3300005262 Bacteria 5933
45 Ga0065165_1014856 3300005262 Bacteria 3001
46 Ga0065165_1052003 3300005262 Bacteria 1159
47 Ga0070668_100001881 3300005347 Bacteria 15343
48 Ga0070669_100000061 3300005353 Bacteria 107718
49 Ga0070671_100001588 3300005355 Bacteria 17088
50 Ga0070667_100000276 3300005367 Bacteria 58397
51 Ga0070665_100000871 3300005548 Bacteria 38979
52 Ga0070665_100018544 3300005548 Bacteria 6973
53 Ga0068854_100637738 3300005578 Bacteria 913
54 Ga0068852_100600265 3300005616 Bacteria 1105
55 Ga0068860_100006289 3300005843 Bacteria 11929
56 Ga0068862_100177078 3300005844 Bacteria 1912
57 Ga0075365_10000344 3300006038 Bacteria 16625
58 Ga0075368_10002321 3300006042 Bacteria 6177
59 Ga0075363_100050740 3300006048 Bacteria 2211
60 Ga0075363_100193753 3300006048 Bacteria 1160
61 Ga0075364_10051096 3300006051 Bacteria 2699
62 Ga0075369_10055682 3300006186 Bacteria 1719
63 Ga0075366_10098842 3300006195 Bacteria 1751
64 Ga0075370_10092305 3300006353 Bacteria 1747
65 Ga0075430_100493704 3300006846 Bacteria 1010
66 Ga0105250_10010435 3300009092 Bacteria 3871
67 Ga0105240_10000012 3300009093 Bacteria 496639
68 Ga0105248_10062295 3300009177 Bacteria 4189
69 Ga0105248_10142357 3300009177 Bacteria 2705
70 Ga0105237_10000054 3300009545 Bacteria 155063
71 Ga0105238_10004282 3300009551 Bacteria 14168
72 Ga0123342_1017765 3300009766 Bacteria 5841
73 Ga0157370_10034657 3300013104 Bacteria 4911
74 Ga0171463_1003 3300013249 Bacteria 695693
75 Ga0163162_10003599 3300013306 Bacteria 14838
76 Ga0182008_10028589 3300014497 Bacteria 2819
77 Ga0182007_10004391 3300015262 Bacteria 6401
78 Ga0183363_1039 3300015690 Bacteria 43099
79 Ga0209435_100006 3300025206 Bacteria 542459
80 Ga0209436_100004 3300025208 Bacteria 196698
81 Ga0209436_100525 3300025208 Bacteria 16662
82 Ga0209563_106294 3300025230 Bacteria 2051
83 Ga0209437_100040 3300025233 Bacteria 448096
84 Ga0209437_100067 3300025233 Bacteria 317685
85 Ga0207425_1000792 3300025245 Bacteria 16135
86 Ga0207425_1014023 3300025245 Bacteria 1831
87 Ga0209646_1000015 3300025246 Bacteria 542459
88 Ga0209026_1000046 3300025250 Bacteria 262031
89 Ga0209677_100285 3300025253 Bacteria 33573
90 Ga0209148_1003844 3300025254 Bacteria 3914
91 Ga0209759_1000005 3300025256 Bacteria 542459
92 Ga0209129_1000279 3300025258 Bacteria 48588
93 Ga0209129_1001337 3300025258 Bacteria 13945
94 Ga0209129_1001740 3300025258 Bacteria 11696
95 Ga0209129_1002433 3300025258 Bacteria 9150
96 Ga0209129_1007840 3300025258 Bacteria 3085
97 Ga0209233_1000051 3300025261 Bacteria 447617
98 Ga0209233_1000088 3300025261 Bacteria 317980
99 Ga0209233_1000201 3300025261 Bacteria 123566
100 Ga0209455_1007584 3300025272 Bacteria 3045
101 Ga0209673_1000015 3300025273 Bacteria 530618
102 Ga0209673_1000325 3300025273 Bacteria 87535
103 Ga0209673_1001202 3300025273 Bacteria 27769
104 Ga0209673_1006235 3300025273 Bacteria 5816
105 Ga0209673_1039203 3300025273 Bacteria 1370
106 Ga0209130_1000001 3300025284 Bacteria 831557
107 Ga0209130_1000026 3300025284 Bacteria 334058
108 Ga0209025_1000216 3300025294 Bacteria 138307
109 Ga0209025_1000483 3300025294 Bacteria 77146
110 Ga0209025_1006739 3300025294 Bacteria 8813
111 Ga0209025_1008253 3300025294 Bacteria 7526
112 Ga0209564_1000013 3300025295 Bacteria 775755
113 Ga0209564_1000703 3300025295 Bacteria 48991
114 Ga0209564_1000785 3300025295 Bacteria 43975
115 Ga0209564_1014711 3300025295 Bacteria 3233
116 Ga0209758_1000544 3300025297 Bacteria 59862
117 Ga0209758_1000599 3300025297 Bacteria 55985
118 Ga0209758_1001288 3300025297 Bacteria 30861
119 Ga0209758_1001861 3300025297 Bacteria 23130
120 Ga0209758_1065823 3300025297 Bacteria 1167
121 Ga0209050_1001727 3300025298 Bacteria 21747
122 Ga0209050_1009116 3300025298 Bacteria 5146
123 Ga0209256_1000042 3300025299 Bacteria 341821
124 Ga0209256_1000245 3300025299 Bacteria 96643
125 Ga0209256_1002111 3300025299 Bacteria 17288
126 Ga0209256_1005704 3300025299 Bacteria 6986
127 Ga0209256_1011540 3300025299 Bacteria 3514
128 Ga0207426_1000006 3300025302 Bacteria 1025969
129 Ga0207426_1000039 3300025302 Bacteria 439937
130 Ga0207426_1000045 3300025302 Bacteria 422847
131 Ga0209051_1000253 3300025303 Bacteria 90622
132 Ga0209051_1002064 3300025303 Bacteria 15232
133 Ga0209051_1006204 3300025303 Bacteria 6778
134 Ga0209051_1008262 3300025303 Bacteria 5538
135 Ga0209051_1018213 3300025303 Bacteria 3113
136 Ga0209051_1048467 3300025303 Bacteria 1440
137 Ga0209257_1002797 3300025304 Bacteria 16431
138 Ga0207696_1008366 3300025711 Bacteria 3968
139 Ga0207695_10000097 3300025913 Bacteria 262517
140 Ga0207671_10000023 3300025914 Bacteria 274756
141 Ga0207681_10000019 3300025923 Bacteria 243902
