F458727

General Info

Members Datasets Scaffolds Average Seq Length
521 308 509 261

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0021105|Ga0439465_0021105_61_1047
Length 297
Sequence MAKKTSSVKPAKKKGKASAPVVFDAPQKPPLKPDGGNIFTGIGGWTFEPWRGVFYPDGLPHNKELEYAAAHLTSIEINGTFYRTQTPATFHKWASEVPNGFKFSVKGVRYVTNRSVLAEAGDSIKRFIDSGVLELGDRLGPLLWQMNPYKKFDEADFGKFLELLPPKVGDQTIRHVVEVRHDSFKTPAFIALLRQFNVGIVYSEHDTYTEIADVTSDFVYARLQKGDDSLATGYPPKALDAWSERLKVWADGGQPDDLPRVDKTDAPKKPRDVFAYVIHEGKVRAPAAAMELIRRQG

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2821131069 Duganella sp. 1224 Isolate Unclassified
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857553236 Duganella sp. R-74557 Isolate Unclassified
6 2857558681 Duganella sp. R-74565 Isolate Unclassified
7 2857564685 Duganella sp. R-74599 Isolate Unclassified
8 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
9 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
10 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
11 2904424332 Duganella sp. 1411 Isolate Rhizosphere
12 2919476304 Duganella sp. 3397 Isolate Unclassified
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
176 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
286 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0.38
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.04
Nodule 0.38
Rhizoplane 5.76
Rhizosphere 70.06
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023351 3300001989 Bacteria 2187
2 JGI24735J21928_10004814 3300002067 Bacteria 4505
3 JGI25154J39366_1000950 3300002738 Bacteria 12003
4 JGI25150J39212_1001896 3300002774 Bacteria 5488
5 JGI25150J39212_1008395 3300002774 Bacteria 2023
6 JGI25159J45721_1005133 3300002987 Bacteria 4156
7 JGI25151J46595_10058463 3300003187 Bacteria 1248
8 JGI25153J46596_10004738 3300003215 Bacteria 7247
9 JGI25153J46596_10012733 3300003215 Bacteria 3604
10 rootL2_10008003 3300003322 Bacteria 3999
11 JGI25161J50226_1002163 3300003374 Bacteria 5251
12 Ga0055529_1000185 3300003763 Bacteria 85584
13 Ga0055529_1000208 3300003763 Bacteria 77951
14 Ga0055526_1000077 3300003771 Bacteria 92111
15 Ga0055526_1000094 3300003771 Bacteria 80954
16 Ga0055526_1000520 3300003771 Bacteria 30566
17 Ga0055526_1002339 3300003771 Bacteria 12884
18 Ga0055526_1008933 3300003771 Bacteria 4911
19 Ga0055537_1000072 3300003773 Bacteria 73276
20 Ga0055537_1003085 3300003773 Bacteria 5241
21 Ga0055537_1007247 3300003773 Bacteria 2697
22 Ga0055524_1006612 3300003775 Bacteria 5014
23 Ga0055534_1000136 3300003784 Bacteria 55242
24 Ga0055534_1002853 3300003784 Bacteria 5751
25 Ga0055534_1004569 3300003784 Bacteria 3961
26 Ga0055528_1000025 3300003790 Bacteria 130730
27 Ga0055528_1014804 3300003790 Bacteria 2860
28 Ga0055530_10004993 3300003791 Bacteria 6550
29 Ga0055530_10006345 3300003791 Bacteria 5308
30 Ga0055530_10007919 3300003791 Bacteria 4358
31 Ga0055531_10001881 3300003794 Bacteria 14703
32 Ga0055531_10035924 3300003794 Bacteria 1540
33 Ga0055543_1002960 3300004625 Bacteria 5289
34 Ga0065165_1007580 3300005262 Bacteria 5289
35 Ga0070658_10115505 3300005327 Bacteria 2227
36 Ga0070676_10202610 3300005328 Bacteria 1301
37 Ga0070683_100341906 3300005329 Bacteria 1425
38 Ga0070689_100185066 3300005340 Bacteria 1693
39 Ga0070688_100118359 3300005365 Bacteria 1771
40 Ga0070667_100342851 3300005367 Bacteria 1352
41 Ga0070714_100149349 3300005435 Bacteria 2104
42 Ga0070713_100080136 3300005436 Bacteria 2783
43 Ga0070713_100087020 3300005436 Bacteria 2680
44 Ga0070710_10028780 3300005437 Bacteria 2975
45 Ga0070708_100259762 3300005445 Bacteria 1633
46 Ga0070663_100113642 3300005455 Bacteria 2038
47 Ga0068867_100231836 3300005459 Bacteria 1493
48 Ga0070685_10127856 3300005466 Bacteria 1585
49 Ga0070706_100075971 3300005467 Bacteria 3109
50 Ga0070679_100040224 3300005530 Bacteria 4651
51 Ga0070679_100169266 3300005530 Bacteria 2158
52 Ga0070684_100278496 3300005535 Bacteria 1532
53 Ga0070697_100096736 3300005536 Bacteria 2450
54 Ga0070686_100273528 3300005544 Bacteria 1243
55 Ga0070665_100138295 3300005548 Bacteria 2439
56 Ga0070665_100406801 3300005548 Bacteria 1369
57 Ga0068855_100020137 3300005563 Bacteria 8011
58 Ga0068857_100711295 3300005577 Bacteria 955
59 Ga0068856_100014461 3300005614 Bacteria 7624
60 Ga0068856_100074638 3300005614 Bacteria 3358
61 Ga0068852_100076686 3300005616 Bacteria 2952
62 Ga0081455_10000678 3300005937 Bacteria 44138
63 Ga0081538_10022183 3300005981 Bacteria 4608
64 Ga0081540_1000084 3300005983 Bacteria 100067
65 Ga0070717_10043803 3300006028 Bacteria 3653
66 Ga0070717_10058354 3300006028 Bacteria 3191
67 Ga0070717_10507154 3300006028 Bacteria 1091
68 Ga0070717_10605889 3300006028 Bacteria 994
69 Ga0075365_10172157 3300006038 Bacteria 1511
70 Ga0075364_10331155 3300006051 Bacteria 1037
71 Ga0070712_100290765 3300006175 Bacteria 1319
72 Ga0075367_10016320 3300006178 Bacteria 4055
73 Ga0075367_10021615 3300006178 Bacteria 3598
74 Ga0075367_10027960 3300006178 Bacteria 3212
75 Ga0075367_10089787 3300006178 Bacteria 1868
76 Ga0075367_10174933 3300006178 Bacteria 1338
77 Ga0097621_100263379 3300006237 Bacteria 1513
78 Ga0075370_10031635 3300006353 Bacteria 2954
79 Ga0075428_100117169 3300006844 Bacteria 2901
80 Ga0075430_100176793 3300006846 Bacteria 1776
81 Ga0075430_100258972 3300006846 Bacteria 1441
82 Ga0075431_100002052 3300006847 Bacteria 19241
83 Ga0075431_100140177 3300006847 Bacteria 2492
84 Ga0075431_100244644 3300006847 Bacteria 1824
85 Ga0075434_100077071 3300006871 Bacteria 3328
86 Ga0075436_100036277 3300006914 Bacteria 3403
87 Ga0075436_100081074 3300006914 Bacteria 2249
88 Ga0079104_1007431 3300006946 Bacteria 3976
89 Ga0099795_10002958 3300007788 Bacteria 4121
90 Ga0099795_10057158 3300007788 Unclassified 1437
91 Ga0099795_10201621 3300007788 Bacteria 839
92 Ga0105251_10000899 3300009011 Bacteria 26656
93 Ga0105244_10004717 3300009036 Bacteria 9276
94 Ga0105240_10205763 3300009093 Bacteria 2304
95 Ga0105245_10024271 3300009098 Bacteria 5324
96 Ga0105247_10504888 3300009101 Bacteria 882
97 Ga0105243_10451603 3300009148 Bacteria 1206
98 Ga0105248_10370749 3300009177 Bacteria 1612
99 Ga0105237_10294087 3300009545 Bacteria 1627
100 Ga0105238_10065743 3300009551 Bacteria 3628
101 Ga0105249_10000037 3300009553 Bacteria 197428
102 Ga0099796_10027047 3300010159 Bacteria 1828
103 Ga0105246_10128565 3300011119 Bacteria 1889
104 Ga0157374_10388131 3300013296 Bacteria 1392
105 Ga0157374_10598752 3300013296 Bacteria 1112
106 Ga0157375_10421267 3300013308 Bacteria 1501
107 Ga0163163_10137627 3300014325 Bacteria 2483
108 Ga0157380_10301336 3300014326 Bacteria 1476
109 Ga0182008_10039260 3300014497 Bacteria 2366
110 Ga0182008_10168834 3300014497 Bacteria 1104
111 Ga0157377_10169136 3300014745 Bacteria 1366
112 Ga0182006_1000163 3300015261 Bacteria 70369
113 Ga0182007_10050117 3300015262 Bacteria 1379
114 Ga0182005_1000020 3300015265 Bacteria 278671
115 Ga0213872_10000002 3300021361 Bacteria 554092
116 Ga0213872_10011548 3300021361 Bacteria 4176
117 Ga0213872_10029828 3300021361 Bacteria 2501
118 Ga0228598_1009140 3300024227 Bacteria 1990
119 Ga0209436_102686 3300025208 Bacteria 5148
120 Ga0209437_109774 3300025233 Bacteria 1484
121 Ga0207425_1000001 3300025245 Bacteria 2525432
122 Ga0207425_1000322 3300025245 Bacteria 34215
123 Ga0207425_1000981 3300025245 Bacteria 13434
124 Ga0207425_1042888 3300025245 Bacteria 854
