F458670

General Info

Members Datasets Scaffolds Average Seq Length
521 239 521 370

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100005780|Ga0070704_1000057804
Length 376
Sequence VPILDEITEAVLSREEIARYLEGSHGESGRAARAKIKGYLEELRTTQRYSLYRSLKHPLYPILRKIERIPEHIEAARTATRGAGRVIYASNHKSHTDYLVELLVLDEHGVRPPIIAAGINLFGGPLGLLHRHVTGAIPIRRNTKDPAYLMTLKAYVAELLRKHDLFFYPEGGRSYSGEIKTPKTGLMHAALQAEHPHLVVLPTAVAYDLVLEDHVLSRQRVKRIQRPFSRELAEMVRYAVGYRSRAFVTFGKPMAVEIDAASRKDVLDFTHTVMDAIGRLYKVLPTAVVANAMRPSITLSDLEARADAVIDTLRANRANLGVQSGAEAVAAAIEPLETRGIVVMDRGRVRVRDRNVLRYYGRTLDHLLASPSRRTH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 2.5
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006003 3300003203 Bacteria 5616
2 JGI25406J46586_10006091 3300003203 Bacteria 5572
3 Ga0065715_10092297 3300005293 Bacteria 5202
4 Ga0065715_10102934 3300005293 Bacteria 3074
5 Ga0065707_10000760 3300005295 Bacteria 16028
6 Ga0070676_10076679 3300005328 Bacteria 2019
7 Ga0070690_100036898 3300005330 Bacteria 3076
8 Ga0070670_100000629 3300005331 Bacteria 27591
9 Ga0070670_100006802 3300005331 Bacteria 9681
10 Ga0070670_100026727 3300005331 Bacteria 4965
11 Ga0070680_100259078 3300005336 Unclassified 1471
12 Ga0070680_100264326 3300005336 Unclassified 1456
13 Ga0070660_100104354 3300005339 Bacteria 2249
14 Ga0070689_100034472 3300005340 Bacteria 3862
15 Ga0070691_10003313 3300005341 Bacteria 7224
16 Ga0070687_100021508 3300005343 Unclassified 3034
17 Ga0070687_100035239 3300005343 Bacteria 2483
18 Ga0070687_100046199 3300005343 Bacteria 2228
19 Ga0070687_100105059 3300005343 Bacteria 1589
20 Ga0070661_100035511 3300005344 Bacteria 3620
21 Ga0070692_10007070 3300005345 Bacteria 4923
22 Ga0070692_10057962 3300005345 Unclassified 2033
23 Ga0070692_10062392 3300005345 Bacteria 1967
24 Ga0070668_100048981 3300005347 Bacteria 3250
25 Ga0070668_100181019 3300005347 Bacteria 1722
26 Ga0070669_100001105 3300005353 Bacteria 19696
27 Ga0070669_100017293 3300005353 Bacteria 5143
28 Ga0070669_100136203 3300005353 Bacteria 1889
29 Ga0070669_100189523 3300005353 Bacteria 1613
30 Ga0070669_100215203 3300005353 Bacteria 1517
31 Ga0070675_100022490 3300005354 Bacteria 5038
32 Ga0070675_100243797 3300005354 Bacteria 1571
33 Ga0070671_100005817 3300005355 Bacteria 9821
34 Ga0070674_100003553 3300005356 Bacteria 8756
35 Ga0070673_100001036 3300005364 Bacteria 15753
36 Ga0070673_100015170 3300005364 Bacteria 5401
37 Ga0070673_100059771 3300005364 Bacteria 3018
38 Ga0070673_100347950 3300005364 Bacteria 1315
39 Ga0070688_100003624 3300005365 Bacteria 7969
40 Ga0070688_100026455 3300005365 Bacteria 3447
41 Ga0070659_100053220 3300005366 Bacteria 3186
42 Ga0070667_100271116 3300005367 Unclassified 1522
43 Ga0070709_10019296 3300005434 Bacteria 3939
44 Ga0070713_100060163 3300005436 Unclassified 3175
45 Ga0070701_10008427 3300005438 Bacteria 4460
46 Ga0070705_100003619 3300005440 Bacteria 7566
47 Ga0070705_100004620 3300005440 Bacteria 6702
48 Ga0070705_100020626 3300005440 Bacteria 3492
49 Ga0070700_100011176 3300005441 Bacteria 4969
50 Ga0070700_100020621 3300005441 Bacteria 3821
51 Ga0070700_100076033 3300005441 Bacteria 2155
52 Ga0070694_100000279 3300005444 Bacteria 27271
53 Ga0070694_100011197 3300005444 Bacteria 5554
54 Ga0070694_100016697 3300005444 Bacteria 4623
55 Ga0070708_100144829 3300005445 Bacteria 2206
56 Ga0070662_100005750 3300005457 Bacteria 7947
57 Ga0070662_100068804 3300005457 Bacteria 2604
58 Ga0070681_10005726 3300005458 Bacteria 12012
59 Ga0070681_10091003 3300005458 Bacteria 3001
60 Ga0070681_10146189 3300005458 Unclassified 2293
61 Ga0068867_100000222 3300005459 Bacteria 37537
62 Ga0068867_100005323 3300005459 Bacteria 9094
63 Ga0068867_100042914 3300005459 Bacteria 3310
64 Ga0068867_100104536 3300005459 Bacteria 2167
65 Ga0070706_100339893 3300005467 Bacteria 1400
66 Ga0070707_100067085 3300005468 Bacteria 3450
67 Ga0070698_100009874 3300005471 Bacteria 10205
68 Ga0070698_100014852 3300005471 Bacteria 8232
69 Ga0070698_100029690 3300005471 Bacteria 5676
70 Ga0070698_100128478 3300005471 Bacteria 2490
71 Ga0070699_100001245 3300005518 Bacteria 23460
72 Ga0070699_100005432 3300005518 Bacteria 11175
73 Ga0070679_100075248 3300005530 Bacteria 3366
74 Ga0070684_100277926 3300005535 Bacteria 1534
75 Ga0070697_100032297 3300005536 Bacteria 4212
76 Ga0070697_100147902 3300005536 Bacteria 1979
77 Ga0070672_100025815 3300005543 Bacteria 4364
78 Ga0070672_100125870 3300005543 Bacteria 2102
79 Ga0070695_100000255 3300005545 Bacteria 26665
80 Ga0070695_100006166 3300005545 Bacteria 7085
81 Ga0070695_100022215 3300005545 Bacteria 3890
82 Ga0070696_100008853 3300005546 Bacteria 6731
83 Ga0070696_100049342 3300005546 Bacteria 2924
84 Ga0070665_100025666 3300005548 Bacteria 5936
85 Ga0070704_100000485 3300005549 Bacteria 18882
86 Ga0070704_100003547 3300005549 Bacteria 8967
87 Ga0070704_100005780 3300005549 Bacteria 7236
88 Ga0070704_100055628 3300005549 Bacteria 2806
89 Ga0070704_100061224 3300005549 Bacteria 2693
90 Ga0068855_100068338 3300005563 Bacteria 4136
91 Ga0068855_100168629 3300005563 Unclassified 2480
92 Ga0070664_100022865 3300005564 Bacteria 5157
93 Ga0070664_100042433 3300005564 Bacteria 3840
94 Ga0068857_100033987 3300005577 Bacteria 4511
95 Ga0068854_100029433 3300005578 Bacteria 3802
96 Ga0068854_100066039 3300005578 Bacteria 2632
97 Ga0068854_100202154 3300005578 Unclassified 1562
98 Ga0068856_100024826 3300005614 Bacteria 5839
99 Ga0070702_100007736 3300005615 Bacteria 5161
100 Ga0070702_100167265 3300005615 Bacteria 1427
101 Ga0068852_100056782 3300005616 Bacteria 3385
102 Ga0068859_100004506 3300005617 Bacteria 14214
103 Ga0068859_100005710 3300005617 Bacteria 12657
104 Ga0068859_100013075 3300005617 Bacteria 8341
105 Ga0068859_100098248 3300005617 Bacteria 2982
106 Ga0068859_100360868 3300005617 Bacteria 1548
107 Ga0068859_100449444 3300005617 Bacteria 1385
108 Ga0068864_100005495 3300005618 Bacteria 10383
109 Ga0068864_100007279 3300005618 Bacteria 9101
110 Ga0068864_100029016 3300005618 Bacteria 4680
111 Ga0068864_100115546 3300005618 Unclassified 2394
112 Ga0068864_100158180 3300005618 Bacteria 2058
113 Ga0068861_100014182 3300005719 Bacteria 5589
114 Ga0068870_10001502 3300005840 Bacteria 9457
115 Ga0068863_100007042 3300005841 Bacteria 11020
116 Ga0068863_100047346 3300005841 Bacteria 4078
117 Ga0068858_100002099 3300005842 Bacteria 20232
118 Ga0068858_100048871 3300005842 Bacteria 3918
119 Ga0068858_100058067 3300005842 Bacteria 3577
120 Ga0068858_100092750 3300005842 Bacteria 2811
121 Ga0068862_100000612 3300005844 Bacteria 37096
122 Ga0081455_10078000 3300005937 Bacteria 2723
123 Ga0081538_10033129 3300005981 Bacteria 3445
124 Ga0081539_10000012 3300005985 Bacteria 440369
125 Ga0081539_10000291 3300005985 Bacteria 113769
126 Ga0081539_10003521 3300005985 Bacteria 19070
127 Ga0097621_100008050 3300006237 Bacteria 7567
128 Ga0068871_100039150 3300006358 Bacteria 3792
129 Ga0068871_100337938 3300006358 Bacteria 1329
130 Ga0068871_100374825 3300006358 Bacteria 1263
131 Ga0075428_100000060 3300006844 Bacteria 88550
132 Ga0075428_100000862 3300006844 Bacteria 31924
133 Ga0075428_100001853 3300006844 Bacteria 22653
134 Ga0075428_100011882 3300006844 Bacteria 9682
135 Ga0075430_100001840 3300006846 Bacteria 17361
136 Ga0075430_100128389 3300006846 Bacteria 2113
137 Ga0075431_100091365 3300006847 Unclassified 3142
138 Ga0075433_10011585 3300006852 Bacteria 7102
139 Ga0075433_10026751 3300006852 Bacteria 4888
140 Ga0075434_100004387 3300006871 Bacteria 12709