142 Ga0207694_10039205 3300025924 Bacteria 3645
143 Ga0207644_10003349 3300025931 Bacteria 10339
144 Ga0207709_10356063 3300025935 Bacteria 1106
145 Ga0207712_10032213 3300025961 Bacteria 3537
146 Ga0207668_10000531 3300025972 Bacteria 23835
147 Ga0207640_10617965 3300025981 Bacteria 919
148 Ga0207658_10000262 3300025986 Bacteria 55229
149 Ga0207702_10077502 3300026078 Bacteria 2875
150 Ga0207698_10115416 3300026142 Bacteria 2261
151 Ga0209371_1010778 3300027312 Bacteria 2774
152 Ga0209813_10003971 3300027866 Bacteria 3506
153 Ga0268266_10000675 3300028379 Bacteria 46130
154 Ga0268266_10083824 3300028379 Bacteria 2783
155 Ga0268265_10686762 3300028380 Bacteria 987
156 Ga0268264_10004598 3300028381 Bacteria 11728
157 Ga0307515_10000017 3300028794 Bacteria 550465
158 Ga0307515_10005688 3300028794 Bacteria 25165
159 Ga0307515_10120645 3300028794 Bacteria 2973
160 Ga0268256_1015967 3300030500 Bacteria 2168
161 Ga0307513_10011512 3300031456 Bacteria 10990
162 Ga0307513_10020102 3300031456 Bacteria 7926
163 Ga0307408_100483933 3300031548 Bacteria 1080
164 Ga0307508_10000458 3300031616 Bacteria 49077
165 Ga0307508_10333737 3300031616 Bacteria 1108
166 Ga0307510_10178433 3300033180 Bacteria 1691
167 Ga0395899_0004154 3300037312 Bacteria 11373
168 Ga0451833_0271586 3300041491 Bacteria 2619
169 Ga0451837_0458588 3300041494 Bacteria 3072
170 Ga0451837_0931646 3300041494 Bacteria 2666
171 Ga0451839_0421304 3300041496 Bacteria 3147
172 Ga0451839_1550328 3300041496 Bacteria 2134
173 Ga0451841_0461472 3300041498 Bacteria 893
174 Ga0451841_1084377 3300041498 Bacteria 4129
175 Ga0451847_0035424 3300041503 Bacteria 1611
176 Ga0451849_0745029 3300041505 Bacteria 2213
177 Ga0451850_04704 3300041506 Bacteria 1334
178 Ga0451851_0576517 3300041507 Bacteria 1247
179 Ga0451843_0415976 3300041509 Bacteria 2192
180 Ga0451843_0647237 3300041509 Bacteria 937
181 Ga0451855_0545881 3300041511 Bacteria 3173
182 Ga0451853_0613702 3300041512 Bacteria 2465
183 Ga0466965_0118021 3300044683 Bacteria 1368
184 Ga0466966_0282474 3300044684 Bacteria 998
185 Ga0466970_0301156 3300044765 Bacteria 904
186 Ga0466958_0019330 3300045836 Bacteria 3965
187 Ga0495617_035058 3300046452 Bacteria 1685
188 Ga0495638_0023664 3300046460 Bacteria 4013
189 Ga0495638_0104049 3300046460 Bacteria 1693
190 Ga0495650_0057566 3300046471 Bacteria 1573
191 Ga0495605_0066754 3300046474 Bacteria 1708
192 Ga0495585_0095999 3300046492 Bacteria 1591
193 Ga0495596_0000298 3300046500 Bacteria 32892
194 Ga0495607_0005399 3300046501 Bacteria 9155
195 Ga0495607_0008985 3300046501 Bacteria 6799
196 Ga0495583_0078043 3300046506 Bacteria 1443
197 Ga0495606_0003351 3300046507 Bacteria 17079
198 Ga0495606_0014267 3300046507 Bacteria 6213
199 Ga0495606_0016866 3300046507 Bacteria 5547
200 Ga0495610_0000515 3300046512 Bacteria 38842
201 Ga0495610_0015238 3300046512 Bacteria 4475
202 Ga0495610_0022218 3300046512 Bacteria 3475
203 Ga0495610_0069785 3300046512 Bacteria 1643
204 Ga0495610_0105058 3300046512 Bacteria 1259
205 Ga0495616_0066724 3300046513 Bacteria 1750
206 Ga0495620_0037519 3300046515 Bacteria 2157
207 Ga0495620_0053889 3300046515 Bacteria 1701
208 Ga0495631_0007178 3300046518 Bacteria 5684
209 Ga0495632_0011198 3300046519 Bacteria 5251
210 Ga0495643_0001887 3300046522 Bacteria 17753
211 Ga0495643_0081175 3300046522 Bacteria 1686
212 Ga0495643_0142435 3300046522 Bacteria 1194
213 Ga0495644_0107575 3300046523 Bacteria 1057
214 Ga0495648_0072392 3300046524 Bacteria 1995
215 Ga0495648_0095425 3300046524 Bacteria 1654
216 Ga0495663_0027607 3300046525 Bacteria 1666
217 Ga0495654_0003939 3300046530 Bacteria 8962
218 Ga0495609_0031220 3300046538 Bacteria 2423
219 Ga0495597_0067310 3300046542 Bacteria 1549
220 Ga0495656_0058547 3300046615 Bacteria 1673
221 Ga0495668_0017449 3300046616 Bacteria 4163
222 Ga0495611_0060246 3300046648 Bacteria 1724
223 Ga0495611_0134430 3300046648 Bacteria 1154
224 Ga0495625_0000508 3300046660 Bacteria 57754
225 Ga0495625_0012026 3300046660 Bacteria 7025
226 Ga0495625_0024002 3300046660 Bacteria 4649
227 Ga0495625_0058789 3300046660 Bacteria 2730
228 Ga0495625_0097206 3300046660 Bacteria 2027
229 Ga0495625_0136820 3300046660 Bacteria 1655
230 Ga0495661_0094882 3300046665 Bacteria 1690
231 Ga0495661_0098849 3300046665 Bacteria 1646
232 Ga0495588_0094146 3300046674 Bacteria 1570
233 Ga0495658_0136072 3300046683 Bacteria 1499
234 Ga0495613_0141608 3300046689 Bacteria 1718
235 Ga0495670_0081176 3300046691 Bacteria 1652
236 Ga0495670_0090276 3300046691 Bacteria 1567
237 Ga0495671_0073973 3300046692 Bacteria 1672
238 Ga0495649_0034109 3300046694 Bacteria 2801
239 Ga0495649_0100740 3300046694 Bacteria 1535
240 Ga0495660_0107539 3300046810 Bacteria 1427