125 Ga0209646_1000028 3300025246 Bacteria 387986
126 Ga0209129_1000001 3300025258 Bacteria 1452436
127 Ga0209129_1003009 3300025258 Bacteria 7678
128 Ga0209565_1000009 3300025263 Bacteria 751701
129 Ga0209565_1000705 3300025263 Bacteria 20479
130 Ga0209565_1003734 3300025263 Bacteria 4821
131 Ga0209565_1004134 3300025263 Bacteria 4512
132 Ga0209565_1004591 3300025263 Bacteria 4166
133 Ga0209455_1000049 3300025272 Bacteria 374414
134 Ga0209673_1000036 3300025273 Bacteria 323162
135 Ga0209673_1007584 3300025273 Bacteria 4965
136 Ga0209130_1002813 3300025284 Bacteria 8112
137 Ga0209130_1003044 3300025284 Bacteria 7560
138 Ga0209130_1009611 3300025284 Bacteria 2737
139 Ga0209675_1000013 3300025291 Bacteria 448220
140 Ga0209675_1001114 3300025291 Bacteria 16367
141 Ga0209675_1007283 3300025291 Bacteria 4277
142 Ga0209025_1022619 3300025294 Bacteria 3325
143 Ga0209564_1000009 3300025295 Bacteria 950196
144 Ga0209564_1000045 3300025295 Bacteria 376549
145 Ga0209564_1000175 3300025295 Bacteria 153109
146 Ga0209564_1000515 3300025295 Bacteria 63379
147 Ga0209564_1011920 3300025295 Bacteria 3843
148 Ga0209564_1016282 3300025295 Bacteria 2971
149 Ga0209758_1000230 3300025297 Bacteria 119426
150 Ga0209758_1000945 3300025297 Bacteria 39123
151 Ga0209050_1000905 3300025298 Bacteria 39208
152 Ga0209050_1001360 3300025298 Bacteria 26768
153 Ga0209050_1009217 3300025298 Bacteria 5094
154 Ga0209256_1000358 3300025299 Bacteria 74650
155 Ga0209256_1005592 3300025299 Bacteria 7144
156 Ga0209256_1007674 3300025299 Bacteria 5241
157 Ga0207426_1009720 3300025302 Bacteria 3782
158 Ga0209257_1000486 3300025304 Bacteria 71627
159 Ga0209257_1001672 3300025304 Bacteria 25066
160 Ga0209257_1015007 3300025304 Bacteria 3267
161 Ga0207655_1011076 3300025728 Bacteria 5405
162 Ga0207655_1016634 3300025728 Bacteria 4011
163 Ga0207713_1001961 3300025735 Bacteria 15545
164 Ga0207692_10049592 3300025898 Bacteria 2119
165 Ga0207647_10023460 3300025904 Bacteria 4079
166 Ga0207645_10136147 3300025907 Bacteria 1600
167 Ga0207684_10024696 3300025910 Bacteria 5124
168 Ga0207671_10102883 3300025914 Bacteria 2165
169 Ga0207671_10189865 3300025914 Bacteria 1602
170 Ga0207693_10039338 3300025915 Bacteria 3724
171 Ga0207663_10053614 3300025916 Bacteria 2520
172 Ga0207662_10011174 3300025918 Bacteria 4970
173 Ga0207652_10236352 3300025921 Bacteria 1647
174 Ga0207694_10019213 3300025924 Bacteria 5165
175 Ga0207694_10103091 3300025924 Bacteria 2262
176 Ga0207650_10001142 3300025925 Bacteria 19506
177 Ga0207700_10009393 3300025928 Bacteria 6105
178 Ga0207700_10161768 3300025928 Bacteria 1860
179 Ga0207700_10184518 3300025928 Bacteria 1749
180 Ga0207664_10113754 3300025929 Bacteria 2254
181 Ga0207644_10061297 3300025931 Bacteria 2724
182 Ga0207670_10299737 3300025936 Bacteria 1258
183 Ga0207667_10044449 3300025949 Bacteria 4706
184 Ga0207712_10000035 3300025961 Bacteria 201152
185 Ga0207658_10180251 3300025986 Bacteria 1748
186 Ga0207678_10077048 3300026067 Bacteria 2856
187 Ga0207678_10206018 3300026067 Bacteria 1682
188 Ga0207702_10011886 3300026078 Bacteria 7247
189 Ga0207702_10193183 3300026078 Bacteria 1882
190 Ga0207648_10165661 3300026089 Bacteria 1953
191 Ga0207683_10204240 3300026121 Bacteria 1797
192 Ga0207698_10187757 3300026142 Bacteria 1837
193 Ga0209281_1009446 3300027111 Bacteria 2293
194 Ga0209179_1037423 3300027512 Unclassified 1013
195 Ga0268266_10088207 3300028379 Bacteria 2715
196 Ga0307515_10284198 3300028794 Bacteria 1358
197 Ga0265338_10159538 3300028800 Bacteria 1743
198 Ga0265762_1022154 3300030760 Bacteria 1174
199 Ga0265760_10041482 3300031090 Bacteria 1372
200 Ga0265328_10001954 3300031239 Bacteria 9370
201 Ga0265325_10021502 3300031241 Bacteria 3543
202 Ga0265340_10001229 3300031247 Bacteria 14674
203 Ga0265316_10045462 3300031344 Bacteria 3484
204 Ga0307408_100000182 3300031548 Bacteria 69692
205 Ga0307408_100018197 3300031548 Bacteria 4715
206 Ga0307408_100022926 3300031548 Bacteria 4248
207 Ga0307408_100072773 3300031548 Bacteria 2545
208 Ga0265313_10000041 3300031595 Bacteria 119119
209 Ga0265313_10000712 3300031595 Bacteria 34316
210 Ga0265313_10012923 3300031595 Bacteria 5061
211 Ga0265314_10168522 3300031711 Bacteria 1325
212 Ga0307413_10129592 3300031824 Bacteria 1724
213 Ga0307413_10263531 3300031824 Bacteria 1286
214 Ga0373929_0026892 3300035085 Bacteria 1205
215 Ga0373936_0007469 3300035113 Bacteria 4111
216 Ga0373939_0019460 3300035114 Bacteria 1832
217 Ga0373943_0096282 3300035170 Bacteria 1541
218 Ga0373943_0311422 3300035170 Bacteria 896
219 Ga0373946_0107763 3300035171 Bacteria 1257
220 Ga0373955_0080407 3300035172 Bacteria 1841
221 Ga0373961_0007681 3300035241 Bacteria 2613
222 Ga0373931_0071732 3300035691 Bacteria 1893
223 Ga0373935_0352193 3300035692 Bacteria 1050
224 Ga0373927_0213051 3300035695 Bacteria 1269
225 Ga0373947_0127040 3300035725 Bacteria 1625
226 Ga0373925_0067023 3300037068 Bacteria 2707
227 Ga0395899_0081389 3300037312 Bacteria 2356
228 Ga0395900_0030158 3300037418 Bacteria 5567
229 Ga0395898_0049455 3300037466 Bacteria 4119
230 Ga0395905_0000594 3300037471 Bacteria 48383
231 Ga0436364_0678334 3300037853 Bacteria 2295
232 Ga0436364_1398223 3300037853 Bacteria 1556
233 Ga0395901_0006448 3300038443 Bacteria 11889
234 Ga0436365_0208033 3300039437 Bacteria 5930
235 Ga0436365_0299394 3300039437 Bacteria 973
236 Ga0436361_0012604 3300039447 Bacteria 4032
237 Ga0436361_0084554 3300039447 Bacteria 3481
238 Ga0436361_0570400 3300039447 Bacteria 111725
239 Ga0436361_0815718 3300039447 Bacteria 1859
240 Ga0436361_1210581 3300039447 Bacteria 3772
241 Ga0436362_0512396 3300039453 Bacteria 1266
242 Ga0439465_0021105 3300041413 Bacteria 2042
243 Ga0439445_0004920 3300042004 Bacteria 3034
244 Ga0450909_011505 3300042185 Bacteria 1296
245 Ga0450893_0022753 3300042532 Bacteria 1087
246 Ga0466972_0034160 3300044658 Bacteria 2493
247 Ga0453683_0000921 3300044673 Bacteria 28022
248 Ga0466963_0271432 3300044694 Bacteria 1191
249 Ga0466957_0192372 3300044842 Bacteria 1337
250 Ga0451576_0032096 3300045051 Bacteria 5597
251 Ga0466967_0056663 3300045976 Bacteria 3456
252 Ga0495617_000006 3300046452 Bacteria 398279
253 Ga0495617_002718 3300046452 Bacteria 6840
254 Ga0495617_030614 3300046452 Bacteria 1808
255 Ga0495617_049177 3300046452 Bacteria 1403
256 Ga0495627_000005 3300046453 Bacteria 630805
257 Ga0495590_0000003 3300046457 Bacteria 478593
258 Ga0495590_0000404 3300046457 Bacteria 21797
259 Ga0495590_0035141 3300046457 Bacteria 1750
260 Ga0495629_0217625 3300046459 Bacteria 1318
261 Ga0495638_0000118 3300046460 Bacteria 127657
262 Ga0495638_0258842 3300046460 Bacteria 955
263 Ga0495653_0000011 3300046463 Bacteria 272314
264 Ga0495650_0000544 3300046471 Bacteria 53879
265 Ga0495650_0003578 3300046471 Bacteria 11233
266 Ga0495639_0011931 3300046475 Bacteria 3747
267 Ga0495584_0001518 3300046491 Bacteria 13788
268 Ga0495584_0092159 3300046491 Bacteria 1528
269 Ga0495585_0012077 3300046492 Bacteria 5095
270 Ga0495585_0105467 3300046492 Bacteria 1503
271 Ga0495585_0117668 3300046492 Bacteria 1408
272 Ga0495607_0018826 3300046501 Bacteria 4392
273 Ga0495607_0102152 3300046501 Bacteria 1534
274 Ga0495607_0126791 3300046501 Bacteria 1333
275 Ga0495607_0127798 3300046501 Bacteria 1326
276 Ga0495583_0000079 3300046506 Bacteria 169681
277 Ga0495583_0000413 3300046506 Bacteria 64881
278 Ga0495606_0000284 3300046507 Bacteria 88119