141 Ga0075434_100012231 3300006871 Bacteria 8132
142 Ga0075434_100016714 3300006871 Bacteria 7058
143 Ga0075434_100035383 3300006871 Bacteria 4937
144 Ga0075429_100007529 3300006880 Bacteria 9452
145 Ga0075429_100018798 3300006880 Bacteria 5985
146 Ga0075429_100093575 3300006880 Bacteria 2621
147 Ga0075429_100319988 3300006880 Bacteria 1358
148 Ga0068865_100013010 3300006881 Bacteria 5247
149 Ga0075436_100007726 3300006914 Bacteria 7349
150 Ga0097620_100004506 3300006931 Bacteria 14214
151 Ga0097620_100005711 3300006931 Bacteria 12657
152 Ga0097620_100013075 3300006931 Bacteria 8341
153 Ga0097620_100098248 3300006931 Bacteria 2982
154 Ga0097620_100360807 3300006931 Bacteria 1548
155 Ga0097620_100449455 3300006931 Bacteria 1385
156 Ga0075435_100000663 3300007076 Bacteria 21212
157 Ga0075435_100006600 3300007076 Bacteria 8214
158 Ga0075435_100014795 3300007076 Bacteria 5848
159 Ga0075435_100053739 3300007076 Bacteria 3249
160 Ga0075435_100105976 3300007076 Bacteria 2334
161 Ga0099794_10119597 3300007265 Bacteria 1324
162 Ga0111539_10000002 3300009094 Bacteria 983359
163 Ga0111539_10001647 3300009094 Bacteria 29819
164 Ga0111539_10003630 3300009094 Bacteria 20329
165 Ga0111539_10007980 3300009094 Bacteria 13502
166 Ga0111539_10074073 3300009094 Bacteria 4012
167 Ga0111539_10133649 3300009094 Bacteria 2905
168 Ga0111539_10361204 3300009094 Bacteria 1690
169 Ga0105245_10034722 3300009098 Bacteria 4473
170 Ga0105245_10223930 3300009098 Bacteria 1816
171 Ga0105247_10002871 3300009101 Bacteria 11489
172 Ga0105247_10012165 3300009101 Bacteria 5173
173 Ga0114129_10001294 3300009147 Bacteria 33348
174 Ga0114129_10006090 3300009147 Bacteria 17102
175 Ga0114129_10009873 3300009147 Bacteria 13608
176 Ga0114129_10014134 3300009147 Bacteria 11372
177 Ga0114129_10017722 3300009147 Bacteria 10141
178 Ga0114129_10030544 3300009147 Bacteria 7624
179 Ga0114129_10042517 3300009147 Bacteria 6399
180 Ga0114129_10086702 3300009147 Bacteria 4342
181 Ga0114129_10086916 3300009147 Bacteria 4336
182 Ga0114129_10189438 3300009147 Bacteria 2794
183 Ga0114129_10274502 3300009147 Unclassified 2254
184 Ga0114129_10560124 3300009147 Bacteria 1485
185 Ga0105243_10020299 3300009148 Bacteria 5038
186 Ga0105243_10039267 3300009148 Bacteria 3689
187 Ga0105243_10162217 3300009148 Bacteria 1928
188 Ga0105243_10191411 3300009148 Bacteria 1787
189 Ga0105242_10009175 3300009176 Bacteria 7594
190 Ga0105242_10013615 3300009176 Bacteria 6295
191 Ga0105248_10009460 3300009177 Bacteria 10725
192 Ga0105248_10020526 3300009177 Bacteria 7322
193 Ga0105248_10129297 3300009177 Bacteria 2849
194 Ga0105249_10019962 3300009553 Bacteria 5984
195 Ga0105249_10251719 3300009553 Unclassified 1751
196 Ga0105249_10352524 3300009553 Bacteria 1491
197 Ga0157374_10031300 3300013296 Bacteria 4834
198 Ga0157374_10083827 3300013296 Bacteria 3029
199 Ga0157378_10071772 3300013297 Bacteria 3110
200 Ga0157378_10085368 3300013297 Bacteria 2859
201 Ga0157378_10217961 3300013297 Bacteria 1813
202 Ga0157375_10067611 3300013308 Bacteria 3571
203 Ga0163163_10017165 3300014325 Bacteria 6744
204 Ga0163163_10031366 3300014325 Bacteria 5128
205 Ga0163163_10049496 3300014325 Bacteria 4137
206 Ga0163163_10066895 3300014325 Bacteria 3571
207 Ga0163163_10440878 3300014325 Bacteria 1362
208 Ga0157380_10011586 3300014326 Bacteria 6374
209 Ga0157380_10012703 3300014326 Bacteria 6115
210 Ga0157380_10030470 3300014326 Bacteria 4132
211 Ga0157380_10054559 3300014326 Bacteria 3172
212 Ga0157380_10082645 3300014326 Bacteria 2629
213 Ga0157380_10147977 3300014326 Bacteria 2026
214 Ga0157380_10357293 3300014326 Bacteria 1369
215 Ga0157377_10031057 3300014745 Bacteria 2900
216 Ga0157379_10013873 3300014968 Bacteria 7064
217 Ga0157379_10082940 3300014968 Unclassified 2873
218 Ga0157379_10168243 3300014968 Bacteria 1979
219 Ga0157376_10010717 3300014969 Bacteria 6721
220 Ga0157376_10144492 3300014969 Bacteria 2138
221 Ga0157376_10146625 3300014969 Unclassified 2124
222 Ga0163161_10188914 3300017792 Bacteria 1583
223 Ga0207653_10019417 3300025885 Unclassified 2143
224 Ga0207710_10078287 3300025900 Unclassified 1529
225 Ga0207680_10056590 3300025903 Bacteria 2369
226 Ga0207680_10099441 3300025903 Bacteria 1866
227 Ga0207699_10004735 3300025906 Bacteria 6499
228 Ga0207645_10001127 3300025907 Bacteria 22111
229 Ga0207645_10093123 3300025907 Bacteria 1939
230 Ga0207643_10001393 3300025908 Bacteria 13876
231 Ga0207643_10012751 3300025908 Bacteria 4544
232 Ga0207643_10104654 3300025908 Bacteria 1662
233 Ga0207684_10100131 3300025910 Bacteria 2476
234 Ga0207684_10214791 3300025910 Bacteria 1659
235 Ga0207707_10015793 3300025912 Bacteria 6583
236 Ga0207707_10100527 3300025912 Bacteria 2527
237 Ga0207660_10088118 3300025917 Bacteria 2295
238 Ga0207660_10147104 3300025917 Bacteria 1807
239 Ga0207660_10270887 3300025917 Unclassified 1345
240 Ga0207662_10025658 3300025918 Bacteria 3394
241 Ga0207662_10036541 3300025918 Bacteria 2872
242 Ga0207657_10011612 3300025919 Bacteria 8735
243 Ga0207649_10070528 3300025920 Bacteria 2229
244 Ga0207652_10110528 3300025921 Bacteria 2437
245 Ga0207646_10039575 3300025922 Bacteria 4243
246 Ga0207646_10343460 3300025922 Bacteria 1349
247 Ga0207681_10001212 3300025923 Bacteria 16585
248 Ga0207681_10028625 3300025923 Bacteria 3610
249 Ga0207681_10042381 3300025923 Bacteria 3040
250 Ga0207681_10106335 3300025923 Bacteria 2033
251 Ga0207650_10093840 3300025925 Bacteria 2298
252 Ga0207650_10171569 3300025925 Bacteria 1724
253 Ga0207659_10000188 3300025926 Bacteria 36927
254 Ga0207659_10007454 3300025926 Bacteria 6728
255 Ga0207659_10091482 3300025926 Unclassified 2273
256 Ga0207687_10052748 3300025927 Unclassified 2839
257 Ga0207700_10012599 3300025928 Bacteria 5462
258 Ga0207644_10022641 3300025931 Bacteria 4294
259 Ga0207690_10162855 3300025932 Bacteria 1664
260 Ga0207706_10068160 3300025933 Bacteria 3131
261 Ga0207706_10116616 3300025933 Bacteria 2349
262 Ga0207686_10055481 3300025934 Bacteria 2486
263 Ga0207709_10071090 3300025935 Unclassified 2208
264 Ga0207709_10080381 3300025935 Bacteria 2099
265 Ga0207709_10225944 3300025935 Bacteria 1353
266 Ga0207670_10004537 3300025936 Bacteria 7494
267 Ga0207670_10028608 3300025936 Bacteria 3541
268 Ga0207670_10034353 3300025936 Bacteria 3277
269 Ga0207669_10015282 3300025937 Bacteria 3868
270 Ga0207704_10007205 3300025938 Bacteria 5238
271 Ga0207704_10081980 3300025938 Bacteria 2088
272 Ga0207691_10029953 3300025940 Bacteria 5089
273 Ga0207691_10071556 3300025940 Bacteria 3129
274 Ga0207691_10149979 3300025940 Bacteria 2050
275 Ga0207711_10007457 3300025941 Bacteria 9152
276 Ga0207711_10047114 3300025941 Bacteria 3685
277 Ga0207711_10067498 3300025941 Bacteria 3096
278 Ga0207711_10076039 3300025941 Bacteria 2923
279 Ga0207689_10055559 3300025942 Bacteria 3259
280 Ga0207689_10143106 3300025942 Unclassified 1970
281 Ga0207689_10220029 3300025942 Bacteria 1569
282 Ga0207679_10047809 3300025945 Bacteria 3111
283 Ga0207679_10242863 3300025945 Bacteria 1527
284 Ga0207667_10121824 3300025949 Bacteria 2687
285 Ga0207651_10010774 3300025960 Bacteria 5082
286 Ga0207651_10050471 3300025960 Bacteria 2825
287 Ga0207651_10174425 3300025960 Unclassified 1699
288 Ga0207712_10094453 3300025961 Bacteria 2209
289 Ga0207668_10027120 3300025972 Bacteria 3729
290 Ga0207640_10031314 3300025981 Bacteria 3285
291 Ga0207640_10137408 3300025981 Bacteria 1776
292 Ga0207703_10037804 3300026035 Bacteria 3847
293 Ga0207703_10053494 3300026035 Bacteria 3281