241 Ga0495636_0109517 3300047318 Bacteria 1214
242 Ga0495687_004989 3300047443 Bacteria 8677
243 Ga0495687_033371 3300047443 Bacteria 2335
244 Ga0495686_0051961 3300047472 Bacteria 2570
245 Ga0495686_0102091 3300047472 Bacteria 1728
246 Ga0495686_0133346 3300047472 Bacteria 1471
247 Ga0495615_0000780 3300048090 Bacteria 4465
248 Ga0495626_0004433 3300048091 Bacteria 8615
249 Ga0496100_0058521 3300048903 Bacteria 2529
250 Ga0496100_0092035 3300048903 Bacteria 2071
251 Ga0496101_0307980 3300048904 Bacteria 1241
252 Ga0496102_0000634 3300048905 Bacteria 35771
253 Ga0496102_0017579 3300048905 Bacteria 6265
254 Ga0496103_0000269 3300048906 Bacteria 49279
255 Ga0496104_0000682 3300048907 Bacteria 29174
256 Ga0496105_0001681 3300048908 Bacteria 15781
257 Ga0496106_0000243 3300048909 Bacteria 37924
258 Ga0496107_0165231 3300048910 Bacteria 1641
259 Ga0496112_0009604 3300048915 Bacteria 8726
260 Ga0496113_0000349 3300048916 Bacteria 22037
261 Ga0496116_0001938 3300048919 Bacteria 22303
262 Ga0496116_0074057 3300048919 Bacteria 2143
263 Ga0496116_0148968 3300048919 Bacteria 1303
264 Ga0496117_0001496 3300048920 Bacteria 33496
265 Ga0496117_0003601 3300048920 Bacteria 17868
266 Ga0496117_0101330 3300048920 Bacteria 1821
267 Ga0496118_0003498 3300048921 Bacteria 19698
268 Ga0496118_0007972 3300048921 Bacteria 11069
269 Ga0496118_0031249 3300048921 Bacteria 4419
270 Ga0496118_0040909 3300048921 Bacteria 3677
271 Ga0496119_0003117 3300048922 Bacteria 17487
272 Ga0496119_0137310 3300048922 Bacteria 1324
273 Ga0496120_0011370 3300048923 Bacteria 6123
274 Ga0496120_0016911 3300048923 Bacteria 4748
275 Ga0496121_0001592 3300048924 Bacteria 37760
276 Ga0496121_0004630 3300048924 Bacteria 18297
277 Ga0496121_0036627 3300048924 Bacteria 4369
278 Ga0496121_0048409 3300048924 Bacteria 3616
279 Ga0496121_0064253 3300048924 Bacteria 2993
280 Ga0496121_0132862 3300048924 Bacteria 1859
281 Ga0496121_0231515 3300048924 Bacteria 1294
282 Ga0496122_0000559 3300048925 Bacteria 76330
283 Ga0496122_0001342 3300048925 Bacteria 40140
284 Ga0496122_0010148 3300048925 Bacteria 9759
285 Ga0496122_0030848 3300048925 Bacteria 4479
286 Ga0496122_0047623 3300048925 Bacteria 3307
287 Ga0496122_0118050 3300048925 Bacteria 1720
288 Ga0496123_0000435 3300048926 Bacteria 75306
289 Ga0496123_0001709 3300048926 Bacteria 29334
290 Ga0496123_0006910 3300048926 Bacteria 10855
291 Ga0496123_0011062 3300048926 Bacteria 7878
292 Ga0496123_0020762 3300048926 Bacteria 5127
293 Ga0496123_0034004 3300048926 Bacteria 3660
294 Ga0496124_0001918 3300048927 Bacteria 28484
295 Ga0496124_0002579 3300048927 Bacteria 23478
296 Ga0496124_0023606 3300048927 Bacteria 5611
297 Ga0496124_0024543 3300048927 Bacteria 5477
298 Ga0496124_0138443 3300048927 Bacteria 1924
299 Ga0496124_0381947 3300048927 Bacteria 985
300 Ga0496125_0008638 3300048928 Bacteria 10628
301 Ga0496125_0016501 3300048928 Bacteria 7088
302 Ga0496125_0132160 3300048928 Bacteria 1755
303 Ga0496125_0177707 3300048928 Bacteria 1422
304 Ga0496126_0000051 3300048929 Bacteria 313169
305 Ga0496126_0003281 3300048929 Bacteria 20639
306 Ga0496126_0112770 3300048929 Bacteria 2367
307 Ga0495678_051085 3300049459 Bacteria 1599
308 Ga0495682_0040189 3300049460 Bacteria 1715
309 Ga0501032_0300912 3300049569 Bacteria 1037
310 Ga0501033_0000204 3300049570 Bacteria 56743
311 Ga0501034_0178350 3300049571 Unclassified 2090
312 Ga0501038_0255499 3300049574 Bacteria 1387
313 Ga0501046_0348881 3300049580 Bacteria 1075
314 Ga0501046_0564413 3300049580 Bacteria 810
315 Ga0501047_0042622 3300049581 Bacteria 4385
316 Ga0501069_0122184 3300049585 Bacteria 1488
317 Ga0501072_0266048 3300049588 Bacteria 1364
318 Ga0501073_0026352 3300049589 Bacteria 4166
319 Ga0501073_0290612 3300049589 Bacteria 1128
320 Ga0501083_0066732 3300049744 Bacteria 2395
321 Ga0501035_0000181 3300049822 Bacteria 76816
322 Ga0501044_0123007 3300049823 Bacteria 2594
323 nmdc:mga03n38_133872_c1 3300050490 Bacteria 1231
324 nmdc:mga03n38_215705_c1 3300050490 Bacteria 999
325 nmdc:mga00v17_244754_c1 3300050491 Unclassified 1163
326 nmdc:mga0k408_188260_c1 3300050493 Bacteria 1231
327 nmdc:mga06z11_88833_c1 3300050494 Bacteria 1674
328 nmdc:mga04h51_2407_c1 3300050495 Bacteria 4435
329 nmdc:mga0sz30_22118_c1 3300050516 Bacteria 2578
330 nmdc:mga0sz30_34764_c1 3300050516 Bacteria 1008
331 Ga0500578_0108563 3300053086 Bacteria 1750
332 Ga0500578_0142772 3300053086 Bacteria 1496
333 Ga0500641_0014776 3300053096 Bacteria 2885
334 Ga0500569_047996 3300053109 Bacteria 1277
335 Ga0500572_096834 3300053111 Bacteria 940
336 Ga0500595_133913 3300053119 Bacteria 697
337 Ga0500608_009583 3300053122 Bacteria 4120
338 Ga0500608_067671 3300053122 Bacteria 1701