279 Ga0495606_0000778 3300046507 Bacteria 48896
280 Ga0495606_0001400 3300046507 Bacteria 32506
281 Ga0495606_0002275 3300046507 Bacteria 22723
282 Ga0495606_0012744 3300046507 Bacteria 6704
283 Ga0495606_0033665 3300046507 Bacteria 3531
284 Ga0495610_0000004 3300046512 Bacteria 1006135
285 Ga0495610_0005896 3300046512 Bacteria 8585
286 Ga0495610_0028847 3300046512 Bacteria 2929
287 Ga0495610_0042770 3300046512 Bacteria 2263
288 Ga0495610_0150079 3300046512 Bacteria 995
289 Ga0495616_0001970 3300046513 Bacteria 13823
290 Ga0495618_0079626 3300046514 Bacteria 2090
291 Ga0495630_0084029 3300046517 Bacteria 2404
292 Ga0495630_0108295 3300046517 Bacteria 2105
293 Ga0495637_0002176 3300046520 Bacteria 10961
294 Ga0495637_0003764 3300046520 Bacteria 8004
295 Ga0495643_0000505 3300046522 Bacteria 48848
296 Ga0495643_0000641 3300046522 Bacteria 41474
297 Ga0495644_0000141 3300046523 Bacteria 34630
298 Ga0495644_0011297 3300046523 Bacteria 3439
299 Ga0495648_0000070 3300046524 Bacteria 136680
300 Ga0495648_0003290 3300046524 Bacteria 14275
301 Ga0495648_0012949 3300046524 Bacteria 6194
302 Ga0495648_0029021 3300046524 Bacteria 3677
303 Ga0495648_0048381 3300046524 Bacteria 2618
304 Ga0495654_0000035 3300046530 Bacteria 192768
305 Ga0495640_0067039 3300046533 Bacteria 2419
306 Ga0495609_0001785 3300046538 Bacteria 13807
307 Ga0495609_0003784 3300046538 Bacteria 8521
308 Ga0495609_0019759 3300046538 Bacteria 3114
309 Ga0495609_0020944 3300046538 Bacteria 3017
310 Ga0495597_0000206 3300046542 Bacteria 53783
311 Ga0495597_0000583 3300046542 Bacteria 30220
312 Ga0495597_0010332 3300046542 Bacteria 4569
313 Ga0495645_0207820 3300046543 Bacteria 1324
314 Ga0495622_0000004 3300046557 Bacteria 258984
315 Ga0495622_0000439 3300046557 Bacteria 26982
316 Ga0495622_0061574 3300046557 Bacteria 1737
317 Ga0495633_0000543 3300046558 Bacteria 37615
318 Ga0495633_0015820 3300046558 Bacteria 3906
319 Ga0495633_0027592 3300046558 Bacteria 2774
320 Ga0495633_0034793 3300046558 Bacteria 2421
321 Ga0495633_0042989 3300046558 Bacteria 2144
322 Ga0495668_0000168 3300046616 Bacteria 97230
323 Ga0495668_0007896 3300046616 Bacteria 6721
324 Ga0495634_0002372 3300046642 Bacteria 15688
325 Ga0495611_0006061 3300046648 Bacteria 5157
326 Ga0495611_0028761 3300046648 Bacteria 2435
327 Ga0495611_0039767 3300046648 Bacteria 2094
328 Ga0495625_0000038 3300046660 Bacteria 211808
329 Ga0495625_0009791 3300046660 Bacteria 7975
330 Ga0495625_0025154 3300046660 Bacteria 4518
331 Ga0495625_0025729 3300046660 Bacteria 4458
332 Ga0495635_0169165 3300046663 Bacteria 1487
333 Ga0495635_0349585 3300046663 Bacteria 986
334 Ga0495659_0002213 3300046664 Bacteria 6331
335 Ga0495661_0075199 3300046665 Bacteria 1963
336 Ga0495658_0164715 3300046683 Bacteria 1369
337 Ga0495671_0000001 3300046692 Bacteria 1169494
338 Ga0495671_0014283 3300046692 Bacteria 4278
339 Ga0495671_0165088 3300046692 Bacteria 1077
340 Ga0495649_0004418 3300046694 Bacteria 9191
341 Ga0495660_0010430 3300046810 Bacteria 5404
342 Ga0495660_0010898 3300046810 Bacteria 5281
343 Ga0495660_0017490 3300046810 Bacteria 4126
344 Ga0495581_0181911 3300047315 Bacteria 1229
345 Ga0495636_0001371 3300047318 Bacteria 9211
346 Ga0495672_0000580 3300047320 Bacteria 41398
347 Ga0495672_0006776 3300047320 Bacteria 8779
348 Ga0495672_0157027 3300047320 Bacteria 1173
349 Ga0495683_0003137 3300047323 Bacteria 9675
350 Ga0495683_0130731 3300047323 Bacteria 1184
351 Ga0495687_000235 3300047443 Bacteria 76976
352 Ga0495687_001054 3300047443 Bacteria 27272
353 Ga0495677_0040662 3300047445 Bacteria 1700
354 Ga0495677_0053948 3300047445 Bacteria 1482
355 Ga0495677_0059228 3300047445 Bacteria 1418
356 Ga0495685_000124 3300047447 Bacteria 26703
357 Ga0495685_032572 3300047447 Bacteria 1791
358 Ga0495673_0000006 3300047469 Bacteria 908691
359 Ga0495673_0000014 3300047469 Bacteria 599202
360 Ga0495673_0004861 3300047469 Bacteria 8304
361 Ga0495673_0044180 3300047469 Bacteria 1989
362 Ga0495681_0011112 3300047470 Bacteria 5396
363 Ga0495684_0007145 3300047471 Bacteria 8665
364 Ga0495686_0000225 3300047472 Bacteria 104121
365 Ga0495626_0097299 3300048091 Bacteria 1287
366 Ga0496100_0003175 3300048903 Bacteria 8530
367 Ga0496100_0175448 3300048903 Bacteria 1547
368 Ga0496101_0011334 3300048904 Bacteria 5912
369 Ga0496102_0024423 3300048905 Bacteria 5374
370 Ga0496103_0001584 3300048906 Bacteria 14992
371 Ga0496103_0010749 3300048906 Bacteria 5414
372 Ga0496104_0162024 3300048907 Bacteria 2145
373 Ga0496104_0203200 3300048907 Bacteria 1893
374 Ga0496105_0013582 3300048908 Bacteria 6469
375 Ga0496105_0038921 3300048908 Bacteria 3918
376 Ga0496106_0004419 3300048909 Bacteria 10416
377 Ga0496106_0047800 3300048909 Bacteria 3221
378 Ga0496106_0162800 3300048909 Bacteria 1765
379 Ga0496107_0004070 3300048910 Bacteria 9846
380 Ga0496107_0363438 3300048910 Bacteria 1077
381 Ga0496108_0098055 3300048911 Bacteria 2498
382 Ga0496108_0119816 3300048911 Bacteria 2256
383 Ga0496108_0561610 3300048911 Bacteria 995
384 Ga0496109_0122010 3300048912 Bacteria 2428
385 Ga0496109_0356991 3300048912 Bacteria 1381
386 Ga0496110_0004592 3300048913 Bacteria 10727
387 Ga0496110_0082147 3300048913 Bacteria 2873
388 Ga0496111_0002330 3300048914 Bacteria 11440
389 Ga0496111_0012075 3300048914 Bacteria 5840
390 Ga0496111_0446967 3300048914 Bacteria 954
391 Ga0496112_0429502 3300048915 Bacteria 1259
392 Ga0496113_0003040 3300048916 Bacteria 9934
393 Ga0496113_0246690 3300048916 Bacteria 1425
394 Ga0496114_0357938 3300048917 Bacteria 1291
395 Ga0496115_0077196 3300048918 Bacteria 2708
396 Ga0496116_0002803 3300048919 Bacteria 17907
397 Ga0496116_0112840 3300048919 Bacteria 1591
398 Ga0496117_0004917 3300048920 Bacteria 14352
399 Ga0496118_0011800 3300048921 Bacteria 8481
400 Ga0496120_0062985 3300048923 Bacteria 2065
401 Ga0496121_0026163 3300048924 Bacteria 5509
402 Ga0496121_0106374 3300048924 Bacteria 2150
403 Ga0496122_0010350 3300048925 Bacteria 9639
404 Ga0496123_0001851 3300048926 Bacteria 27757
405 Ga0496123_0005622 3300048926 Bacteria 12520
406 Ga0496124_0029688 3300048927 Bacteria 4865
407 Ga0496124_0054969 3300048927 Bacteria 3367
408 Ga0496125_0006825 3300048928 Bacteria 12248
409 Ga0496126_0016990 3300048929 Bacteria 7259
410 Ga0495678_000016 3300049459 Bacteria 303426
411 Ga0495678_000459 3300049459 Bacteria 40493
412 Ga0495678_001634 3300049459 Bacteria 17062
413 Ga0495682_0000233 3300049460 Bacteria 43866
414 Ga0495682_0000357 3300049460 Bacteria 33463
415 Ga0501031_0068465 3300049568 Bacteria 2313
416 Ga0501032_0054250 3300049569 Bacteria 2698
417 Ga0501032_0084420 3300049569 Bacteria 2111
418 Ga0501032_0283834 3300049569 Bacteria 1072
419 Ga0501033_0010717 3300049570 Bacteria 7026
420 Ga0501033_0190894 3300049570 Bacteria 1466
421 Ga0501034_0000032 3300049571 Bacteria 243763
422 Ga0501034_0004997 3300049571 Bacteria 14594
423 Ga0501034_0010486 3300049571 Bacteria 9648
424 Ga0501034_0132590 3300049571 Bacteria 2474
425 Ga0501034_0232628 3300049571 Bacteria 1791
426 Ga0501034_0251510 3300049571 Bacteria 1711
427 Ga0501036_0000609 3300049572 Bacteria 25966
428 Ga0501036_0018572 3300049572 Bacteria 5829
429 Ga0501037_0007475 3300049573 Bacteria 7994
430 Ga0501037_0007550 3300049573 Bacteria 7963
431 Ga0501037_0281813 3300049573 Bacteria 1158
432 Ga0501038_0024084 3300049574 Bacteria 5433
433 Ga0501038_0053657 3300049574 Bacteria 3469