294 Ga0207639_10248505 3300026041 Unclassified 1550
295 Ga0207708_10021002 3300026075 Bacteria 4927
296 Ga0207708_10032018 3300026075 Bacteria 3992
297 Ga0207708_10035743 3300026075 Bacteria 3781
298 Ga0207708_10208081 3300026075 Bacteria 1563
299 Ga0207702_10020533 3300026078 Bacteria 5468
300 Ga0207641_10007307 3300026088 Bacteria 9204
301 Ga0207641_10281549 3300026088 Unclassified 1564
302 Ga0207648_10001673 3300026089 Bacteria 24273
303 Ga0207648_10009704 3300026089 Bacteria 9205
304 Ga0207648_10081496 3300026089 Bacteria 2822
305 Ga0207648_10085002 3300026089 Bacteria 2760
306 Ga0207676_10013381 3300026095 Bacteria 5893
307 Ga0207676_10019750 3300026095 Bacteria 4921
308 Ga0207676_10071582 3300026095 Bacteria 2784
309 Ga0207674_10006964 3300026116 Bacteria 13233
310 Ga0207675_100016948 3300026118 Bacteria 6808
311 Ga0207675_100025648 3300026118 Bacteria 5486
312 Ga0207675_100036001 3300026118 Bacteria 4616
313 Ga0207675_100042903 3300026118 Bacteria 4223
314 Ga0207675_100086496 3300026118 Bacteria 2944
315 Ga0207675_100127883 3300026118 Bacteria 2408
316 Ga0207675_100157222 3300026118 Bacteria 2166
317 Ga0207675_100213124 3300026118 Bacteria 1859
318 Ga0207683_10072747 3300026121 Unclassified 3040
319 Ga0207683_10121368 3300026121 Bacteria 2346
320 Ga0207428_10000026 3300027907 Bacteria 255539
321 Ga0207428_10000319 3300027907 Bacteria 62926
322 Ga0207428_10001344 3300027907 Bacteria 26177
323 Ga0207428_10008335 3300027907 Bacteria 9364
324 Ga0207428_10021167 3300027907 Bacteria 5508
325 Ga0207428_10051677 3300027907 Bacteria 3285
326 Ga0268266_10022883 3300028379 Bacteria 5318
327 Ga0268266_10042195 3300028379 Bacteria 3895
328 Ga0268265_10000618 3300028380 Bacteria 35420
329 Ga0268265_10032416 3300028380 Bacteria 3786
330 Ga0268264_10068812 3300028381 Bacteria 2993
331 Ga0265318_10027180 3300028577 Bacteria 2250
332 Ga0265336_10011428 3300028666 Bacteria 3019
333 Ga0265314_10014222 3300031711 Bacteria 6382
334 Ga0265314_10062200 3300031711 Bacteria 2538
335 Ga0307405_10048790 3300031731 Bacteria 2613
336 Ga0307413_10012898 3300031824 Bacteria 4178
337 Ga0307410_10004658 3300031852 Bacteria 7127
338 Ga0307410_10015855 3300031852 Bacteria 4479
339 Ga0307410_10085150 3300031852 Bacteria 2230
340 Ga0307410_10132213 3300031852 Bacteria 1834
341 Ga0307406_10003443 3300031901 Bacteria 8613
342 Ga0307407_10000594 3300031903 Bacteria 11505
343 Ga0307407_10002881 3300031903 Bacteria 6873
344 Ga0307407_10115084 3300031903 Bacteria 1695
345 Ga0307412_10023355 3300031911 Bacteria 3804
346 Ga0307412_10161075 3300031911 Bacteria 1667
347 Ga0307409_100004132 3300031995 Bacteria 8077
348 Ga0307409_100130439 3300031995 Bacteria 2147
349 Ga0307416_100001749 3300032002 Bacteria 12020
350 Ga0307416_100010946 3300032002 Bacteria 6020
351 Ga0307416_100026028 3300032002 Bacteria 4303
352 Ga0307416_100082874 3300032002 Bacteria 2718
353 Ga0307411_10004812 3300032005 Bacteria 6544
354 Ga0307411_10045368 3300032005 Bacteria 2827
355 Ga0307411_10048334 3300032005 Bacteria 2757
356 Ga0307411_10200110 3300032005 Bacteria 1533
357 Ga0307411_10232701 3300032005 Bacteria 1437
358 Ga0307415_100000792 3300032126 Bacteria 14346
359 Ga0373934_0012475 3300035086 Bacteria 3208
360 Ga0373936_0093920 3300035113 Bacteria 1260
361 Ga0373941_0003435 3300035115 Bacteria 3588
362 Ga0373945_0009789 3300035116 Bacteria 3145
363 Ga0373945_0012515 3300035116 Bacteria 2820
364 Ga0373956_0082597 3300035119 Unclassified 1476
365 Ga0373943_0029545 3300035170 Bacteria 2590
366 Ga0373924_0023620 3300035410 Unclassified 2415
367 Ga0373935_0013430 3300035692 Bacteria 4940
368 Ga0373935_0151450 3300035692 Unclassified 1574
369 Ga0373947_0088331 3300035725 Bacteria 1929
370 Ga0373937_0019372 3300036401 Bacteria 6091
371 Ga0373937_0029155 3300036401 Bacteria 4997
372 Ga0373925_0003038 3300037068 Bacteria 13202
373 Ga0439450_021371 3300042008 Bacteria 1389
374 Ga0439435_0000707 3300042436 Bacteria 5562
375 Ga0439435_0005481 3300042436 Bacteria 2794
376 Ga0451576_0004119 3300045051 Bacteria 19176
377 Ga0451576_0033485 3300045051 Bacteria 5462
378 Ga0451576_0087899 3300045051 Bacteria 3232
379 Ga0466967_0283988 3300045976 Bacteria 1589
380 Ga0495603_0006301 3300046455 Bacteria 7096
381 Ga0495629_0085276 3300046459 Bacteria 2204
382 Ga0495582_0059902 3300046473 Bacteria 2100
383 Ga0495662_0069018 3300046476 Bacteria 1712
384 Ga0495594_0007743 3300046499 Bacteria 5524
385 Ga0495594_0155658 3300046499 Unclassified 1298
386 Ga0495608_0016159 3300046511 Bacteria 5162
387 Ga0495630_0011908 3300046517 Bacteria 6305
388 Ga0495663_0018674 3300046525 Bacteria 1975
389 Ga0495642_0013170 3300046528 Bacteria 3194
390 Ga0495652_0016588 3300046529 Bacteria 6586
391 Ga0495598_0016800 3300046537 Bacteria 1875
392 Ga0495609_0020285 3300046538 Bacteria 3071
393 Ga0495621_0001780 3300046539 Bacteria 5657
394 Ga0495621_0005952 3300046539 Bacteria 3537
395 Ga0495621_0010567 3300046539 Bacteria 2829
396 Ga0495621_0013671 3300046539 Bacteria 2555
397 Ga0495645_0037167 3300046543 Bacteria 3548
398 Ga0495634_0128133 3300046642 Bacteria 1620
399 Ga0495659_0004533 3300046664 Bacteria 4370
400 Ga0495659_0011402 3300046664 Bacteria 2864
401 Ga0495659_0022810 3300046664 Bacteria 2121
402 Ga0495659_0023239 3300046664 Bacteria 2105
403 Ga0495659_0056516 3300046664 Bacteria 1440
404 Ga0495588_0028140 3300046674 Bacteria 2812
405 Ga0495669_0013119 3300046684 Bacteria 3529
406 Ga0495613_0000270 3300046689 Bacteria 48533
407 Ga0495604_0010810 3300047317 Bacteria 7248
408 Ga0495636_0019808 3300047318 Bacteria 2706
409 Ga0495674_0004142 3300047319 Bacteria 14004
410 Ga0495674_0188884 3300047319 Unclassified 1713
411 Ga0495676_0016670 3300047321 Bacteria 6508
412 Ga0495684_0000011 3300047471 Bacteria 195144
413 Ga0496101_0153451 3300048904 Unclassified 1763
414 Ga0496104_0286344 3300048907 Bacteria 1560
415 Ga0496104_0364110 3300048907 Unclassified 1358
416 Ga0496104_0398374 3300048907 Bacteria 1289
417 Ga0496107_0290062 3300048910 Bacteria 1218
418 Ga0496108_0049339 3300048911 Bacteria 3521
419 Ga0496108_0051540 3300048911 Bacteria 3448
420 Ga0496108_0076481 3300048911 Unclassified 2830
421 Ga0496109_0056590 3300048912 Bacteria 3579
422 Ga0496112_0036226 3300048915 Bacteria 4812
423 Ga0496113_0109829 3300048916 Bacteria 2145
424 Ga0496114_0088590 3300048917 Bacteria 2625
425 Ga0496114_0284535 3300048917 Bacteria 1458
426 Ga0501033_0122526 3300049570 Unclassified 1886
427 Ga0501036_0010626 3300049572 Bacteria 7606
428 Ga0501036_0072457 3300049572 Bacteria 2912
429 Ga0501036_0175907 3300049572 Bacteria 1802
430 Ga0501038_0019145 3300049574 Bacteria 6174
431 Ga0501040_0000719 3300049576 Bacteria 20451
432 Ga0501041_0055648 3300049577 Unclassified 2415
433 Ga0501042_0006212 3300049578 Bacteria 7755
434 Ga0501042_0010100 3300049578 Bacteria 6314
435 Ga0501042_0150126 3300049578 Bacteria 1680
436 Ga0501046_0002475 3300049580 Bacteria 17314
437 Ga0501046_0057811 3300049580 Bacteria 3042
438 Ga0501047_0064780 3300049581 Bacteria 3525
439 Ga0501068_0042903 3300049584 Bacteria 2720
440 Ga0501071_0007286 3300049587 Bacteria 7241
441 Ga0501071_0008594 3300049587 Bacteria 6750
442 Ga0501072_0012525 3300049588 Bacteria 6485
443 Ga0501072_0025698 3300049588 Bacteria 4587
444 Ga0501072_0079596 3300049588 Bacteria 2595
445 Ga0501073_0002679 3300049589 Bacteria 13335
446 Ga0501075_0000043 3300049591 Bacteria 51143
447 Ga0501075_0030526 3300049591 Bacteria 3993
448 Ga0501075_0129667 3300049591 Unclassified 1921
449 Ga0501075_0218535 3300049591 Unclassified 1454