339 Ga0500618_000175 3300053125 Bacteria 53230
340 Ga0500618_000814 3300053125 Bacteria 17169
341 Ga0500618_004297 3300053125 Bacteria 4605
342 Ga0500618_022123 3300053125 Bacteria 1546
343 Ga0500658_0001709 3300053134 Bacteria 8680
344 Ga0500658_0031787 3300053134 Bacteria 2066
345 Ga0500559_0007338 3300053136 Bacteria 4891
346 Ga0500559_0189184 3300053136 Bacteria 970
347 Ga0500564_115769 3300053138 Bacteria 1172
348 Ga0500568_0000571 3300053139 Bacteria 26959
349 Ga0500568_0025076 3300053139 Bacteria 2520
350 Ga0500574_019096 3300053141 Bacteria 1701
351 Ga0500604_0037956 3300053151 Bacteria 1443
352 Ga0500616_0003848 3300053153 Bacteria 11090
353 Ga0500619_042659 3300053154 Bacteria 1439
354 Ga0500622_0000083 3300053156 Bacteria 101289
355 Ga0500622_0000331 3300053156 Bacteria 46916
356 Ga0500624_005381 3300053157 Bacteria 1701
357 Ga0500627_0108159 3300053158 Bacteria 1251
358 Ga0500633_0008837 3300053160 Bacteria 2617
359 Ga0500633_0082372 3300053160 Bacteria 1166
360 Ga0500638_074176 3300053162 Bacteria 1622
361 Ga0500636_0086407 3300053177 Bacteria 1801
362 Ga0500567_122442 3300053723 Bacteria 1035
363 2509392426 2509276021 Bacteria 7634384
364 2510133571 2510065019 Bacteria 6903379
365 2510894956 2510461076 Bacteria 8618824
366 2511128049 2510917021 Bacteria 5705459
367 2511187219 2510917028 Bacteria 6185411
368 2511198672 2510917030 Bacteria 7460662
369 2513573341 2513237084 Bacteria 7231967
370 2513577526 2513237085 Bacteria 7695351
371 2513629825 2513237093 Bacteria 7545552
372 2513708459 2513237103 Bacteria 7647401
373 2513867609 2513237138 Bacteria 7368160
374 2514022080 2513237162 Bacteria 7468464
375 2515112557 2515075009 Bacteria 7288508
376 2515632893 2515154113 Bacteria 7807172
377 2515640037 2515154114 Bacteria 7848616
378 2515655765 2515154116 Bacteria 7552979
379 2515740217 2515154134 Bacteria 7220242
380 2517036281 2516653077 Bacteria 7555578
381 2517076642 2516653085 Bacteria 7346596
382 2517095417 2517093000 Bacteria 7412387
383 2517407014 2517287029 Bacteria 6905599
384 2530645741 2529292951 Bacteria 6916614
385 2535519613 2534681796 Bacteria 7146037
386 2585204845 2582581294 Bacteria 6626667
387 2585221384 2582581298 Bacteria 7315509
388 2585276720 2582581307 Bacteria 6597605
389 2585278215 2582581308 Bacteria 7413247
390 2585324969 2582581315 Bacteria 7318924
391 2585332845 2582581316 Bacteria 7774528
392 2585403412 2582581867 Bacteria 7184437
393 2585527035 2585427526 Bacteria 7258840
394 2585532125 2585427527 Bacteria 7273426
395 2585537792 2585427528 Bacteria 6842387
396 2585544446 2585427529 Bacteria 7395659
397 2585552486 2585427530 Bacteria 7383882
398 2585562694 2585427531 Bacteria 6992870
399 2585823708 2585427590 Bacteria 6824633
400 2585835742 2585427593 Bacteria 7141551
401 2585908749 2585427609 Bacteria 6667127
402 2585994206 2585427633 Bacteria 6413184
403 2585998724 2585427634 Bacteria 6455027
404 2587984166 2585428125 Bacteria 6662905
405 2599334013 2599185156 Bacteria 5403036
406 2600197615 2599185352 Bacteria 7228948
407 2616307733 2615840626 Bacteria 7921970
408 2616552195 2615840698 Bacteria 7319877
409 2617382787 2617270742 Bacteria 6808054
410 2643803284 2643221557 Bacteria 7184309
411 2644063648 2643221610 Bacteria 7480339
412 2644107466 2643221618 Bacteria 7717186
413 2644146063 2643221626 Bacteria 8069654
414 2644308862 2643221655 Bacteria 7722067
415 2644332686 2643221659 Bacteria 7890716
416 2644374928 2643221668 Bacteria 7306521
417 2644414411 2643221675 Bacteria 7473456
418 2644447939 2643221680 Bacteria 7473610
419 2644540088 2643221698 Bacteria 7756764
420 2644614803 2643221712 Bacteria 7729434
421 2644676266 2643221723 Bacteria 7095460
422 2644690412 2643221726 Bacteria 7455827
423 2671114172 2667528174 Bacteria 6435400
424 2671693977 2671180139 Bacteria 4196045
425 2719385982 2718217927 Bacteria 6972593
426 2721399762 2718218423 Bacteria 6438183
427 2724038575 2721755809 Bacteria 6438790
428 2725950519 2724679232 Bacteria 7646494
429 2738849120 2738541301 Bacteria 4834102
430 2738864849 2738541304 Bacteria 4833665
431 2739032449 2738541333 Bacteria 7106503
432 2739297367 2738543022 Bacteria 4835059
433 2739359045 2738543033 Bacteria 4833336
434 2766066881 2765235942 Bacteria 7445910
435 2778178382 2775507266 Bacteria 7392367
436 2793331838 2791355261 Bacteria 6661293
437 2793341728 2791355263 Bacteria 6872478
438 2793360711 2791355266 Bacteria 7116587
439 2793366948 2791355267 Bacteria 7222458
440 2806043425 2802429633 Bacteria 7341974
441 2806050642 2802429634 Bacteria 7083200
442 2806057459 2802429635 Bacteria 7650140
443 2806064840 2802429636 Bacteria 7597525
444 2806072106 2802429637 Bacteria 7067217