434 Ga0501043_0002387 3300049579 Bacteria 15915
435 Ga0501043_0011113 3300049579 Bacteria 7052
436 Ga0501043_0053814 3300049579 Bacteria 3160
437 Ga0501046_0019105 3300049580 Bacteria 5685
438 Ga0501046_0074015 3300049580 Bacteria 2643
439 Ga0501047_0000228 3300049581 Bacteria 66588
440 Ga0501047_0076291 3300049581 Bacteria 3226
441 Ga0501047_0082985 3300049581 Bacteria 3080
442 Ga0501047_0114817 3300049581 Bacteria 2575
443 Ga0501047_0525586 3300049581 Bacteria 1009
444 Ga0501048_0000467 3300049582 Bacteria 28373
445 Ga0501048_0002713 3300049582 Bacteria 13503
446 Ga0501048_0426513 3300049582 Bacteria 949
447 Ga0501069_0096343 3300049585 Bacteria 1676
448 Ga0501070_0003235 3300049586 Bacteria 14160
449 Ga0501070_0012221 3300049586 Bacteria 7244
450 Ga0501070_0054946 3300049586 Bacteria 3301
451 Ga0501070_0085942 3300049586 Bacteria 2604
452 Ga0501070_0160053 3300049586 Bacteria 1856
453 Ga0501070_0643803 3300049586 Bacteria 842
454 Ga0501071_0266457 3300049587 Bacteria 1294
455 Ga0501072_0022171 3300049588 Bacteria 4927
456 Ga0501073_0045122 3300049589 Bacteria 3105
457 Ga0501073_0142232 3300049589 Bacteria 1662
458 Ga0501074_0005965 3300049590 Bacteria 8789
459 Ga0501074_0247914 3300049590 Bacteria 1266
460 Ga0501077_0129152 3300049593 Bacteria 1602
461 Ga0501222_004602 3300049662 Bacteria 1873
462 Ga0501079_0187878 3300049741 Bacteria 1613
463 Ga0501080_0000112 3300049742 Bacteria 56408
464 Ga0501080_0035703 3300049742 Bacteria 4640
465 Ga0501080_0206742 3300049742 Bacteria 1800
466 Ga0501081_0073391 3300049743 Bacteria 2386
467 Ga0501083_0030548 3300049744 Bacteria 3701
468 Ga0501083_0045082 3300049744 Bacteria 2983
469 Ga0501083_0285804 3300049744 Bacteria 1073
470 Ga0501269_000203 3300049766 Bacteria 17659
471 Ga0501279_000515 3300049775 Bacteria 5081
472 Ga0501035_0061354 3300049822 Bacteria 3346
473 Ga0501044_0000960 3300049823 Bacteria 34653
474 Ga0501044_0006265 3300049823 Bacteria 13150
475 Ga0501044_0158666 3300049823 Bacteria 2240
476 Ga0501044_0161662 3300049823 Bacteria 2216
477 nmdc:mga0yw44_243625_c1 3300050492 Bacteria 1195
478 nmdc:mga0yw44_89954_c1 3300050492 Bacteria 1938
479 nmdc:mga06z11_175972_c1 3300050494 Bacteria 1231
480 nmdc:mga06z11_240786_c1 3300050494 Bacteria 1062
481 nmdc:mga06z11_29458_c1 3300050494 Bacteria 2645
482 nmdc:mga07m45_196015_c1 3300050496 Bacteria 1175
483 nmdc:mga05p37_471662_c1 3300050507 Bacteria 1448
484 nmdc:mga09592_586717_c1 3300050508 Bacteria 956
485 nmdc:mga0qj67_14048_c1 3300050509 Bacteria 6048
486 nmdc:mga06r32_10182_c1 3300050510 Bacteria 8488
487 nmdc:mga06r32_17129_c1 3300050510 Bacteria 6614
488 nmdc:mga0n895_307653_c1 3300050512 Bacteria 1606
489 nmdc:mga0n895_75902_c1 3300050512 Bacteria 3342
490 nmdc:mga08x19_25889_c1 3300050514 Bacteria 3658
491 nmdc:mga08x19_85080_c1 3300050514 Bacteria 2081
492 nmdc:mga0sz30_132948_c1 3300050516 Bacteria 1097
493 nmdc:mga0sz30_62938_c1 3300050516 Bacteria 1587
494 Ga0495601_0028359 3300053077 Bacteria 3468
495 Ga0495595_0012310 3300053084 Bacteria 3593
496 Ga0500643_000654 3300053087 Bacteria 23285
497 Ga0500643_041841 3300053087 Bacteria 1343
498 Ga0500566_0000712 3300053094 Bacteria 18710
499 Ga0500618_000371 3300053125 Bacteria 31102
500 Ga0500586_001509 3300053145 Bacteria 4938
501 Ga0500616_0002488 3300053153 Bacteria 15274
502 Ga0500616_0045965 3300053153 Bacteria 2323
503 Ga0501084_0118206 3300054114 Bacteria 2228
504 Ga0501084_0320321 3300054114 Bacteria 1310
505 Ga0501082_0007806 3300060353 Bacteria 9234
506 Ga0501082_0077933 3300060353 Bacteria 2858
507 Ga0501082_0375660 3300060353 Bacteria 1240
508 Ga0501082_0530875 3300060353 Bacteria 1029
509 Ga0530510_0409872 3300061734 Bacteria 1022

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0126791 Ga0495607_0126791_481_1182 220
2 3300053125 Ga0500618_000371 Ga0500618_000371_20997_21740 235
3 3300037471 Ga0395905_0000594 Ga0395905_0000594_30328_31077 238
4 3300046507 Ga0495606_0002275 Ga0495606_0002275_2315_3058 238
5 3300047469 Ga0495673_0000006 Ga0495673_0000006_291435_292181 239
6 3300049582 Ga0501048_0426513 Ga0501048_0426513_218_937 239
7 3300053087 Ga0500643_000654 Ga0500643_000654_21559_22284 241
8 3300053087 Ga0500643_041841 Ga0500643_041841_104_829 241
9 3300046457 Ga0495590_0000003 Ga0495590_0000003_70646_71374 242
10 3300046460 Ga0495638_0000118 Ga0495638_0000118_27528_28256 242
11 3300046471 Ga0495650_0003578 Ga0495650_0003578_1530_2258 242
12 3300046501 Ga0495607_0102152 Ga0495607_0102152_569_1297 242
13 3300046506 Ga0495583_0000079 Ga0495583_0000079_70423_71151 242
14 3300046522 Ga0495643_0000641 Ga0495643_0000641_20057_20785 242
15 3300046524 Ga0495648_0000070 Ga0495648_0000070_27605_28333 242
16 3300046542 Ga0495597_0000206 Ga0495597_0000206_22299_23027 242
17 3300046557 Ga0495622_0000439 Ga0495622_0000439_1497_2225 242
18 3300046558 Ga0495633_0015820 Ga0495633_0015820_622_1350 242
19 3300046616 Ga0495668_0000168 Ga0495668_0000168_26524_27252 242
20 3300046660 Ga0495625_0000038 Ga0495625_0000038_686_1414 242
21 iso_pu_bacteria 2643221554 2643788201 242
22 3300039447 Ga0436361_0012604 Ga0436361_0012604_2447_3178 243
23 iso_pu_bacteria 2643221638 2644213858 243
24 iso_pu_bacteria 2821131069 2821133618 243
25 iso_pu_bacteria 2857564685 2857565407 243
26 3300005437 Ga0070710_10028780 Ga0070710_100287804 245
27 3300025898 Ga0207692_10049592 Ga0207692_100495922 245
28 3300002738 JGI25154J39366_1000950 JGI25154J39366_100095011 246
29 3300002774 JGI25150J39212_1008395 JGI25150J39212_10083951 246
30 3300003187 JGI25151J46595_10058463 JGI25151J46595_100584632 246
31 3300003215 JGI25153J46596_10012733 JGI25153J46596_100127331 246
32 3300003322 rootL2_10008003 rootL2_100080037 246
33 3300003763 Ga0055529_1000185 Ga0055529_100018564 246
34 3300003763 Ga0055529_1000208 Ga0055529_10002086 246
35 3300003771 Ga0055526_1000077 Ga0055526_100007769 246
36 3300003771 Ga0055526_1000094 Ga0055526_10000944 246
37 3300003771 Ga0055526_1000520 Ga0055526_10005207 246
38 3300003771 Ga0055526_1002339 Ga0055526_100233914 246
39 3300003773 Ga0055537_1000072 Ga0055537_100007244 246
40 3300003773 Ga0055537_1003085 Ga0055537_10030859 246
41 3300003784 Ga0055534_1000136 Ga0055534_100013631 246
42 3300003784 Ga0055534_1002853 Ga0055534_10028537 246
43 3300003790 Ga0055528_1000025 Ga0055528_100002598 246
44 3300003790 Ga0055528_1014804 Ga0055528_10148043 246
45 3300003791 Ga0055530_10004993 Ga0055530_100049932 246
46 3300003794 Ga0055531_10001881 Ga0055531_1000188116 246
47 3300005445 Ga0070708_100259762 Ga0070708_1002597621 246
48 3300005467 Ga0070706_100075971 Ga0070706_1000759713 246
49 3300005536 Ga0070697_100096736 Ga0070697_1000967363 246
50 3300006175 Ga0070712_100290765 Ga0070712_1002907651 246
51 3300007788 Ga0099795_10201621 Ga0099795_102016211 246
52 3300009036 Ga0105244_10004717 Ga0105244_1000471711 246
53 3300010159 Ga0099796_10027047 Ga0099796_100270472 246
54 3300025233 Ga0209437_109774 Ga0209437_1097742 246
55 3300025245 Ga0207425_1000322 Ga0207425_100032223 246
56 3300025245 Ga0207425_1000981 Ga0207425_10009813 246
57 3300025246 Ga0209646_1000028 Ga0209646_1000028264 246
58 3300025258 Ga0209129_1003009 Ga0209129_10030092 246
59 3300025263 Ga0209565_1000009 Ga0209565_1000009441 246
60 3300025263 Ga0209565_1000705 Ga0209565_100070514 246
61 3300025272 Ga0209455_1000049 Ga0209455_100004966 246