450 Ga0501076_0061193 3300049592 Bacteria 2996
451 Ga0501077_0007615 3300049593 Bacteria 6684
452 Ga0501077_0160811 3300049593 Bacteria 1426
453 Ga0501079_0001578 3300049741 Bacteria 16191
454 Ga0501079_0075165 3300049741 Bacteria 2612
455 Ga0501079_0094540 3300049741 Bacteria 2316
456 Ga0501081_0002138 3300049743 Bacteria 12373
457 Ga0501035_0084172 3300049822 Bacteria 2805
458 Ga0501045_0016266 3300049824 Bacteria 5282
459 Ga0501045_0044965 3300049824 Bacteria 3215
460 Ga0501045_0080247 3300049824 Bacteria 2405
461 nmdc:mga05p37_124218_c1 3300050507 Bacteria 3170
462 nmdc:mga05p37_14340_c1 3300050507 Bacteria 9515
463 nmdc:mga05p37_179975_c1 3300050507 Bacteria 2573
464 nmdc:mga05p37_21858_c2 3300050507 Bacteria 5645
465 nmdc:mga05p37_228117_c1 3300050507 Unclassified 2245
466 nmdc:mga05p37_29565_c1 3300050507 Bacteria 4975
467 nmdc:mga05p37_3618_c1 3300050507 Bacteria 18067
468 nmdc:mga05p37_49197_c1 3300050507 Bacteria 5185
469 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
470 nmdc:mga05p37_9709_c1 3300050507 Bacteria 11411
471 nmdc:mga09592_11229_c1 3300050508 Bacteria 7288
472 nmdc:mga0qj67_2070_c1 3300050509 Bacteria 14319
473 nmdc:mga0qj67_21426_c1 3300050509 Bacteria 4958
474 nmdc:mga0qj67_81320_c1 3300050509 Bacteria 2597
475 nmdc:mga06r32_3246_c1 3300050510 Bacteria 14550
476 nmdc:mga06r32_72230_c1 3300050510 Bacteria 3341
477 nmdc:mga08y16_1387_c1 3300050511 Bacteria 24239
478 nmdc:mga08y16_13945_c1 3300050511 Bacteria 8460
479 nmdc:mga08y16_144609_c1 3300050511 Bacteria 2472
480 nmdc:mga08y16_208867_c1 3300050511 Bacteria 2022
481 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
482 nmdc:mga08y16_34796_c1 3300050511 Bacteria 5293
483 nmdc:mga08y16_385233_c1 3300050511 Bacteria 1437
484 nmdc:mga08y16_64032_c1 3300050511 Bacteria 3840
485 nmdc:mga08y16_8286_c1 3300050511 Bacteria 10875
486 nmdc:mga08y16_86164_c1 3300050511 Bacteria 3274
487 nmdc:mga0n895_18715_c1 3300050512 Bacteria 6417
488 nmdc:mga0n895_361552_c1 3300050512 Bacteria 1470
489 nmdc:mga0n895_7444_c1 3300050512 Bacteria 9395
490 nmdc:mga0rr50_11809_c1 3300050513 Bacteria 5609
491 nmdc:mga0rr50_248211_c1 3300050513 Bacteria 1477
492 nmdc:mga0rr50_70316_c1 3300050513 Bacteria 2667
493 nmdc:mga08x19_18047_c1 3300050514 Bacteria 4323
494 nmdc:mga08x19_31050_c1 3300050514 Bacteria 3359
495 nmdc:mga0a205_14352_c1 3300050515 Bacteria 7388
496 nmdc:mga0a205_15836_c2 3300050515 Bacteria 6656
497 nmdc:mga0a205_34268_c1 3300050515 Bacteria 4872
498 nmdc:mga0a205_432220_c1 3300050515 Bacteria 1178
499 nmdc:mga0a205_68050_c1 3300050515 Bacteria 3439
500 nmdc:mga0a205_71176_c1 3300050515 Bacteria 3359
501 Ga0495601_0010849 3300053077 Bacteria 5437
502 Ga0495601_0013734 3300053077 Bacteria 4873
503 Ga0495601_0035949 3300053077 Bacteria 3093
504 Ga0495619_0002253 3300053085 Bacteria 12750
505 Ga0495619_0012337 3300053085 Bacteria 5378
506 Ga0500556_0047735 3300053104 Bacteria 1537
507 Ga0501084_0010055 3300054114 Bacteria 7819
508 Ga0501084_0024503 3300054114 Bacteria 5035
509 Ga0590071_000006 3300059421 Bacteria 60899
510 Ga0590071_001300 3300059421 Bacteria 6680
511 Ga0590071_010383 3300059421 Bacteria 2181
512 Ga0590074_001634 3300059423 Bacteria 3650
513 Ga0590075_000335 3300059424 Bacteria 13095
514 Ga0590075_008589 3300059424 Bacteria 2440
515 Ga0590077_000034 3300059426 Bacteria 31653
516 Ga0590077_001330 3300059426 Bacteria 5832
517 Ga0501082_0045164 3300060353 Bacteria 3799
518 Ga0530510_0016549 3300061734 Bacteria 5221
519 Ga0530510_0052935 3300061734 Bacteria 2933
520 Ga0530510_0094501 3300061734 Unclassified 2183
521 Ga0530510_0154460 3300061734 Bacteria 1695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025885 Ga0207653_10019417 Ga0207653_100194172 339
2 3300053104 Ga0500556_0047735 Ga0500556_0047735_473_1495 340
3 3300049572 Ga0501036_0072457 Ga0501036_0072457_1101_2219 342
4 3300049587 Ga0501071_0008594 Ga0501071_0008594_89_1207 342
5 3300049588 Ga0501072_0012525 Ga0501072_0012525_3002_4120 342
6 3300049591 Ga0501075_0030526 Ga0501075_0030526_1272_2390 342
7 3300049592 Ga0501076_0061193 Ga0501076_0061193_455_1573 342
8 3300049824 Ga0501045_0044965 Ga0501045_0044965_1613_2731 342
9 3300061734 Ga0530510_0052935 Ga0530510_0052935_903_2021 342
10 3300013297 Ga0157378_10071772 Ga0157378_100717722 346
11 3300005340 Ga0070689_100034472 Ga0070689_1000344722 347
12 3300005343 Ga0070687_100021508 Ga0070687_1000215082 347
13 3300005345 Ga0070692_10062392 Ga0070692_100623922 347
14 3300005353 Ga0070669_100001105 Ga0070669_1000011057 347
15 3300005354 Ga0070675_100022490 Ga0070675_1000224902 347
16 3300005444 Ga0070694_100011197 Ga0070694_1000111974 347
17 3300005457 Ga0070662_100005750 Ga0070662_1000057501 347
18 3300005459 Ga0068867_100000222 Ga0068867_1000002222 347
19 3300005549 Ga0070704_100000485 Ga0070704_10000048512 347
20 3300005577 Ga0068857_100033987 Ga0068857_1000339872 347
21 3300005578 Ga0068854_100202154 Ga0068854_1002021542 347
22 3300005617 Ga0068859_100005710 Ga0068859_1000057109 347
23 3300005618 Ga0068864_100115546 Ga0068864_1001155462 347
24 3300005719 Ga0068861_100014182 Ga0068861_1000141825 347
25 3300005840 Ga0068870_10001502 Ga0068870_100015024 347
26 3300005844 Ga0068862_100000612 Ga0068862_10000061230 347
27 3300006931 Ga0097620_100005711 Ga0097620_1000057116 347
28 3300009094 Ga0111539_10074073 Ga0111539_100740734 347
29 3300009148 Ga0105243_10039267 Ga0105243_100392672 347
30 3300009553 Ga0105249_10019962 Ga0105249_100199624 347
31 3300025908 Ga0207643_10001393 Ga0207643_100013934 347
32 3300025918 Ga0207662_10025658 Ga0207662_100256582 347
33 3300025923 Ga0207681_10001212 Ga0207681_1000121213 347
34 3300025926 Ga0207659_10091482 Ga0207659_100914822 347
35 3300025935 Ga0207709_10071090 Ga0207709_100710902 347
36 3300025936 Ga0207670_10004537 Ga0207670_100045376 347
37 3300025945 Ga0207679_10242863 Ga0207679_102428632 347
38 3300026089 Ga0207648_10001673 Ga0207648_100016734 347
39 3300026116 Ga0207674_10006964 Ga0207674_1000696412 347
40 3300026118 Ga0207675_100036001 Ga0207675_1000360012 347
41 3300027907 Ga0207428_10001344 Ga0207428_1000134418 347
42 3300028380 Ga0268265_10000618 Ga0268265_1000061821 347
43 3300050511 nmdc:mga08y16_144609_c1 nmdc:mga08y16_144609_c1_1009_2133 347
44 3300050511 nmdc:mga08y16_34796_c1 nmdc:mga08y16_34796_c1_1210_2328 347
45 3300046455 Ga0495603_0006301 Ga0495603_0006301_280_1395 348
46 3300046499 Ga0495594_0007743 Ga0495594_0007743_3455_4570 348
47 3300046539 Ga0495621_0001780 Ga0495621_0001780_3737_4855 348
48 3300046674 Ga0495588_0028140 Ga0495588_0028140_1184_2299 348
49 3300050511 nmdc:mga08y16_385233_c1 nmdc:mga08y16_385233_c1_72_1196 349
50 3300005535 Ga0070684_100277926 Ga0070684_1002779261 350
51 3300050511 nmdc:mga08y16_64032_c1 nmdc:mga08y16_64032_c1_2476_3600 352
52 3300005441 Ga0070700_100011176 Ga0070700_1000111763 355
53 3300014326 Ga0157380_10011586 Ga0157380_100115867 355
54 3300014326 Ga0157380_10147977 Ga0157380_101479772 355
55 3300026075 Ga0207708_10021002 Ga0207708_100210023 355
56 3300045051 Ga0451576_0033485 Ga0451576_0033485_2046_3164 360
57 3300046664 Ga0495659_0023239 Ga0495659_0023239_762_1880 360
58 3300049591 Ga0501075_0218535 Ga0501075_0218535_295_1419 360
59 3300005336 Ga0070680_100264326 Ga0070680_1002643262 361
60 3300005458 Ga0070681_10091003 Ga0070681_100910031 361
61 3300025912 Ga0207707_10100527 Ga0207707_101005272 361
62 3300025917 Ga0207660_10147104 Ga0207660_101471042 361
63 3300005355 Ga0070671_100005817 Ga0070671_1000058177 362