445 2808974204 2808606384 Bacteria 8474373
446 2809008990 2808606390 Bacteria 8476311
447 2809016141 2808606391 Bacteria 8308166
448 2819555307 2818991438 Bacteria 5793701
449 2819610108 2818991448 Bacteria 6772224
450 2819640371 2818991453 Bacteria 7181617
451 2834578841 2834578030 Bacteria 3530182
452 2837680060 2837678835 Bacteria 5252418
453 2838032705 2838029111 Bacteria 6603031
454 2838043646 2838042994 Bacteria 6046894
455 2838681972 2838680041 Bacteria 6545511
456 2838692029 2838686498 Bacteria 7807632
457 2838696543 2838694306 Bacteria 6853137
458 2838710217 2838707686 Bacteria 6619912
459 2838732825 2838729681 Bacteria 7400765
460 2838745703 2838742623 Bacteria 7396178
461 2841855839 2841851746 Bacteria 7532261
462 2841864328 2841864319 Bacteria 6742987
463 2842078391 2842077413 Bacteria 6508645
464 2842114150 2842110456 Bacteria 7656360
465 2842119100 2842118031 Bacteria 7033875
466 2842157169 2842156927 Bacteria 6894975
467 2842167830 2842163707 Bacteria 6916235
468 2842181247 2842180545 Bacteria 6888678
469 2842217512 2842217011 Bacteria 7497767
470 2842230702 2842229732 Bacteria 7475766
471 2842239629 2842237096 Bacteria 6620661
472 2842245198 2842243621 Bacteria 7421798
473 2842259011 2842257432 Bacteria 7401195
474 2842276319 2842271015 Bacteria 7807131
475 2842292053 2842291075 Bacteria 7076806
476 2842304538 2842304105 Bacteria 7023636
477 2842345336 2842341865 Bacteria 7003929
478 2842364785 2842363717 Bacteria 6844742
479 2842372538 2842370503 Bacteria 7038661
480 2842378449 2842377471 Bacteria 7140707
481 2842385610 2842384541 Bacteria 7057858
482 2842398897 2842395702 Bacteria 6780583
483 2842479437 2842475841 Bacteria 6603183
484 2842487020 2842482326 Bacteria 7212537
485 2842506404 2842502639 Bacteria 6604161
486 2842925707 2842922631 Bacteria 5824079
487 2844168203 2844163670 Bacteria 7266046
488 2844458916 2844454524 Bacteria 7952546
489 2857519959 2857516855 Bacteria 7787325
490 2891050122 2891048133 Bacteria 4447501
491 2919108166 2919100787 Bacteria 7710546
492 2919412504 2919408235 Bacteria 6149349
493 2923558949 2923556063 Bacteria 6793593
494 2933571811 2933570622 Bacteria 7023390
495 2933590246 2933586486 Bacteria 7667493
496 2935897601 2935894831 Bacteria 6620579
497 2935905440 2935901341 Bacteria 7341747
498 2936372455 2936367885 Bacteria 7324495
499 2936376555 2936375103 Bacteria 6652732
500 2936388418 2936381700 Bacteria 7006523
501 2937845814 2937843397 Bacteria 5256375
502 2941502317 2941499720 Bacteria 7599444
503 3005412214 3005409236 Bacteria 7188837
504 639648794 639633055 Bacteria 7751309
505 8005280766 8005275841 Bacteria 6929066
506 8005312410 8005307578 Bacteria 7395396
507 8005379468 8005376324 Bacteria 6590079
508 8005385448 8005382845 Bacteria 6732062
509 8005463230 8005460587 Bacteria 7157962
510 8005547312 8005542996 Bacteria 7077758
511 8005557446 8005556819 Bacteria 6908598
512 8005568625 8005563573 Bacteria 7153261
513 8005647880 8005645114 Bacteria 6950293
514 8005684269 8005682033 Bacteria 6726518
515 8005699791 8005695170 Bacteria 6912330
516 8018166536 8018163183 Bacteria 7277977
517 8018178730 8018176218 Bacteria 6896178
518 8023685138 8023680758 Bacteria 7729763
519 8024483284 8024479707 Bacteria 6954785
520 8056376834 8056375014 Bacteria 7006639
521 8057874787 8057874678 Bacteria 7494653
522 JGI25152J39213_1006710
523 JGI25156J39149_1000007
524 JGI25162J39368_1000242
525 JGI25162J39368_1000288
526 JGI25154J39366_1000013
527 JGI25158J39367_1000215
528 JGI25158J39367_1002212
529 JGI25157J39369_1000099
530 JGI25152J39213_1005305
531 JGI25152J39213_1005428
532 JGI25152J39213_1010131
533 JGI25150J39212_1016958
534 JGI25159J45721_1000046
535 JGI25159J45721_1000173
536 JGI25151J46595_10001453
537 JGI25151J46595_10004395
538 JGI25165J46597_1000068
539 JGI25165J46597_1000457
540 JGI25153J46596_10005014
541 JGI25153J46596_10024400
542 JGI25153J46596_10024829
543 JGI25153J46596_10043339
544 rootL2_10003682
545 rootH1_10056436
546 JGI25160J50197_1000024
547 JGI25161J50226_1000130
548 JGI25161J50226_1000580
549 JGI25161J50226_1004844
550 Ga0055526_1001678
551 Ga0055526_1002283
552 Ga0055526_1007010
553 Ga0055524_1000729
554 Ga0055536_1032882
555 Ga0055528_1000659
556 Ga0055528_1001675
557 Ga0055528_1004570
558 Ga0055530_10010700
559 Ga0055540_1006212
560 Ga0055531_10059896
561 Ga0055543_1000013
562 Ga0055543_1000045
563 Ga0055543_1000329
564 Ga0065165_1000098
565 Ga0065165_1006693
566 Ga0065165_1014856
567 Ga0065165_1052003
568 Ga0070668_100001881
569 Ga0070669_100000061
570 Ga0070671_100001588
571 Ga0070667_100000276
572 Ga0070665_100000871
573 Ga0070665_100018544
574 Ga0068854_100637738
575 Ga0068852_100600265