62 3300025273 Ga0209673_1000036 Ga0209673_1000036241 246
63 3300025273 Ga0209673_1007584 Ga0209673_10075842 246
64 3300025284 Ga0209130_1002813 Ga0209130_100281310 246
65 3300025291 Ga0209675_1000013 Ga0209675_1000013241 246
66 3300025291 Ga0209675_1001114 Ga0209675_100111416 246
67 3300025294 Ga0209025_1022619 Ga0209025_10226194 246
68 3300025295 Ga0209564_1000009 Ga0209564_1000009861 246
69 3300025295 Ga0209564_1000045 Ga0209564_1000045279 246
70 3300025295 Ga0209564_1000515 Ga0209564_100051516 246
71 3300025295 Ga0209564_1016282 Ga0209564_10162822 246
72 3300025297 Ga0209758_1000945 Ga0209758_10009454 246
73 3300025298 Ga0209050_1000905 Ga0209050_10009053 246
74 3300025299 Ga0209256_1000358 Ga0209256_10003584 246
75 3300025299 Ga0209256_1005592 Ga0209256_10055928 246
76 3300025304 Ga0209257_1000486 Ga0209257_100048612 246
77 3300025304 Ga0209257_1001672 Ga0209257_10016724 246
78 3300025728 Ga0207655_1016634 Ga0207655_10166345 246
79 3300025910 Ga0207684_10024696 Ga0207684_100246966 246
80 3300035114 Ga0373939_0019460 Ga0373939_0019460_1002_1745 246
81 3300046452 Ga0495617_000006 Ga0495617_000006_224023_224766 246
82 3300046463 Ga0495653_0000011 Ga0495653_0000011_118449_119192 246
83 3300046471 Ga0495650_0000544 Ga0495650_0000544_25527_26270 246
84 3300046501 Ga0495607_0018826 Ga0495607_0018826_2999_3742 246
85 3300046507 Ga0495606_0000284 Ga0495606_0000284_68044_68787 246
86 3300046512 Ga0495610_0000004 Ga0495610_0000004_221077_221820 246
87 3300046512 Ga0495610_0150079 Ga0495610_0150079_52_795 246
88 3300046520 Ga0495637_0002176 Ga0495637_0002176_8142_8891 246
89 3300046520 Ga0495637_0003764 Ga0495637_0003764_3876_4619 246
90 3300046524 Ga0495648_0029021 Ga0495648_0029021_717_1460 246
91 3300046530 Ga0495654_0000035 Ga0495654_0000035_171076_171819 246
92 3300046558 Ga0495633_0034793 Ga0495633_0034793_1041_1784 246
93 3300046616 Ga0495668_0007896 Ga0495668_0007896_5102_5845 246
94 3300046692 Ga0495671_0000001 Ga0495671_0000001_872587_873330 246
95 3300046692 Ga0495671_0014283 Ga0495671_0014283_3217_3960 246
96 3300047323 Ga0495683_0130731 Ga0495683_0130731_158_907 246
97 3300047469 Ga0495673_0000014 Ga0495673_0000014_111179_111922 246
98 3300048903 Ga0496100_0175448 Ga0496100_0175448_756_1502 246
99 3300048910 Ga0496107_0363438 Ga0496107_0363438_114_857 246
100 3300048914 Ga0496111_0012075 Ga0496111_0012075_4586_5329 246
101 3300048923 Ga0496120_0062985 Ga0496120_0062985_388_1131 246
102 3300048924 Ga0496121_0106374 Ga0496121_0106374_1371_2114 246
103 3300048926 Ga0496123_0001851 Ga0496123_0001851_4944_5687 246
104 3300048929 Ga0496126_0016990 Ga0496126_0016990_6252_6995 246
105 iso_pu_bacteria 2857558681 2857563893 246
106 3300002774 JGI25150J39212_1001896 JGI25150J39212_10018963 247
107 3300002987 JGI25159J45721_1005133 JGI25159J45721_10051333 247
108 3300003215 JGI25153J46596_10004738 JGI25153J46596_100047382 247
109 3300003374 JGI25161J50226_1002163 JGI25161J50226_10021634 247
110 3300003771 Ga0055526_1008933 Ga0055526_10089333 247
111 3300003773 Ga0055537_1007247 Ga0055537_10072472 247
112 3300003775 Ga0055524_1006612 Ga0055524_10066124 247
113 3300003784 Ga0055534_1004569 Ga0055534_10045693 247
114 3300003791 Ga0055530_10006345 Ga0055530_100063454 247
115 3300003791 Ga0055530_10007919 Ga0055530_100079194 247
116 3300003794 Ga0055531_10035924 Ga0055531_100359242 247
117 3300004625 Ga0055543_1002960 Ga0055543_10029603 247
118 3300005262 Ga0065165_1007580 Ga0065165_10075803 247
119 3300005436 Ga0070713_100080136 Ga0070713_1000801362 247
120 3300005614 Ga0068856_100014461 Ga0068856_1000144616 247
121 3300006028 Ga0070717_10058354 Ga0070717_100583542 247
122 3300006914 Ga0075436_100081074 Ga0075436_1000810743 247
123 3300014497 Ga0182008_10039260 Ga0182008_100392603 247
124 3300025208 Ga0209436_102686 Ga0209436_1026863 247
125 3300025245 Ga0207425_1000001 Ga0207425_10000011997 247
126 3300025245 Ga0207425_1042888 Ga0207425_10428881 247
127 3300025258 Ga0209129_1000001 Ga0209129_10000011174 247
128 3300025263 Ga0209565_1003734 Ga0209565_10037344 247
129 3300025263 Ga0209565_1004134 Ga0209565_10041343 247
130 3300025263 Ga0209565_1004591 Ga0209565_10045913 247
131 3300025284 Ga0209130_1003044 Ga0209130_10030446 247
132 3300025284 Ga0209130_1009611 Ga0209130_10096112 247
133 3300025291 Ga0209675_1007283 Ga0209675_10072833 247
134 3300025295 Ga0209564_1000175 Ga0209564_100017575 247
135 3300025295 Ga0209564_1011920 Ga0209564_10119203 247
136 3300025297 Ga0209758_1000230 Ga0209758_100023042 247
137 3300025298 Ga0209050_1001360 Ga0209050_10013603 247
138 3300025298 Ga0209050_1009217 Ga0209050_10092174 247
139 3300025299 Ga0209256_1007674 Ga0209256_10076743 247
140 3300025304 Ga0209257_1015007 Ga0209257_10150074 247
141 3300025916 Ga0207663_10053614 Ga0207663_100536143 247
142 3300025928 Ga0207700_10009393 Ga0207700_100093937 247
143 3300025928 Ga0207700_10161768 Ga0207700_101617682 247
144 3300025929 Ga0207664_10113754 Ga0207664_101137543 247
145 3300026067 Ga0207678_10206018 Ga0207678_102060182 247
146 3300026078 Ga0207702_10011886 Ga0207702_100118866 247
147 3300031548 Ga0307408_100000182 Ga0307408_10000018249 247
148 3300031548 Ga0307408_100018197 Ga0307408_1000181975 247
149 3300031548 Ga0307408_100022926 Ga0307408_1000229264 247
150 3300035085 Ga0373929_0026892 Ga0373929_0026892_380_1135 247
151 3300042532 Ga0450893_0022753 Ga0450893_0022753_56_805 247
152 3300044673 Ga0453683_0000921 Ga0453683_0000921_8177_8932 247
153 3300045051 Ga0451576_0032096 Ga0451576_0032096_3857_4612 247
154 3300046475 Ga0495639_0011931 Ga0495639_0011931_2401_3153 247
155 3300046538 Ga0495609_0019759 Ga0495609_0019759_1916_2668 247
156 3300046660 Ga0495625_0025154 Ga0495625_0025154_3753_4508 247
157 3300046810 Ga0495660_0017490 Ga0495660_0017490_1484_2236 247
158 3300047443 Ga0495687_001054 Ga0495687_001054_25527_26279 247
159 3300047445 Ga0495677_0059228 Ga0495677_0059228_419_1171 247
160 3300048914 Ga0496111_0446967 Ga0496111_0446967_139_894 247
161 3300048915 Ga0496112_0429502 Ga0496112_0429502_23_778 247
162 3300048916 Ga0496113_0246690 Ga0496113_0246690_603_1358 247
163 3300049587 Ga0501071_0266457 Ga0501071_0266457_10_753 247
164 3300049662 Ga0501222_004602 Ga0501222_004602_270_1013 247
165 3300049775 Ga0501279_000515 Ga0501279_000515_1229_1978 247
166 3300050514 nmdc:mga08x19_85080_c1 nmdc:mga08x19_85080_c1_231_986 247
167 iso_pu_bacteria 2842711865 2842716771 247
168 3300005435 Ga0070714_100149349 Ga0070714_1001493492 248
169 3300006028 Ga0070717_10043803 Ga0070717_100438033 248
170 3300006028 Ga0070717_10605889 Ga0070717_106058892 248
171 3300007788 Ga0099795_10002958 Ga0099795_100029583 248
172 3300014497 Ga0182008_10168834 Ga0182008_101688342 248
173 3300028794 Ga0307515_10284198 Ga0307515_102841982 248
174 3300039447 Ga0436361_0815718 Ga0436361_0815718_1036_1788 248
175 3300046512 Ga0495610_0005896 Ga0495610_0005896_4873_5631 248
176 3300046522 Ga0495643_0000505 Ga0495643_0000505_24906_25664 248
177 3300046524 Ga0495648_0012949 Ga0495648_0012949_680_1438 248
178 3300046538 Ga0495609_0020944 Ga0495609_0020944_1962_2720 248
179 3300046542 Ga0495597_0000583 Ga0495597_0000583_27805_28566 248
180 3300046558 Ga0495633_0000543 Ga0495633_0000543_622_1386 248
181 3300046558 Ga0495633_0027592 Ga0495633_0027592_1817_2581 248
182 3300046692 Ga0495671_0165088 Ga0495671_0165088_199_957 248
183 3300047320 Ga0495672_0000580 Ga0495672_0000580_20493_21251 248