64 3300005543 Ga0070672_100125870 Ga0070672_1001258702 362
65 3300005841 Ga0068863_100007042 Ga0068863_1000070422 362
66 3300005841 Ga0068863_100047346 Ga0068863_1000473464 362
67 3300006871 Ga0075434_100035383 Ga0075434_1000353834 362
68 3300007076 Ga0075435_100000663 Ga0075435_10000066310 362
69 3300007076 Ga0075435_100053739 Ga0075435_1000537393 362
70 3300007265 Ga0099794_10119597 Ga0099794_101195971 362
71 3300009147 Ga0114129_10006090 Ga0114129_1000609012 362
72 3300009147 Ga0114129_10009873 Ga0114129_100098734 362
73 3300009147 Ga0114129_10017722 Ga0114129_100177225 362
74 3300009147 Ga0114129_10030544 Ga0114129_100305444 362
75 3300009147 Ga0114129_10274502 Ga0114129_102745022 362
76 3300025931 Ga0207644_10022641 Ga0207644_100226414 362
77 3300025940 Ga0207691_10071556 Ga0207691_100715563 362
78 3300026041 Ga0207639_10248505 Ga0207639_102485051 362
79 3300026088 Ga0207641_10007307 Ga0207641_100073076 362
80 3300035115 Ga0373941_0003435 Ga0373941_0003435_2227_3315 362
81 3300050507 nmdc:mga05p37_124218_c1 nmdc:mga05p37_124218_c1_1396_2484 362
82 3300050507 nmdc:mga05p37_21858_c2 nmdc:mga05p37_21858_c2_939_2027 362
83 3300050507 nmdc:mga05p37_228117_c1 nmdc:mga05p37_228117_c1_1122_2210 362
84 3300050507 nmdc:mga05p37_3618_c1 nmdc:mga05p37_3618_c1_15338_16426 362
85 3300050507 nmdc:mga05p37_9709_c1 nmdc:mga05p37_9709_c1_673_1761 362
86 3300050512 nmdc:mga0n895_18715_c1 nmdc:mga0n895_18715_c1_2534_3622 362
87 3300050513 nmdc:mga0rr50_248211_c1 nmdc:mga0rr50_248211_c1_181_1299 362
88 3300050514 nmdc:mga08x19_18047_c1 nmdc:mga08x19_18047_c1_217_1305 362
89 3300050514 nmdc:mga08x19_31050_c1 nmdc:mga08x19_31050_c1_1087_2175 362
90 3300050515 nmdc:mga0a205_34268_c1 nmdc:mga0a205_34268_c1_2432_3520 362
91 3300050515 nmdc:mga0a205_68050_c1 nmdc:mga0a205_68050_c1_1412_2500 362
92 3300025917 Ga0207660_10270887 Ga0207660_102708871 363
93 3300005365 Ga0070688_100003624 Ga0070688_1000036246 364
94 3300005367 Ga0070667_100271116 Ga0070667_1002711162 364
95 3300005842 Ga0068858_100058067 Ga0068858_1000580672 364
96 3300006871 Ga0075434_100012231 Ga0075434_1000122314 364
97 3300007076 Ga0075435_100006600 Ga0075435_1000066002 364
98 3300014745 Ga0157377_10031057 Ga0157377_100310573 364
99 3300025926 Ga0207659_10000188 Ga0207659_100001886 364
100 3300025936 Ga0207670_10034353 Ga0207670_100343533 364
101 3300026035 Ga0207703_10037804 Ga0207703_100378043 364
102 3300026121 Ga0207683_10121368 Ga0207683_101213682 364
103 3300045051 Ga0451576_0087899 Ga0451576_0087899_1067_2185 364
104 3300050512 nmdc:mga0n895_361552_c1 nmdc:mga0n895_361552_c1_132_1250 364
105 3300050513 nmdc:mga0rr50_11809_c1 nmdc:mga0rr50_11809_c1_1332_2450 364
106 3300059421 Ga0590071_001300 Ga0590071_001300_2917_4032 364
107 3300059423 Ga0590074_001634 Ga0590074_001634_1619_2734 364
108 3300059424 Ga0590075_008589 Ga0590075_008589_204_1319 364
109 3300059426 Ga0590077_001330 Ga0590077_001330_3623_4738 364
110 3300014326 Ga0157380_10054559 Ga0157380_100545592 365
111 3300025941 Ga0207711_10067498 Ga0207711_100674983 365
112 3300005617 Ga0068859_100360868 Ga0068859_1003608681 367
113 3300006358 Ga0068871_100337938 Ga0068871_1003379382 367
114 3300006931 Ga0097620_100360807 Ga0097620_1003608071 367
115 3300013297 Ga0157378_10085368 Ga0157378_100853683 367
116 3300014325 Ga0163163_10017165 Ga0163163_100171657 367
117 3300017792 Ga0163161_10188914 Ga0163161_101889142 367
118 3300025941 Ga0207711_10047114 Ga0207711_100471144 367
119 3300025960 Ga0207651_10050471 Ga0207651_100504713 367
120 3300036401 Ga0373937_0019372 Ga0373937_0019372_779_1894 371
121 3300059421 Ga0590071_010383 Ga0590071_010383_858_1976 371
122 3300061734 Ga0530510_0016549 Ga0530510_0016549_502_1620 371
123 3300005293 Ga0065715_10092297 Ga0065715_100922974 372
124 3300005295 Ga0065707_10000760 Ga0065707_100007608 372
125 3300005331 Ga0070670_100006802 Ga0070670_1000068022 372
126 3300005331 Ga0070670_100026727 Ga0070670_1000267275 372
127 3300005336 Ga0070680_100259078 Ga0070680_1002590782 372
128 3300005343 Ga0070687_100046199 Ga0070687_1000461991 372
129 3300005345 Ga0070692_10007070 Ga0070692_100070705 372
130 3300005354 Ga0070675_100243797 Ga0070675_1002437971 372
131 3300005364 Ga0070673_100059771 Ga0070673_1000597712 372
132 3300005440 Ga0070705_100003619 Ga0070705_1000036191 372
133 3300005440 Ga0070705_100004620 Ga0070705_1000046204 372
134 3300005441 Ga0070700_100020621 Ga0070700_1000206212 372
135 3300005444 Ga0070694_100000279 Ga0070694_10000027923 372
136 3300005445 Ga0070708_100144829 Ga0070708_1001448292 372
137 3300005458 Ga0070681_10005726 Ga0070681_100057266 372
138 3300005467 Ga0070706_100339893 Ga0070706_1003398932 372
139 3300005468 Ga0070707_100067085 Ga0070707_1000670852 372
140 3300005471 Ga0070698_100009874 Ga0070698_1000098749 372
141 3300005471 Ga0070698_100014852 Ga0070698_1000148524 372
142 3300005471 Ga0070698_100029690 Ga0070698_1000296902 372
143 3300005518 Ga0070699_100001245 Ga0070699_10000124510 372
144 3300005536 Ga0070697_100032297 Ga0070697_1000322975 372
145 3300005545 Ga0070695_100000255 Ga0070695_10000025523 372
146 3300005545 Ga0070695_100022215 Ga0070695_1000222155 372
147 3300005546 Ga0070696_100049342 Ga0070696_1000493422 372
148 3300005549 Ga0070704_100003547 Ga0070704_1000035475 372
149 3300005549 Ga0070704_100055628 Ga0070704_1000556282 372
150 3300005564 Ga0070664_100042433 Ga0070664_1000424332 372
151 3300005615 Ga0070702_100167265 Ga0070702_1001672652 372
152 3300005617 Ga0068859_100004506 Ga0068859_1000045065 372
153 3300005617 Ga0068859_100013075 Ga0068859_1000130756 372
154 3300005617 Ga0068859_100098248 Ga0068859_1000982483 372
155 3300005618 Ga0068864_100005495 Ga0068864_1000054956 372
156 3300005937 Ga0081455_10078000 Ga0081455_100780002 372
157 3300006844 Ga0075428_100000060 Ga0075428_10000006052 372
158 3300006844 Ga0075428_100000862 Ga0075428_1000008625 372
159 3300006852 Ga0075433_10011585 Ga0075433_100115852 372
160 3300006852 Ga0075433_10026751 Ga0075433_100267512 372
161 3300006871 Ga0075434_100004387 Ga0075434_1000043876 372
162 3300006871 Ga0075434_100016714 Ga0075434_1000167146 372
163 3300006931 Ga0097620_100004506 Ga0097620_1000045065 372
164 3300006931 Ga0097620_100013075 Ga0097620_1000130756 372
165 3300006931 Ga0097620_100098248 Ga0097620_1000982482 372
166 3300007076 Ga0075435_100014795 Ga0075435_1000147953 372
167 3300009094 Ga0111539_10000002 Ga0111539_10000002720 372
168 3300009094 Ga0111539_10133649 Ga0111539_101336492 372
169 3300009147 Ga0114129_10001294 Ga0114129_1000129420 372
170 3300009147 Ga0114129_10014134 Ga0114129_100141344 372
171 3300009147 Ga0114129_10042517 Ga0114129_100425173 372
172 3300009148 Ga0105243_10191411 Ga0105243_101914111 372
173 3300014325 Ga0163163_10049496 Ga0163163_100494964 372
174 3300014326 Ga0157380_10082645 Ga0157380_100826452 372
175 3300014968 Ga0157379_10168243 Ga0157379_101682431 372
176 3300025908 Ga0207643_10012751 Ga0207643_100127514 372
177 3300025910 Ga0207684_10100131 Ga0207684_101001312 372
178 3300025910 Ga0207684_10214791 Ga0207684_102147912 372
179 3300025912 Ga0207707_10015793 Ga0207707_100157936 372
180 3300025921 Ga0207652_10110528 Ga0207652_101105282 372
181 3300025922 Ga0207646_10039575 Ga0207646_100395754 372
182 3300025922 Ga0207646_10343460 Ga0207646_103434601 372
183 3300025925 Ga0207650_10171569 Ga0207650_101715692 372
184 3300025935 Ga0207709_10225944 Ga0207709_102259441 372
185 3300025942 Ga0207689_10055559 Ga0207689_100555593 372
186 3300025960 Ga0207651_10174425 Ga0207651_101744251 372