576 Ga0068860_100006289
577 Ga0068862_100177078
578 Ga0075365_10000344
579 Ga0075368_10002321
580 Ga0075363_100050740
581 Ga0075363_100193753
582 Ga0075364_10051096
583 Ga0075369_10055682
584 Ga0075366_10098842
585 Ga0075370_10092305
586 Ga0075430_100493704
587 Ga0105250_10010435
588 Ga0105240_10000012
589 Ga0105248_10062295
590 Ga0105248_10142357
591 Ga0105237_10000054
592 Ga0105238_10004282
593 Ga0123342_1017765
594 Ga0157370_10034657
595 Ga0171463_1003
596 Ga0163162_10003599
597 Ga0182008_10028589
598 Ga0182007_10004391
599 Ga0183363_1039
600 Ga0209435_100006
601 Ga0209436_100004
602 Ga0209436_100525
603 Ga0209563_106294
604 Ga0209437_100040
605 Ga0209437_100067
606 Ga0207425_1000792
607 Ga0207425_1014023
608 Ga0209646_1000015
609 Ga0209026_1000046
610 Ga0209677_100285
611 Ga0209148_1003844
612 Ga0209759_1000005
613 Ga0209129_1000279
614 Ga0209129_1001337
615 Ga0209129_1001740
616 Ga0209129_1002433
617 Ga0209129_1007840
618 Ga0209233_1000051
619 Ga0209233_1000088
620 Ga0209233_1000201
621 Ga0209455_1007584
622 Ga0209673_1000015
623 Ga0209673_1000325
624 Ga0209673_1001202
625 Ga0209673_1006235
626 Ga0209673_1039203
627 Ga0209130_1000001
628 Ga0209130_1000026
629 Ga0209025_1000216
630 Ga0209025_1000483
631 Ga0209025_1006739
632 Ga0209025_1008253
633 Ga0209564_1000013
634 Ga0209564_1000703
635 Ga0209564_1000785
636 Ga0209564_1014711
637 Ga0209758_1000544
638 Ga0209758_1000599
639 Ga0209758_1001288
640 Ga0209758_1001861
641 Ga0209758_1065823
642 Ga0209050_1001727
643 Ga0209050_1009116
644 Ga0209256_1000042
645 Ga0209256_1000245
646 Ga0209256_1002111
647 Ga0209256_1005704
648 Ga0209256_1011540
649 Ga0207426_1000006
650 Ga0207426_1000039
651 Ga0207426_1000045
652 Ga0209051_1000253
653 Ga0209051_1002064
654 Ga0209051_1006204
655 Ga0209051_1008262
656 Ga0209051_1018213
657 Ga0209051_1048467
658 Ga0209257_1002797
659 Ga0207696_1008366
660 Ga0207695_10000097
661 Ga0207671_10000023
662 Ga0207681_10000019
663 Ga0207694_10039205
664 Ga0207644_10003349
665 Ga0207709_10356063
666 Ga0207712_10032213
667 Ga0207668_10000531
668 Ga0207640_10617965
669 Ga0207658_10000262
670 Ga0207702_10077502
671 Ga0207698_10115416
672 Ga0209371_1010778
673 Ga0209813_10003971
674 Ga0268266_10000675
675 Ga0268266_10083824
676 Ga0268265_10686762
677 Ga0268264_10004598
678 Ga0307515_10000017
679 Ga0307515_10005688
680 Ga0307515_10120645
681 Ga0268256_1015967
682 Ga0307513_10011512
683 Ga0307513_10020102
684 Ga0307408_100483933
685 Ga0307508_10000458
686 Ga0307508_10333737
687 Ga0307510_10178433
688 Ga0395899_0004154
689 Ga0451833_0271586
690 Ga0451837_0458588
691 Ga0451837_0931646
692 Ga0451839_0421304
693 Ga0451839_1550328
694 Ga0451841_0461472
695 Ga0451841_1084377
696 Ga0451847_0035424
697 Ga0451849_0745029
698 Ga0451850_04704
699 Ga0451851_0576517
700 Ga0451843_0415976
701 Ga0451843_0647237
702 Ga0451855_0545881
703 Ga0451853_0613702
704 Ga0466965_0118021
705 Ga0466966_0282474
706 Ga0466970_0301156
707 Ga0466958_0019330
708 Ga0495617_035058
709 Ga0495638_0023664
710 Ga0495638_0104049
711 Ga0495650_0057566
712 Ga0495605_0066754
713 Ga0495585_0095999
714 Ga0495596_0000298
715 Ga0495607_0005399
716 Ga0495607_0008985
717 Ga0495583_0078043
718 Ga0495606_0003351
719 Ga0495606_0014267
720 Ga0495606_0016866
721 Ga0495610_0000515
722 Ga0495610_0015238
723 Ga0495610_0022218
724 Ga0495610_0069785
725 Ga0495610_0105058
726 Ga0495616_0066724
727 Ga0495620_0037519
728 Ga0495620_0053889
729 Ga0495631_0007178
730 Ga0495632_0011198
731 Ga0495643_0001887
732 Ga0495643_0081175
733 Ga0495643_0142435
734 Ga0495644_0107575
735 Ga0495648_0072392
736 Ga0495648_0095425
737 Ga0495663_0027607
738 Ga0495654_0003939
739 Ga0495609_0031220
740 Ga0495597_0067310
741 Ga0495656_0058547
742 Ga0495668_0017449
743 Ga0495611_0060246
744 Ga0495611_0134430
745 Ga0495625_0000508
746 Ga0495625_0012026
747 Ga0495625_0024002
748 Ga0495625_0058789
749 Ga0495625_0097206
750 Ga0495625_0136820
751 Ga0495661_0094882
752 Ga0495661_0098849
753 Ga0495588_0094146
754 Ga0495658_0136072
755 Ga0495613_0141608
756 Ga0495670_0081176
757 Ga0495670_0090276
758 Ga0495671_0073973
759 Ga0495649_0034109
760 Ga0495649_0100740
761 Ga0495660_0107539
762 Ga0495636_0109517
763 Ga0495687_004989
764 Ga0495687_033371
765 Ga0495686_0051961
766 Ga0495686_0102091
767 Ga0495686_0133346
768 Ga0495615_0000780
769 Ga0495626_0004433
770 Ga0496100_0058521
771 Ga0496100_0092035
772 Ga0496101_0307980
773 Ga0496102_0000634
774 Ga0496102_0017579
775 Ga0496103_0000269
776 Ga0496104_0000682
777 Ga0496105_0001681
778 Ga0496106_0000243
779 Ga0496107_0165231
780 Ga0496112_0009604
781 Ga0496113_0000349
782 Ga0496116_0001938
783 Ga0496116_0074057
784 Ga0496116_0148968
785 Ga0496117_0001496