184 3300047445 Ga0495677_0040662 Ga0495677_0040662_667_1425 248
185 3300049459 Ga0495678_000459 Ga0495678_000459_10676_11434 248
186 3300053145 Ga0500586_001509 Ga0500586_001509_1976_2740 248
187 3300035691 Ga0373931_0071732 Ga0373931_0071732_351_1115 249
188 3300009148 Ga0105243_10451603 Ga0105243_104516031 250
189 3300037853 Ga0436364_0678334 Ga0436364_0678334_710_1474 250
190 3300042185 Ga0450909_011505 Ga0450909_011505_189_956 250
191 3300046507 Ga0495606_0001400 Ga0495606_0001400_29061_29855 250
192 3300005577 Ga0068857_100711295 Ga0068857_1007112952 251
193 3300009098 Ga0105245_10024271 Ga0105245_100242712 253
194 3300046452 Ga0495617_002718 Ga0495617_002718_4905_5738 253
195 3300046507 Ga0495606_0012744 Ga0495606_0012744_518_1339 253
196 3300046507 Ga0495606_0033665 Ga0495606_0033665_588_1433 253
197 3300046512 Ga0495610_0028847 Ga0495610_0028847_50_871 253
198 3300047447 Ga0495685_032572 Ga0495685_032572_849_1664 253
199 3300006178 Ga0075367_10174933 Ga0075367_101749331 254
200 3300046660 Ga0495625_0009791 Ga0495625_0009791_4800_5621 255
201 3300046694 Ga0495649_0004418 Ga0495649_0004418_3530_4351 255
202 3300013308 Ga0157375_10421267 Ga0157375_104212672 257
203 3300049581 Ga0501047_0082985 Ga0501047_0082985_820_1599 257
204 iso_pu_bacteria 2891088606 2891089438 257
205 3300006237 Ga0097621_100263379 Ga0097621_1002633791 258
206 3300053153 Ga0500616_0002488 Ga0500616_0002488_13709_14485 258
207 iso_pu_bacteria 2857553236 2857553724 259
208 iso_pu_bacteria 2904424332 2904430455 259
209 iso_pu_bacteria 2919476304 2919480352 259
210 3300005340 Ga0070689_100185066 Ga0070689_1001850661 260
211 3300005466 Ga0070685_10127856 Ga0070685_101278563 260
212 3300025918 Ga0207662_10011174 Ga0207662_100111742 260
213 3300025936 Ga0207670_10299737 Ga0207670_102997372 260
214 3300031247 Ga0265340_10001229 Ga0265340_1000122916 260
215 3300031344 Ga0265316_10045462 Ga0265316_100454624 260
216 3300031595 Ga0265313_10000712 Ga0265313_1000071230 260
217 3300039437 Ga0436365_0299394 Ga0436365_0299394_62_850 260
218 3300049568 Ga0501031_0068465 Ga0501031_0068465_1355_2137 260
219 3300049569 Ga0501032_0283834 Ga0501032_0283834_232_1014 260
220 3300049571 Ga0501034_0132590 Ga0501034_0132590_498_1280 260
221 3300049572 Ga0501036_0018572 Ga0501036_0018572_2002_2784 260
222 3300049574 Ga0501038_0053657 Ga0501038_0053657_2067_2849 260
223 3300049581 Ga0501047_0114817 Ga0501047_0114817_1227_2009 260
224 3300049586 Ga0501070_0054946 Ga0501070_0054946_611_1393 260
225 3300049742 Ga0501080_0206742 Ga0501080_0206742_386_1168 260
226 3300049823 Ga0501044_0158666 Ga0501044_0158666_322_1104 260
227 3300006946 Ga0079104_1007431 Ga0079104_10074314 261
228 3300027111 Ga0209281_1009446 Ga0209281_10094462 261
229 3300031239 Ga0265328_10001954 Ga0265328_100019542 261
230 3300046558 Ga0495633_0042989 Ga0495633_0042989_849_1646 261
231 3300046810 Ga0495660_0010430 Ga0495660_0010430_1706_2497 261
232 3300048906 Ga0496103_0001584 Ga0496103_0001584_5084_5881 261
233 3300048917 Ga0496114_0357938 Ga0496114_0357938_123_920 261
234 3300048919 Ga0496116_0112840 Ga0496116_0112840_706_1497 261
235 3300049588 Ga0501072_0022171 Ga0501072_0022171_2465_3250 261
236 3300049589 Ga0501073_0142232 Ga0501073_0142232_382_1167 261
237 3300049742 Ga0501080_0035703 Ga0501080_0035703_2618_3403 261
238 3300049744 Ga0501083_0045082 Ga0501083_0045082_1543_2328 261
239 3300053084 Ga0495595_0012310 Ga0495595_0012310_2692_3498 261
240 3300054114 Ga0501084_0118206 Ga0501084_0118206_255_1040 261
241 3300005367 Ga0070667_100342851 Ga0070667_1003428512 262
242 3300006847 Ga0075431_100002052 Ga0075431_10000205219 262
243 3300046557 Ga0495622_0000004 Ga0495622_0000004_236567_237358 262
244 3300050510 nmdc:mga06r32_17129_c1 nmdc:mga06r32_17129_c1_4818_5612 262
245 iso_pu_bacteria 2889790730 2889795965 262
246 iso_pu_bacteria 2889914905 2889918682 262
247 3300021361 Ga0213872_10000002 Ga0213872_1000000274 263
248 3300021361 Ga0213872_10011548 Ga0213872_100115485 263
249 3300039447 Ga0436361_0570400 Ga0436361_0570400_28137_28937 263
250 3300039447 Ga0436361_1210581 Ga0436361_1210581_2032_2832 263
251 3300046507 Ga0495606_0000778 Ga0495606_0000778_39031_39825 263
252 3300049581 Ga0501047_0525586 Ga0501047_0525586_18_818 263
253 3300005327 Ga0070658_10115505 Ga0070658_101155053 264
254 3300005530 Ga0070679_100040224 Ga0070679_1000402244 264
255 3300005530 Ga0070679_100169266 Ga0070679_1001692662 264
256 3300005535 Ga0070684_100278496 Ga0070684_1002784962 264
257 3300005563 Ga0068855_100020137 Ga0068855_1000201378 264
258 3300005614 Ga0068856_100074638 Ga0068856_1000746383 264
259 3300005616 Ga0068852_100076686 Ga0068852_1000766863 264
260 3300006051 Ga0075364_10331155 Ga0075364_103311552 264
261 3300021361 Ga0213872_10029828 Ga0213872_100298282 264
262 3300025728 Ga0207655_1011076 Ga0207655_10110762 264
263 3300025921 Ga0207652_10236352 Ga0207652_102363522 264
264 3300025924 Ga0207694_10103091 Ga0207694_101030912 264
265 3300025949 Ga0207667_10044449 Ga0207667_100444492 264
266 3300026078 Ga0207702_10193183 Ga0207702_101931832 264
267 3300026142 Ga0207698_10187757 Ga0207698_101877572 264
268 3300035171 Ga0373946_0107763 Ga0373946_0107763_324_1127 264
269 3300037312 Ga0395899_0081389 Ga0395899_0081389_141_935 264
270 3300037418 Ga0395900_0030158 Ga0395900_0030158_2925_3719 264
271 3300037466 Ga0395898_0049455 Ga0395898_0049455_883_1677 264
272 3300038443 Ga0395901_0006448 Ga0395901_0006448_2993_3787 264
273 3300039447 Ga0436361_0084554 Ga0436361_0084554_1474_2277 264
274 3300046453 Ga0495627_000005 Ga0495627_000005_162350_163165 264
275 3300046459 Ga0495629_0217625 Ga0495629_0217625_207_1010 264
276 3300046517 Ga0495630_0108295 Ga0495630_0108295_919_1722 264
277 3300046523 Ga0495644_0011297 Ga0495644_0011297_1717_2532 264
278 3300046538 Ga0495609_0003784 Ga0495609_0003784_2074_2889 264
279 3300046810 Ga0495660_0010898 Ga0495660_0010898_2988_3803 264
280 3300047320 Ga0495672_0157027 Ga0495672_0157027_346_1149 264
281 3300047470 Ga0495681_0011112 Ga0495681_0011112_2563_3378 264
282 3300048911 Ga0496108_0561610 Ga0496108_0561610_164_964 264
283 3300048927 Ga0496124_0029688 Ga0496124_0029688_3760_4575 264
284 3300049459 Ga0495678_000016 Ga0495678_000016_138168_138983 264
285 3300049569 Ga0501032_0054250 Ga0501032_0054250_558_1358 264
286 3300049569 Ga0501032_0084420 Ga0501032_0084420_743_1543 264
287 3300049571 Ga0501034_0004997 Ga0501034_0004997_11453_12253 264
288 3300049571 Ga0501034_0251510 Ga0501034_0251510_816_1616 264
289 3300049572 Ga0501036_0000609 Ga0501036_0000609_12411_13211 264
290 3300049573 Ga0501037_0007475 Ga0501037_0007475_2014_2814 264
291 3300049573 Ga0501037_0007550 Ga0501037_0007550_534_1334 264
292 3300049574 Ga0501038_0024084 Ga0501038_0024084_3120_3920 264
293 3300049579 Ga0501043_0002387 Ga0501043_0002387_2422_3222 264
294 3300049579 Ga0501043_0011113 Ga0501043_0011113_652_1452 264
295 3300049579 Ga0501043_0053814 Ga0501043_0053814_1541_2341 264
296 3300049580 Ga0501046_0019105 Ga0501046_0019105_3272_4072 264
297 3300049580 Ga0501046_0074015 Ga0501046_0074015_596_1396 264
298 3300049581 Ga0501047_0000228 Ga0501047_0000228_25023_25823 264
299 3300049582 Ga0501048_0000467 Ga0501048_0000467_25023_25838 264
300 3300049586 Ga0501070_0003235 Ga0501070_0003235_8755_9555 264
301 3300049586 Ga0501070_0012221 Ga0501070_0012221_4921_5721 264