187 3300026075 Ga0207708_10035743 Ga0207708_100357431 372
188 3300026088 Ga0207641_10281549 Ga0207641_102815492 372
189 3300026095 Ga0207676_10019750 Ga0207676_100197504 372
190 3300026118 Ga0207675_100042903 Ga0207675_1000429032 372
191 3300027907 Ga0207428_10000026 Ga0207428_1000002667 372
192 3300031852 Ga0307410_10015855 Ga0307410_100158553 372
193 3300031903 Ga0307407_10002881 Ga0307407_100028812 372
194 3300031995 Ga0307409_100130439 Ga0307409_1001304392 372
195 3300032005 Ga0307411_10200110 Ga0307411_102001102 372
196 3300045051 Ga0451576_0004119 Ga0451576_0004119_9161_10279 372
197 3300046525 Ga0495663_0018674 Ga0495663_0018674_794_1912 372
198 3300046528 Ga0495642_0013170 Ga0495642_0013170_205_1323 372
199 3300046538 Ga0495609_0020285 Ga0495609_0020285_1649_2767 372
200 3300046539 Ga0495621_0005952 Ga0495621_0005952_263_1381 372
201 3300046539 Ga0495621_0013671 Ga0495621_0013671_1017_2135 372
202 3300046664 Ga0495659_0004533 Ga0495659_0004533_872_1990 372
203 3300046664 Ga0495659_0011402 Ga0495659_0011402_1020_2138 372
204 3300046664 Ga0495659_0022810 Ga0495659_0022810_798_1916 372
205 3300046664 Ga0495659_0056516 Ga0495659_0056516_178_1296 372
206 3300046684 Ga0495669_0013119 Ga0495669_0013119_978_2096 372
207 3300047318 Ga0495636_0019808 Ga0495636_0019808_309_1427 372
208 3300047321 Ga0495676_0016670 Ga0495676_0016670_4940_6058 372
209 3300048907 Ga0496104_0364110 Ga0496104_0364110_165_1283 372
210 3300048911 Ga0496108_0049339 Ga0496108_0049339_76_1194 372
211 3300048912 Ga0496109_0056590 Ga0496109_0056590_605_1723 372
212 3300048915 Ga0496112_0036226 Ga0496112_0036226_745_1863 372
213 3300050507 nmdc:mga05p37_14340_c1 nmdc:mga05p37_14340_c1_2928_4046 372
214 3300050507 nmdc:mga05p37_179975_c1 nmdc:mga05p37_179975_c1_476_1594 372
215 3300050507 nmdc:mga05p37_29565_c1 nmdc:mga05p37_29565_c1_3155_4273 372
216 3300050507 nmdc:mga05p37_644_c1 nmdc:mga05p37_644_c1_18672_19790 372
217 3300050511 nmdc:mga08y16_208867_c1 nmdc:mga08y16_208867_c1_884_2002 372
218 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_162030_163151 372
219 3300050512 nmdc:mga0n895_7444_c1 nmdc:mga0n895_7444_c1_3346_4464 372
220 3300050513 nmdc:mga0rr50_70316_c1 nmdc:mga0rr50_70316_c1_1343_2461 372
221 3300050515 nmdc:mga0a205_14352_c1 nmdc:mga0a205_14352_c1_1121_2239 372
222 3300050515 nmdc:mga0a205_15836_c2 nmdc:mga0a205_15836_c2_3638_4756 372
223 3300050515 nmdc:mga0a205_71176_c1 nmdc:mga0a205_71176_c1_1810_2928 372
224 3300005328 Ga0070676_10076679 Ga0070676_100766791 373
225 3300005339 Ga0070660_100104354 Ga0070660_1001043542 373
226 3300005341 Ga0070691_10003313 Ga0070691_100033135 373
227 3300005343 Ga0070687_100035239 Ga0070687_1000352392 373
228 3300005344 Ga0070661_100035511 Ga0070661_1000355112 373
229 3300005345 Ga0070692_10057962 Ga0070692_100579622 373
230 3300005347 Ga0070668_100048981 Ga0070668_1000489812 373
231 3300005347 Ga0070668_100181019 Ga0070668_1001810192 373
232 3300005353 Ga0070669_100017293 Ga0070669_1000172935 373
233 3300005353 Ga0070669_100189523 Ga0070669_1001895232 373
234 3300005353 Ga0070669_100215203 Ga0070669_1002152032 373
235 3300005364 Ga0070673_100015170 Ga0070673_1000151702 373
236 3300005364 Ga0070673_100347950 Ga0070673_1003479501 373
237 3300005366 Ga0070659_100053220 Ga0070659_1000532203 373
238 3300005434 Ga0070709_10019296 Ga0070709_100192963 373
239 3300005436 Ga0070713_100060163 Ga0070713_1000601632 373
240 3300005438 Ga0070701_10008427 Ga0070701_100084275 373
241 3300005440 Ga0070705_100020626 Ga0070705_1000206263 373
242 3300005441 Ga0070700_100076033 Ga0070700_1000760332 373
243 3300005444 Ga0070694_100016697 Ga0070694_1000166974 373
244 3300005458 Ga0070681_10146189 Ga0070681_101461892 373
245 3300005459 Ga0068867_100005323 Ga0068867_1000053235 373
246 3300005459 Ga0068867_100042914 Ga0068867_1000429143 373
247 3300005459 Ga0068867_100104536 Ga0068867_1001045362 373
248 3300005518 Ga0070699_100005432 Ga0070699_10000543210 373
249 3300005530 Ga0070679_100075248 Ga0070679_1000752483 373
250 3300005536 Ga0070697_100147902 Ga0070697_1001479022 373
251 3300005545 Ga0070695_100006166 Ga0070695_1000061666 373
252 3300005546 Ga0070696_100008853 Ga0070696_1000088535 373
253 3300005548 Ga0070665_100025666 Ga0070665_1000256664 373
254 3300005549 Ga0070704_100005780 Ga0070704_1000057804 373
255 3300005549 Ga0070704_100061224 Ga0070704_1000612242 373
256 3300005563 Ga0068855_100068338 Ga0068855_1000683382 373
257 3300005563 Ga0068855_100168629 Ga0068855_1001686292 373
258 3300005564 Ga0070664_100022865 Ga0070664_1000228655 373
259 3300005578 Ga0068854_100029433 Ga0068854_1000294332 373
260 3300005578 Ga0068854_100066039 Ga0068854_1000660392 373
261 3300005614 Ga0068856_100024826 Ga0068856_1000248263 373
262 3300005615 Ga0070702_100007736 Ga0070702_1000077365 373
263 3300005616 Ga0068852_100056782 Ga0068852_1000567824 373
264 3300005617 Ga0068859_100449444 Ga0068859_1004494442 373
265 3300005618 Ga0068864_100007279 Ga0068864_1000072795 373
266 3300005618 Ga0068864_100158180 Ga0068864_1001581802 373
267 3300005842 Ga0068858_100002099 Ga0068858_10000209910 373
268 3300005842 Ga0068858_100048871 Ga0068858_1000488714 373
269 3300005842 Ga0068858_100092750 Ga0068858_1000927502 373
270 3300005981 Ga0081538_10033129 Ga0081538_100331292 373
271 3300006237 Ga0097621_100008050 Ga0097621_1000080504 373
272 3300006358 Ga0068871_100039150 Ga0068871_1000391504 373
273 3300006358 Ga0068871_100374825 Ga0068871_1003748252 373
274 3300006844 Ga0075428_100001853 Ga0075428_10000185311 373
275 3300006844 Ga0075428_100011882 Ga0075428_1000118822 373
276 3300006846 Ga0075430_100001840 Ga0075430_1000018404 373
277 3300006847 Ga0075431_100091365 Ga0075431_1000913653 373
278 3300006880 Ga0075429_100007529 Ga0075429_1000075297 373
279 3300006880 Ga0075429_100018798 Ga0075429_1000187984 373
280 3300006880 Ga0075429_100319988 Ga0075429_1003199882 373
281 3300006881 Ga0068865_100013010 Ga0068865_1000130105 373
282 3300006914 Ga0075436_100007726 Ga0075436_1000077268 373
283 3300006931 Ga0097620_100449455 Ga0097620_1004494552 373
284 3300007076 Ga0075435_100105976 Ga0075435_1001059762 373
285 3300009094 Ga0111539_10003630 Ga0111539_100036308 373
286 3300009094 Ga0111539_10361204 Ga0111539_103612042 373
287 3300009098 Ga0105245_10034722 Ga0105245_100347224 373
288 3300009098 Ga0105245_10223930 Ga0105245_102239302 373
289 3300009101 Ga0105247_10002871 Ga0105247_1000287110 373
290 3300009101 Ga0105247_10012165 Ga0105247_100121655 373
291 3300009147 Ga0114129_10086702 Ga0114129_100867023 373
292 3300009147 Ga0114129_10086916 Ga0114129_100869164 373
293 3300009147 Ga0114129_10189438 Ga0114129_101894382 373
294 3300009148 Ga0105243_10020299 Ga0105243_100202994 373
295 3300009148 Ga0105243_10162217 Ga0105243_101622172 373
296 3300009176 Ga0105242_10009175 Ga0105242_100091754 373
297 3300009176 Ga0105242_10013615 Ga0105242_100136154 373
298 3300009177 Ga0105248_10009460 Ga0105248_1000946011 373
299 3300009177 Ga0105248_10020526 Ga0105248_100205265 373
300 3300009177 Ga0105248_10129297 Ga0105248_101292974 373
301 3300009553 Ga0105249_10251719 Ga0105249_102517192 373
302 3300013296 Ga0157374_10031300 Ga0157374_100313004 373
303 3300013296 Ga0157374_10083827 Ga0157374_100838273 373
304 3300013297 Ga0157378_10217961 Ga0157378_102179612 373
305 3300013308 Ga0157375_10067611 Ga0157375_100676112 373
306 3300014325 Ga0163163_10031366 Ga0163163_100313665 373
307 3300014325 Ga0163163_10440878 Ga0163163_104408782 373