786 Ga0496117_0003601
787 Ga0496117_0101330
788 Ga0496118_0003498
789 Ga0496118_0007972
790 Ga0496118_0031249
791 Ga0496118_0040909
792 Ga0496119_0003117
793 Ga0496119_0137310
794 Ga0496120_0011370
795 Ga0496120_0016911
796 Ga0496121_0001592
797 Ga0496121_0004630
798 Ga0496121_0036627
799 Ga0496121_0048409
800 Ga0496121_0064253
801 Ga0496121_0132862
802 Ga0496121_0231515
803 Ga0496122_0000559
804 Ga0496122_0001342
805 Ga0496122_0010148
806 Ga0496122_0030848
807 Ga0496122_0047623
808 Ga0496122_0118050
809 Ga0496123_0000435
810 Ga0496123_0001709
811 Ga0496123_0006910
812 Ga0496123_0011062
813 Ga0496123_0020762
814 Ga0496123_0034004
815 Ga0496124_0001918
816 Ga0496124_0002579
817 Ga0496124_0023606
818 Ga0496124_0024543
819 Ga0496124_0138443
820 Ga0496124_0381947
821 Ga0496125_0008638
822 Ga0496125_0016501
823 Ga0496125_0132160
824 Ga0496125_0177707
825 Ga0496126_0000051
826 Ga0496126_0003281
827 Ga0496126_0112770
828 Ga0495678_051085
829 Ga0495682_0040189
830 Ga0501032_0300912
831 Ga0501033_0000204
832 Ga0501034_0178350
833 Ga0501038_0255499
834 Ga0501046_0348881
835 Ga0501046_0564413
836 Ga0501047_0042622
837 Ga0501069_0122184
838 Ga0501072_0266048
839 Ga0501073_0026352
840 Ga0501073_0290612
841 Ga0501083_0066732
842 Ga0501035_0000181
843 Ga0501044_0123007
844 nmdc:mga03n38_133872_c1
845 nmdc:mga03n38_215705_c1
846 nmdc:mga00v17_244754_c1
847 nmdc:mga0k408_188260_c1
848 nmdc:mga06z11_88833_c1
849 nmdc:mga04h51_2407_c1
850 nmdc:mga0sz30_22118_c1
851 nmdc:mga0sz30_34764_c1
852 Ga0500578_0108563
853 Ga0500578_0142772
854 Ga0500641_0014776
855 Ga0500569_047996
856 Ga0500572_096834
857 Ga0500595_133913
858 Ga0500608_009583
859 Ga0500608_067671
860 Ga0500618_000175
861 Ga0500618_000814
862 Ga0500618_004297
863 Ga0500618_022123
864 Ga0500658_0001709
865 Ga0500658_0031787
866 Ga0500559_0007338
867 Ga0500559_0189184
868 Ga0500564_115769
869 Ga0500568_0000571
870 Ga0500568_0025076
871 Ga0500574_019096
872 Ga0500604_0037956
873 Ga0500616_0003848
874 Ga0500619_042659
875 Ga0500622_0000083
876 Ga0500622_0000331
877 Ga0500624_005381
878 Ga0500627_0108159
879 Ga0500633_0008837
880 Ga0500633_0082372
881 Ga0500638_074176
882 Ga0500636_0086407
883 Ga0500567_122442
884 2509392426
885 2510133571
886 2510894956
887 2511128049
888 2511187219
889 2511198672
890 2513573341
891 2513577526
892 2513629825
893 2513708459
894 2513867609
895 2514022080
896 2515112557
897 2515632893
898 2515640037
899 2515655765
900 2515740217
901 2517036281
902 2517076642
903 2517095417
904 2517407014
905 2530645741
906 2535519613
907 2585204845
908 2585221384
909 2585276720
910 2585278215
911 2585324969
912 2585332845
913 2585403412
914 2585527035
915 2585532125
916 2585537792
917 2585544446
918 2585552486
919 2585562694
920 2585823708
921 2585835742
922 2585908749
923 2585994206
924 2585998724
925 2587984166
926 2599334013
927 2600197615
928 2616307733
929 2616552195
930 2617382787
931 2643803284
932 2644063648
933 2644107466
934 2644146063
935 2644308862
936 2644332686
937 2644374928
938 2644414411
939 2644447939
940 2644540088
941 2644614803
942 2644676266
943 2644690412
944 2671114172
945 2671693977
946 2719385982
947 2721399762
948 2724038575
949 2725950519
950 2738849120
951 2738864849
952 2739032449
953 2739297367
954 2739359045
955 2766066881
956 2778178382
957 2793331838
958 2793341728
959 2793360711
960 2793366948
961 2806043425
962 2806050642
963 2806057459
964 2806064840
965 2806072106
966 2808974204
967 2809008990
968 2809016141
969 2819555307
970 2819610108
971 2819640371
972 2834578841
973 2837680060
974 2838032705
975 2838043646
976 2838681972
977 2838692029
978 2838696543
979 2838710217
980 2838732825
981 2838745703
982 2841855839
983 2841864328
984 2842078391
985 2842114150
986 2842119100
987 2842157169
988 2842167830
989 2842181247
990 2842217512
991 2842230702
992 2842239629
993 2842245198
994 2842259011
995 2842276319
996 2842292053
997 2842304538
998 2842345336
999 2842364785
1000 2842372538
1001 2842378449
1002 2842385610
1003 2842398897
1004 2842479437
1005 2842487020
1006 2842506404
1007 2842925707
1008 2844168203
1009 2844458916
1010 2857519959
1011 2891050122
1012 2919108166
1013 2919412504
1014 2923558949
1015 2933571811
1016 2933590246
1017 2935897601
1018 2935905440
1019 2936372455
1020 2936376555
1021 2936388418
1022 2937845814
1023 2941502317
1024 3005412214
1025 639648794
1026 8005280766
1027 8005312410
1028 8005379468
1029 8005385448
1030 8005463230
1031 8005547312
1032 8005557446
1033 8005568625
1034 8005647880
1035 8005684269
1036 8005699791
1037 8018166536
1038 8018178730
1039 8023685138
1040 8024483284
1041 8056376834
1042 8057874787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04954