302 3300049590 Ga0501074_0005965 Ga0501074_0005965_6459_7259 264
303 3300049742 Ga0501080_0000112 Ga0501080_0000112_53583_54383 264
304 3300049744 Ga0501083_0030548 Ga0501083_0030548_2816_3616 264
305 3300049766 Ga0501269_000203 Ga0501269_000203_15566_16384 264
306 3300049822 Ga0501035_0061354 Ga0501035_0061354_1342_2142 264
307 3300049823 Ga0501044_0006265 Ga0501044_0006265_1794_2594 264
308 3300053094 Ga0500566_0000712 Ga0500566_0000712_13839_14633 264
309 3300005329 Ga0070683_100341906 Ga0070683_1003419062 265
310 3300006178 Ga0075367_10089787 Ga0075367_100897873 265
311 3300006353 Ga0075370_10031635 Ga0075370_100316353 265
312 3300031824 Ga0307413_10263531 Ga0307413_102635312 265
313 3300035170 Ga0373943_0311422 Ga0373943_0311422_76_882 265
314 3300042004 Ga0439445_0004920 Ga0439445_0004920_1023_1820 265
315 3300044694 Ga0466963_0271432 Ga0466963_0271432_146_943 265
316 3300044842 Ga0466957_0192372 Ga0466957_0192372_286_1086 265
317 3300045976 Ga0466967_0056663 Ga0466967_0056663_2488_3285 265
318 3300046452 Ga0495617_030614 Ga0495617_030614_699_1511 265
319 3300046452 Ga0495617_049177 Ga0495617_049177_294_1106 265
320 3300046457 Ga0495590_0035141 Ga0495590_0035141_904_1716 265
321 3300046460 Ga0495638_0258842 Ga0495638_0258842_95_907 265
322 3300046491 Ga0495584_0001518 Ga0495584_0001518_2495_3307 265
323 3300046491 Ga0495584_0092159 Ga0495584_0092159_181_993 265
324 3300046492 Ga0495585_0012077 Ga0495585_0012077_678_1490 265
325 3300046492 Ga0495585_0105467 Ga0495585_0105467_408_1220 265
326 3300046492 Ga0495585_0117668 Ga0495585_0117668_166_978 265
327 3300046501 Ga0495607_0127798 Ga0495607_0127798_119_931 265
328 3300046506 Ga0495583_0000413 Ga0495583_0000413_11713_12525 265
329 3300046512 Ga0495610_0042770 Ga0495610_0042770_822_1634 265
330 3300046513 Ga0495616_0001970 Ga0495616_0001970_793_1605 265
331 3300046523 Ga0495644_0000141 Ga0495644_0000141_2046_2858 265
332 3300046524 Ga0495648_0003290 Ga0495648_0003290_5228_6040 265
333 3300046524 Ga0495648_0048381 Ga0495648_0048381_1693_2514 265
334 3300046533 Ga0495640_0067039 Ga0495640_0067039_1374_2180 265
335 3300046538 Ga0495609_0001785 Ga0495609_0001785_704_1516 265
336 3300046557 Ga0495622_0061574 Ga0495622_0061574_483_1295 265
337 3300046648 Ga0495611_0006061 Ga0495611_0006061_3660_4472 265
338 3300046648 Ga0495611_0028761 Ga0495611_0028761_466_1278 265
339 3300046648 Ga0495611_0039767 Ga0495611_0039767_377_1189 265
340 3300046660 Ga0495625_0025729 Ga0495625_0025729_1489_2301 265
341 3300046664 Ga0495659_0002213 Ga0495659_0002213_1815_2627 265
342 3300046665 Ga0495661_0075199 Ga0495661_0075199_425_1237 265
343 3300047318 Ga0495636_0001371 Ga0495636_0001371_1977_2789 265
344 3300047320 Ga0495672_0006776 Ga0495672_0006776_207_1019 265
345 3300047323 Ga0495683_0003137 Ga0495683_0003137_41_853 265
346 3300047443 Ga0495687_000235 Ga0495687_000235_64020_64832 265
347 3300047445 Ga0495677_0053948 Ga0495677_0053948_318_1130 265
348 3300047447 Ga0495685_000124 Ga0495685_000124_24583_25395 265
349 3300047469 Ga0495673_0004861 Ga0495673_0004861_2318_3130 265
350 3300049459 Ga0495678_001634 Ga0495678_001634_2433_3245 265
351 3300049460 Ga0495682_0000233 Ga0495682_0000233_36665_37477 265
352 3300049460 Ga0495682_0000357 Ga0495682_0000357_20390_21202 265
353 3300049570 Ga0501033_0010717 Ga0501033_0010717_4010_4834 265
354 3300049570 Ga0501033_0190894 Ga0501033_0190894_421_1227 265
355 3300049571 Ga0501034_0000032 Ga0501034_0000032_192739_193542 265
356 3300049571 Ga0501034_0010486 Ga0501034_0010486_878_1681 265
357 3300049571 Ga0501034_0232628 Ga0501034_0232628_830_1654 265
358 3300049573 Ga0501037_0281813 Ga0501037_0281813_142_945 265
359 3300049586 Ga0501070_0085942 Ga0501070_0085942_916_1719 265
360 3300049586 Ga0501070_0643803 Ga0501070_0643803_21_827 265
361 3300049593 Ga0501077_0129152 Ga0501077_0129152_568_1374 265
362 3300049743 Ga0501081_0073391 Ga0501081_0073391_31_837 265
363 3300049744 Ga0501083_0285804 Ga0501083_0285804_79_885 265
364 3300049823 Ga0501044_0000960 Ga0501044_0000960_27255_28079 265
365 3300049823 Ga0501044_0161662 Ga0501044_0161662_290_1093 265
366 3300060353 Ga0501082_0007806 Ga0501082_0007806_8095_8901 265
367 3300060353 Ga0501082_0375660 Ga0501082_0375660_376_1179 265
368 3300060353 Ga0501082_0530875 Ga0501082_0530875_139_948 265
369 3300061734 Ga0530510_0409872 Ga0530510_0409872_89_895 265
370 3300005455 Ga0070663_100113642 Ga0070663_1001136422 266
371 3300005459 Ga0068867_100231836 Ga0068867_1002318362 266
372 3300006844 Ga0075428_100117169 Ga0075428_1001171693 266
373 3300006846 Ga0075430_100258972 Ga0075430_1002589722 266
374 3300006847 Ga0075431_100244644 Ga0075431_1002446442 266
375 3300009177 Ga0105248_10370749 Ga0105248_103707492 266
376 3300009553 Ga0105249_10000037 Ga0105249_10000037168 266
377 3300014325 Ga0163163_10137627 Ga0163163_101376273 266
378 3300014326 Ga0157380_10301336 Ga0157380_103013362 266
379 3300015261 Ga0182006_1000163 Ga0182006_100016366 266
380 3300015262 Ga0182007_10050117 Ga0182007_100501171 266
381 3300015265 Ga0182005_1000020 Ga0182005_1000020179 266
382 3300025925 Ga0207650_10001142 Ga0207650_100011426 266
383 3300025961 Ga0207712_10000035 Ga0207712_10000035168 266
384 3300026067 Ga0207678_10077048 Ga0207678_100770483 266
385 3300026089 Ga0207648_10165661 Ga0207648_101656612 266
386 3300028800 Ga0265338_10159538 Ga0265338_101595382 266
387 3300031824 Ga0307413_10129592 Ga0307413_101295922 266
388 3300035695 Ga0373927_0213051 Ga0373927_0213051_365_1171 266
389 3300037068 Ga0373925_0067023 Ga0373925_0067023_43_849 266
390 3300046683 Ga0495658_0164715 Ga0495658_0164715_213_1019 266
391 3300047472 Ga0495686_0000225 Ga0495686_0000225_81472_82311 266
392 3300048905 Ga0496102_0024423 Ga0496102_0024423_2003_2809 266
393 3300048907 Ga0496104_0162024 Ga0496104_0162024_571_1377 266
394 3300048907 Ga0496104_0203200 Ga0496104_0203200_162_971 266
395 3300048908 Ga0496105_0038921 Ga0496105_0038921_1668_2474 266
396 3300048909 Ga0496106_0162800 Ga0496106_0162800_823_1629 266
397 3300048911 Ga0496108_0119816 Ga0496108_0119816_482_1288 266
398 3300050507 nmdc:mga05p37_471662_c1 nmdc:mga05p37_471662_c1_279_1091 266
399 3300050508 nmdc:mga09592_586717_c1 nmdc:mga09592_586717_c1_40_846 266
400 3300050509 nmdc:mga0qj67_14048_c1 nmdc:mga0qj67_14048_c1_822_1628 266
401 3300050510 nmdc:mga06r32_10182_c1 nmdc:mga06r32_10182_c1_3286_4092 266
402 3300050516 nmdc:mga0sz30_62938_c1 nmdc:mga0sz30_62938_c1_668_1474 266
403 3300060353 Ga0501082_0077933 Ga0501082_0077933_1712_2551 266
404 3300005981 Ga0081538_10022183 Ga0081538_100221835 267
405 3300006178 Ga0075367_10021615 Ga0075367_100216152 267
406 3300006178 Ga0075367_10027960 Ga0075367_100279602 267
407 3300031241 Ga0265325_10021502 Ga0265325_100215024 267
408 3300031595 Ga0265313_10000041 Ga0265313_1000004176 267
409 3300031595 Ga0265313_10012923 Ga0265313_100129232 267
410 3300048928 Ga0496125_0006825 Ga0496125_0006825_8777_9580 267
411 3300050494 nmdc:mga06z11_175972_c1 nmdc:mga06z11_175972_c1_172_1137 267
412 3300050494 nmdc:mga06z11_29458_c1 nmdc:mga06z11_29458_c1_741_1700 267
413 3300050512 nmdc:mga0n895_307653_c1 nmdc:mga0n895_307653_c1_479_1282 267
414 3300054114 Ga0501084_0320321 Ga0501084_0320321_22_828 267
415 3300005436 Ga0070713_100087020 Ga0070713_1000870202 268
416 3300006028 Ga0070717_10507154 Ga0070717_105071542 268