308 3300014326 Ga0157380_10012703 Ga0157380_100127034 373
309 3300014326 Ga0157380_10030470 Ga0157380_100304704 373
310 3300014326 Ga0157380_10357293 Ga0157380_103572932 373
311 3300014968 Ga0157379_10013873 Ga0157379_100138734 373
312 3300014968 Ga0157379_10082940 Ga0157379_100829402 373
313 3300014969 Ga0157376_10010717 Ga0157376_100107174 373
314 3300014969 Ga0157376_10144492 Ga0157376_101444922 373
315 3300014969 Ga0157376_10146625 Ga0157376_101466252 373
316 3300025900 Ga0207710_10078287 Ga0207710_100782871 373
317 3300025903 Ga0207680_10056590 Ga0207680_100565902 373
318 3300025903 Ga0207680_10099441 Ga0207680_100994412 373
319 3300025906 Ga0207699_10004735 Ga0207699_100047356 373
320 3300025907 Ga0207645_10001127 Ga0207645_100011277 373
321 3300025907 Ga0207645_10093123 Ga0207645_100931232 373
322 3300025908 Ga0207643_10104654 Ga0207643_101046542 373
323 3300025917 Ga0207660_10088118 Ga0207660_100881182 373
324 3300025919 Ga0207657_10011612 Ga0207657_100116127 373
325 3300025920 Ga0207649_10070528 Ga0207649_100705282 373
326 3300025923 Ga0207681_10028625 Ga0207681_100286252 373
327 3300025923 Ga0207681_10042381 Ga0207681_100423812 373
328 3300025923 Ga0207681_10106335 Ga0207681_101063351 373
329 3300025926 Ga0207659_10007454 Ga0207659_100074546 373
330 3300025927 Ga0207687_10052748 Ga0207687_100527482 373
331 3300025928 Ga0207700_10012599 Ga0207700_100125994 373
332 3300025932 Ga0207690_10162855 Ga0207690_101628552 373
333 3300025933 Ga0207706_10068160 Ga0207706_100681602 373
334 3300025934 Ga0207686_10055481 Ga0207686_100554812 373
335 3300025935 Ga0207709_10080381 Ga0207709_100803812 373
336 3300025938 Ga0207704_10007205 Ga0207704_100072055 373
337 3300025938 Ga0207704_10081980 Ga0207704_100819802 373
338 3300025941 Ga0207711_10007457 Ga0207711_100074572 373
339 3300025941 Ga0207711_10076039 Ga0207711_100760393 373
340 3300025942 Ga0207689_10143106 Ga0207689_101431062 373
341 3300025945 Ga0207679_10047809 Ga0207679_100478092 373
342 3300025949 Ga0207667_10121824 Ga0207667_101218242 373
343 3300025961 Ga0207712_10094453 Ga0207712_100944532 373
344 3300025972 Ga0207668_10027120 Ga0207668_100271202 373
345 3300025981 Ga0207640_10031314 Ga0207640_100313143 373
346 3300025981 Ga0207640_10137408 Ga0207640_101374082 373
347 3300026035 Ga0207703_10053494 Ga0207703_100534943 373
348 3300026075 Ga0207708_10032018 Ga0207708_100320184 373
349 3300026075 Ga0207708_10208081 Ga0207708_102080812 373
350 3300026078 Ga0207702_10020533 Ga0207702_100205334 373
351 3300026089 Ga0207648_10009704 Ga0207648_100097046 373
352 3300026089 Ga0207648_10081496 Ga0207648_100814962 373
353 3300026095 Ga0207676_10013381 Ga0207676_100133812 373
354 3300026118 Ga0207675_100016948 Ga0207675_1000169485 373
355 3300026118 Ga0207675_100025648 Ga0207675_1000256485 373
356 3300026118 Ga0207675_100086496 Ga0207675_1000864962 373
357 3300026118 Ga0207675_100127883 Ga0207675_1001278831 373
358 3300026118 Ga0207675_100157222 Ga0207675_1001572222 373
359 3300026118 Ga0207675_100213124 Ga0207675_1002131242 373
360 3300026121 Ga0207683_10072747 Ga0207683_100727472 373
361 3300027907 Ga0207428_10008335 Ga0207428_100083355 373
362 3300028379 Ga0268266_10022883 Ga0268266_100228832 373
363 3300028379 Ga0268266_10042195 Ga0268266_100421954 373
364 3300028380 Ga0268265_10032416 Ga0268265_100324162 373
365 3300028381 Ga0268264_10068812 Ga0268264_100688124 373
366 3300028577 Ga0265318_10027180 Ga0265318_100271802 373
367 3300028666 Ga0265336_10011428 Ga0265336_100114282 373
368 3300031711 Ga0265314_10014222 Ga0265314_100142224 373
369 3300031711 Ga0265314_10062200 Ga0265314_100622003 373
370 3300031731 Ga0307405_10048790 Ga0307405_100487902 373
371 3300031824 Ga0307413_10012898 Ga0307413_100128982 373
372 3300031852 Ga0307410_10004658 Ga0307410_100046585 373
373 3300031852 Ga0307410_10132213 Ga0307410_101322132 373
374 3300031901 Ga0307406_10003443 Ga0307406_100034435 373
375 3300031995 Ga0307409_100004132 Ga0307409_1000041327 373
376 3300032002 Ga0307416_100026028 Ga0307416_1000260285 373
377 3300032002 Ga0307416_100082874 Ga0307416_1000828742 373
378 3300032005 Ga0307411_10045368 Ga0307411_100453682 373
379 3300035086 Ga0373934_0012475 Ga0373934_0012475_655_1776 373
380 3300035113 Ga0373936_0093920 Ga0373936_0093920_19_1140 373
381 3300035116 Ga0373945_0009789 Ga0373945_0009789_1360_2484 373
382 3300035116 Ga0373945_0012515 Ga0373945_0012515_1360_2484 373
383 3300035119 Ga0373956_0082597 Ga0373956_0082597_320_1441 373
384 3300035170 Ga0373943_0029545 Ga0373943_0029545_1392_2513 373
385 3300035410 Ga0373924_0023620 Ga0373924_0023620_1183_2304 373
386 3300035692 Ga0373935_0013430 Ga0373935_0013430_950_2074 373
387 3300035692 Ga0373935_0151450 Ga0373935_0151450_342_1463 373
388 3300035725 Ga0373947_0088331 Ga0373947_0088331_310_1431 373
389 3300036401 Ga0373937_0029155 Ga0373937_0029155_2866_3987 373
390 3300037068 Ga0373925_0003038 Ga0373925_0003038_8733_9857 373
391 3300042436 Ga0439435_0005481 Ga0439435_0005481_1204_2328 373
392 3300045976 Ga0466967_0283988 Ga0466967_0283988_372_1496 373
393 3300046459 Ga0495629_0085276 Ga0495629_0085276_809_1930 373
394 3300046473 Ga0495582_0059902 Ga0495582_0059902_222_1346 373
395 3300046476 Ga0495662_0069018 Ga0495662_0069018_180_1304 373
396 3300046499 Ga0495594_0155658 Ga0495594_0155658_126_1247 373
397 3300046511 Ga0495608_0016159 Ga0495608_0016159_1836_2960 373
398 3300046517 Ga0495630_0011908 Ga0495630_0011908_4549_5673 373
399 3300046529 Ga0495652_0016588 Ga0495652_0016588_231_1355 373
400 3300046543 Ga0495645_0037167 Ga0495645_0037167_1142_2266 373
401 3300046642 Ga0495634_0128133 Ga0495634_0128133_76_1200 373
402 3300046689 Ga0495613_0000270 Ga0495613_0000270_36182_37306 373
403 3300047317 Ga0495604_0010810 Ga0495604_0010810_6056_7180 373
404 3300047319 Ga0495674_0004142 Ga0495674_0004142_10702_11826 373
405 3300047319 Ga0495674_0188884 Ga0495674_0188884_472_1593 373
406 3300047471 Ga0495684_0000011 Ga0495684_0000011_103556_104680 373
407 3300048907 Ga0496104_0286344 Ga0496104_0286344_255_1376 373
408 3300048907 Ga0496104_0398374 Ga0496104_0398374_117_1238 373
409 3300048910 Ga0496107_0290062 Ga0496107_0290062_15_1136 373
410 3300048911 Ga0496108_0051540 Ga0496108_0051540_2134_3255 373
411 3300048911 Ga0496108_0076481 Ga0496108_0076481_1259_2380 373
412 3300048916 Ga0496113_0109829 Ga0496113_0109829_798_1919 373
413 3300048917 Ga0496114_0088590 Ga0496114_0088590_1221_2342 373
414 3300048917 Ga0496114_0284535 Ga0496114_0284535_106_1230 373
415 3300049572 Ga0501036_0175907 Ga0501036_0175907_184_1305 373
416 3300049578 Ga0501042_0010100 Ga0501042_0010100_1967_3088 373
417 3300049578 Ga0501042_0150126 Ga0501042_0150126_386_1510 373
418 3300049580 Ga0501046_0057811 Ga0501046_0057811_1264_2385 373
419 3300049581 Ga0501047_0064780 Ga0501047_0064780_1406_2527 373
420 3300049588 Ga0501072_0079596 Ga0501072_0079596_437_1561 373
421 3300049589 Ga0501073_0002679 Ga0501073_0002679_10998_12122 373
422 3300049591 Ga0501075_0129667 Ga0501075_0129667_170_1294 373
423 3300049593 Ga0501077_0160811 Ga0501077_0160811_223_1344 373
424 3300049741 Ga0501079_0075165 Ga0501079_0075165_240_1361 373
425 3300049741 Ga0501079_0094540 Ga0501079_0094540_430_1554 373
426 3300049824 Ga0501045_0080247 Ga0501045_0080247_269_1390 373
427 3300050507 nmdc:mga05p37_49197_c1 nmdc:mga05p37_49197_c1_1985_3115 373
428 3300050508 nmdc:mga09592_11229_c1 nmdc:mga09592_11229_c1_4100_5221 373
429 3300050509 nmdc:mga0qj67_2070_c1 nmdc:mga0qj67_2070_c1_8666_9787 373