SIP

Siderophore-interacting protein

153

271

0.97

PF08021

FAD_binding_9

Siderophore-interacting FAD-binding domain

93

147

0.95

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

50

149

0.91

PF08021

FAD_binding_9

Siderophore-interacting FAD-binding domain

52

98

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yhb-assembly1.cif.gz_A crystal structure of a siderophore utilization protein from t. fusca 0.8989 14 252
2gpj-assembly1.cif.gz_A crystal structure of a siderophore-interacting protein (sputcn32_0076) from shewanella putrefaciens cn-32 at 2.20 a resolution 0.8956 25 251
7xlz-assembly2.cif.gz_B structure of siderophore-interacting protein from vibrio anguillarum 0.861 24 251
6k2l-assembly1.cif.gz_A crystal structure of the siderophore-interacting protein sips from aeromonas hydrophila 0.8513 24 251
7xlz-assembly1.cif.gz_A structure of siderophore-interacting protein from vibrio anguillarum 0.846 24 251
ID Description Score Start End Superfamily
6gehA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9231 24 120 2.40.30.10
af_Q46871_5_133_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9216 17 123 2.40.30.10
af_P9WQJ9_14_115_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9205 22 118 2.40.30.10
2gpjA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8918 129 251 3.40.50.80
4yhbA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8852 15 122 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A327MGA6-F1-model_v4 Siderophore-interacting protein 0.982 15 257 GO:0016491
AF-A0A838C4I3-F1-model_v4 deleted 0.9796 9 257
AF-A0A4P6H8P6-F1-model_v4 NADPH-dependent ferric siderophore reductase 0.9746 1 257 GO:0016491
AF-A0A6L6JEQ9-F1-model_v4 Siderophore-interacting protein 0.9736 16 257 GO:0016491
AF-A0A1B6VLI4-F1-model_v4 Siderophore-interacting iron utilization protein 0.9735 1 248 GO:0016491

Map