430 3300050510 nmdc:mga06r32_3246_c1 nmdc:mga06r32_3246_c1_872_1993 373
431 3300050511 nmdc:mga08y16_8286_c1 nmdc:mga08y16_8286_c1_4977_6098 373
432 3300050511 nmdc:mga08y16_86164_c1 nmdc:mga08y16_86164_c1_156_1280 373
433 3300050515 nmdc:mga0a205_432220_c1 nmdc:mga0a205_432220_c1_42_1163 373
434 3300053077 Ga0495601_0010849 Ga0495601_0010849_2062_3183 373
435 3300053077 Ga0495601_0013734 Ga0495601_0013734_488_1612 373
436 3300053077 Ga0495601_0035949 Ga0495601_0035949_1515_2639 373
437 3300053085 Ga0495619_0002253 Ga0495619_0002253_2252_3376 373
438 3300053085 Ga0495619_0012337 Ga0495619_0012337_1097_2218 373
439 3300054114 Ga0501084_0024503 Ga0501084_0024503_46_1167 373
440 3300059421 Ga0590071_000006 Ga0590071_000006_38836_39957 373
441 3300059424 Ga0590075_000335 Ga0590075_000335_3418_4539 373
442 3300059426 Ga0590077_000034 Ga0590077_000034_29389_30510 373
443 3300061734 Ga0530510_0154460 Ga0530510_0154460_511_1632 373
444 3300003203 JGI25406J46586_10006003 JGI25406J46586_100060034 374
445 3300003203 JGI25406J46586_10006091 JGI25406J46586_100060914 374
446 3300005293 Ga0065715_10102934 Ga0065715_101029342 374
447 3300005330 Ga0070690_100036898 Ga0070690_1000368982 374
448 3300005331 Ga0070670_100000629 Ga0070670_1000006294 374
449 3300005343 Ga0070687_100105059 Ga0070687_1001050592 374
450 3300005353 Ga0070669_100136203 Ga0070669_1001362032 374
451 3300005356 Ga0070674_100003553 Ga0070674_1000035533 374
452 3300005364 Ga0070673_100001036 Ga0070673_1000010365 374
453 3300005365 Ga0070688_100026455 Ga0070688_1000264553 374
454 3300005457 Ga0070662_100068804 Ga0070662_1000688042 374
455 3300005471 Ga0070698_100128478 Ga0070698_1001284782 374
456 3300005543 Ga0070672_100025815 Ga0070672_1000258154 374
457 3300005618 Ga0068864_100029016 Ga0068864_1000290164 374
458 3300005985 Ga0081539_10000012 Ga0081539_100000126 374
459 3300005985 Ga0081539_10000291 Ga0081539_1000029114 374
460 3300005985 Ga0081539_10003521 Ga0081539_100035214 374
461 3300006846 Ga0075430_100128389 Ga0075430_1001283892 374
462 3300006880 Ga0075429_100093575 Ga0075429_1000935752 374
463 3300009094 Ga0111539_10001647 Ga0111539_1000164723 374
464 3300009094 Ga0111539_10007980 Ga0111539_100079808 374
465 3300009147 Ga0114129_10560124 Ga0114129_105601242 374
466 3300009553 Ga0105249_10352524 Ga0105249_103525242 374
467 3300014325 Ga0163163_10066895 Ga0163163_100668953 374
468 3300025918 Ga0207662_10036541 Ga0207662_100365412 374
469 3300025925 Ga0207650_10093840 Ga0207650_100938402 374
470 3300025933 Ga0207706_10116616 Ga0207706_101166162 374
471 3300025936 Ga0207670_10028608 Ga0207670_100286083 374
472 3300025937 Ga0207669_10015282 Ga0207669_100152824 374
473 3300025940 Ga0207691_10029953 Ga0207691_100299534 374
474 3300025940 Ga0207691_10149979 Ga0207691_101499792 374
475 3300025942 Ga0207689_10220029 Ga0207689_102200292 374
476 3300025960 Ga0207651_10010774 Ga0207651_100107743 374
477 3300026089 Ga0207648_10085002 Ga0207648_100850023 374
478 3300026095 Ga0207676_10071582 Ga0207676_100715823 374
479 3300027907 Ga0207428_10000319 Ga0207428_1000031939 374
480 3300027907 Ga0207428_10021167 Ga0207428_100211672 374
481 3300027907 Ga0207428_10051677 Ga0207428_100516772 374
482 3300031852 Ga0307410_10085150 Ga0307410_100851501 374
483 3300031903 Ga0307407_10000594 Ga0307407_100005944 374
484 3300031903 Ga0307407_10115084 Ga0307407_101150842 374
485 3300031911 Ga0307412_10023355 Ga0307412_100233553 374
486 3300031911 Ga0307412_10161075 Ga0307412_101610751 374
487 3300032002 Ga0307416_100001749 Ga0307416_1000017497 374
488 3300032002 Ga0307416_100010946 Ga0307416_1000109464 374
489 3300032005 Ga0307411_10004812 Ga0307411_100048124 374
490 3300032005 Ga0307411_10048334 Ga0307411_100483342 374
491 3300032005 Ga0307411_10232701 Ga0307411_102327012 374
492 3300032126 Ga0307415_100000792 Ga0307415_1000007928 374
493 3300042008 Ga0439450_021371 Ga0439450_021371_88_1212 374
494 3300042436 Ga0439435_0000707 Ga0439435_0000707_667_1791 374
495 3300046537 Ga0495598_0016800 Ga0495598_0016800_347_1471 374
496 3300046539 Ga0495621_0010567 Ga0495621_0010567_827_1951 374
497 3300048904 Ga0496101_0153451 Ga0496101_0153451_190_1332 374
498 3300049570 Ga0501033_0122526 Ga0501033_0122526_375_1502 374
499 3300049572 Ga0501036_0010626 Ga0501036_0010626_4513_5640 374
500 3300049574 Ga0501038_0019145 Ga0501038_0019145_2412_3539 374
501 3300049576 Ga0501040_0000719 Ga0501040_0000719_6024_7151 374
502 3300049577 Ga0501041_0055648 Ga0501041_0055648_759_1886 374
503 3300049578 Ga0501042_0006212 Ga0501042_0006212_1358_2485 374
504 3300049580 Ga0501046_0002475 Ga0501046_0002475_12070_13197 374
505 3300049584 Ga0501068_0042903 Ga0501068_0042903_1078_2205 374
506 3300049587 Ga0501071_0007286 Ga0501071_0007286_4075_5202 374
507 3300049588 Ga0501072_0025698 Ga0501072_0025698_2405_3532 374
508 3300049591 Ga0501075_0000043 Ga0501075_0000043_21101_22228 374
509 3300049593 Ga0501077_0007615 Ga0501077_0007615_5230_6357 374
510 3300049741 Ga0501079_0001578 Ga0501079_0001578_5831_6958 374
511 3300049743 Ga0501081_0002138 Ga0501081_0002138_3052_4179 374
512 3300049822 Ga0501035_0084172 Ga0501035_0084172_810_1937 374
513 3300049824 Ga0501045_0016266 Ga0501045_0016266_1171_2298 374
514 3300050509 nmdc:mga0qj67_21426_c1 nmdc:mga0qj67_21426_c1_1407_2531 374
515 3300050509 nmdc:mga0qj67_81320_c1 nmdc:mga0qj67_81320_c1_790_1914 374
516 3300050510 nmdc:mga06r32_72230_c1 nmdc:mga06r32_72230_c1_606_1730 374
517 3300050511 nmdc:mga08y16_1387_c1 nmdc:mga08y16_1387_c1_3313_4437 374
518 3300050511 nmdc:mga08y16_13945_c1 nmdc:mga08y16_13945_c1_5077_6201 374
519 3300054114 Ga0501084_0010055 Ga0501084_0010055_3673_4800 374
520 3300060353 Ga0501082_0045164 Ga0501082_0045164_762_1889 374
521 3300061734 Ga0530510_0094501 Ga0530510_0094501_668_1795 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

63

206

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7u-assembly1.cif.gz_A 2.3 a structure of putative catechol degradative operon regulator from rhodococcus sp. rha1 0.7797 283 349
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.7656 5 365
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.74 5 365
1omi-assembly3.cif.gz_A crystal structure of prfa,the transcriptional regulator in listeria monocytogenes 0.7357 325 365
6ob1-assembly1.cif.gz_C structure of whb in complex with ubiquitin variant 0.7128 285 349
ID Description Score Start End Superfamily
af_P0A7A7_281_425_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8932 70 203 3.40.50.620
af_P9WI59_103_242_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.874 72 203 3.40.50.620
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8657 71 197 3.40.50.620
af_Q9HCL2_203_355_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8594 71 203 3.40.50.620
af_Q9Y137_236_387_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8568 71 203 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6A7L7D4-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.961 1 368 GO:0008374
GO:0012505
AF-A0A2E6ZYN2-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.959 3 374 GO:0008374
GO:0012505
AF-A0A2E4FML4-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9572 61 374 GO:0008374
GO:0012505
AF-A0A3N5P707-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9564 3 374 GO:0008374
GO:0012505
AF-A0A2E6ZYN2-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9515 3 374 GO:0008374
GO:0012505

Feature Viewer

pLDDT pTM Quality
86.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map