417 3300006178 Ga0075367_10016320 Ga0075367_100163201 268
418 3300006846 Ga0075430_100176793 Ga0075430_1001767931 268
419 3300006847 Ga0075431_100140177 Ga0075431_1001401773 268
420 3300006871 Ga0075434_100077071 Ga0075434_1000770712 268
421 3300007788 Ga0099795_10057158 Ga0099795_100571582 268
422 3300009545 Ga0105237_10294087 Ga0105237_102940872 268
423 3300009551 Ga0105238_10065743 Ga0105238_100657433 268
424 3300013296 Ga0157374_10598752 Ga0157374_105987521 268
425 3300014745 Ga0157377_10169136 Ga0157377_101691361 268
426 3300025914 Ga0207671_10189865 Ga0207671_101898651 268
427 3300025924 Ga0207694_10019213 Ga0207694_100192134 268
428 3300025928 Ga0207700_10184518 Ga0207700_101845182 268
429 3300027512 Ga0209179_1037423 Ga0209179_10374231 268
430 3300031548 Ga0307408_100072773 Ga0307408_1000727731 268
431 3300035113 Ga0373936_0007469 Ga0373936_0007469_2370_3185 268
432 3300035170 Ga0373943_0096282 Ga0373943_0096282_424_1239 268
433 3300035241 Ga0373961_0007681 Ga0373961_0007681_1795_2601 268
434 3300035692 Ga0373935_0352193 Ga0373935_0352193_56_862 268
435 3300035725 Ga0373947_0127040 Ga0373947_0127040_547_1362 268
436 3300041413 Ga0439465_0021105 Ga0439465_0021105_61_1047 268
437 3300046543 Ga0495645_0207820 Ga0495645_0207820_472_1278 268
438 3300046663 Ga0495635_0169165 Ga0495635_0169165_174_980 268
439 3300048909 Ga0496106_0047800 Ga0496106_0047800_1857_2663 268
440 3300048912 Ga0496109_0356991 Ga0496109_0356991_133_939 268
441 3300048913 Ga0496110_0082147 Ga0496110_0082147_2020_2826 268
442 3300048918 Ga0496115_0077196 Ga0496115_0077196_153_959 268
443 3300050494 nmdc:mga06z11_240786_c1 nmdc:mga06z11_240786_c1_190_996 268
444 3300050496 nmdc:mga07m45_196015_c1 nmdc:mga07m45_196015_c1_249_1055 268
445 3300050512 nmdc:mga0n895_75902_c1 nmdc:mga0n895_75902_c1_796_1602 268
446 3300050516 nmdc:mga0sz30_132948_c1 nmdc:mga0sz30_132948_c1_27_833 268
447 3300053077 Ga0495601_0028359 Ga0495601_0028359_2269_3075 268
448 3300053153 Ga0500616_0045965 Ga0500616_0045965_495_1301 268
449 3300005328 Ga0070676_10202610 Ga0070676_102026102 269
450 3300005365 Ga0070688_100118359 Ga0070688_1001183592 269
451 3300005544 Ga0070686_100273528 Ga0070686_1002735282 269
452 3300005548 Ga0070665_100406801 Ga0070665_1004068013 269
453 3300005937 Ga0081455_10000678 Ga0081455_1000067822 269
454 3300005983 Ga0081540_1000084 Ga0081540_100008468 269
455 3300006038 Ga0075365_10172157 Ga0075365_101721572 269
456 3300006914 Ga0075436_100036277 Ga0075436_1000362772 269
457 3300024227 Ga0228598_1009140 Ga0228598_10091401 269
458 3300025907 Ga0207645_10136147 Ga0207645_101361472 269
459 3300025914 Ga0207671_10102883 Ga0207671_101028832 269
460 3300025915 Ga0207693_10039338 Ga0207693_100393382 269
461 3300025931 Ga0207644_10061297 Ga0207644_100612973 269
462 3300025986 Ga0207658_10180251 Ga0207658_101802512 269
463 3300026121 Ga0207683_10204240 Ga0207683_102042402 269
464 3300030760 Ga0265762_1022154 Ga0265762_10221542 269
465 3300031090 Ga0265760_10041482 Ga0265760_100414821 269
466 3300031711 Ga0265314_10168522 Ga0265314_101685221 269
467 3300035172 Ga0373955_0080407 Ga0373955_0080407_631_1455 269
468 3300037853 Ga0436364_1398223 Ga0436364_1398223_630_1439 269
469 3300039437 Ga0436365_0208033 Ga0436365_0208033_3077_3895 269
470 3300039453 Ga0436362_0512396 Ga0436362_0512396_195_1013 269
471 3300046514 Ga0495618_0079626 Ga0495618_0079626_1162_1971 269
472 3300046517 Ga0495630_0084029 Ga0495630_0084029_141_950 269
473 3300046642 Ga0495634_0002372 Ga0495634_0002372_1189_1998 269
474 3300046663 Ga0495635_0349585 Ga0495635_0349585_161_970 269
475 3300047315 Ga0495581_0181911 Ga0495581_0181911_107_916 269
476 3300047471 Ga0495684_0007145 Ga0495684_0007145_7337_8146 269
477 3300049581 Ga0501047_0076291 Ga0501047_0076291_1689_2534 269
478 3300049582 Ga0501048_0002713 Ga0501048_0002713_6353_7189 269
479 3300049585 Ga0501069_0096343 Ga0501069_0096343_415_1260 269
480 3300049586 Ga0501070_0160053 Ga0501070_0160053_396_1241 269
481 3300049589 Ga0501073_0045122 Ga0501073_0045122_1701_2546 269
482 3300049590 Ga0501074_0247914 Ga0501074_0247914_202_1047 269
483 3300049741 Ga0501079_0187878 Ga0501079_0187878_247_1092 269
484 3300050492 nmdc:mga0yw44_243625_c1 nmdc:mga0yw44_243625_c1_144_956 269
485 3300050492 nmdc:mga0yw44_89954_c1 nmdc:mga0yw44_89954_c1_202_1032 269
486 3300050514 nmdc:mga08x19_25889_c1 nmdc:mga08x19_25889_c1_2365_3174 269
487 3300044658 Ga0466972_0034160 Ga0466972_0034160_1602_2480 271
488 3300001989 JGI24739J22299_10023351 JGI24739J22299_100233513 272
489 3300002067 JGI24735J21928_10004814 JGI24735J21928_100048143 272
490 3300005548 Ga0070665_100138295 Ga0070665_1001382952 272
491 3300009011 Ga0105251_10000899 Ga0105251_100008997 272
492 3300009093 Ga0105240_10205763 Ga0105240_102057632 272
493 3300009101 Ga0105247_10504888 Ga0105247_105048881 272
494 3300011119 Ga0105246_10128565 Ga0105246_101285653 272
495 3300013296 Ga0157374_10388131 Ga0157374_103881312 272
496 3300025302 Ga0207426_1009720 Ga0207426_10097203 272
497 3300025735 Ga0207713_1001961 Ga0207713_10019615 272
498 3300025904 Ga0207647_10023460 Ga0207647_100234606 272
499 3300028379 Ga0268266_10088207 Ga0268266_100882073 272
500 3300046457 Ga0495590_0000404 Ga0495590_0000404_7725_8543 272
501 3300046542 Ga0495597_0010332 Ga0495597_0010332_2346_3164 272
502 3300047469 Ga0495673_0044180 Ga0495673_0044180_654_1472 272
503 3300048091 Ga0495626_0097299 Ga0495626_0097299_298_1116 272
504 3300048903 Ga0496100_0003175 Ga0496100_0003175_127_945 272
505 3300048904 Ga0496101_0011334 Ga0496101_0011334_521_1339 272
506 3300048906 Ga0496103_0010749 Ga0496103_0010749_3837_4655 272
507 3300048908 Ga0496105_0013582 Ga0496105_0013582_5085_5903 272
508 3300048909 Ga0496106_0004419 Ga0496106_0004419_3012_3830 272
509 3300048910 Ga0496107_0004070 Ga0496107_0004070_1424_2242 272
510 3300048911 Ga0496108_0098055 Ga0496108_0098055_395_1213 272
511 3300048912 Ga0496109_0122010 Ga0496109_0122010_205_1023 272
512 3300048913 Ga0496110_0004592 Ga0496110_0004592_9789_10607 272
513 3300048914 Ga0496111_0002330 Ga0496111_0002330_2534_3352 272
514 3300048916 Ga0496113_0003040 Ga0496113_0003040_7637_8455 272
515 3300048919 Ga0496116_0002803 Ga0496116_0002803_14825_15643 272
516 3300048920 Ga0496117_0004917 Ga0496117_0004917_11141_11959 272
517 3300048921 Ga0496118_0011800 Ga0496118_0011800_94_912 272
518 3300048924 Ga0496121_0026163 Ga0496121_0026163_4000_4818 272
519 3300048925 Ga0496122_0010350 Ga0496122_0010350_7457_8275 272
520 3300048926 Ga0496123_0005622 Ga0496123_0005622_9120_9938 272
521 3300048927 Ga0496124_0054969 Ga0496124_0054969_1272_2090 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

55

295

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7499 10 272
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7446 10 272
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7246 9 271
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7064 9 271
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.6736 11 271
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7499 10 272 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7446 10 272 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7273 11 271 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7187 8 272 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7181 74 271 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A4R9WRZ7-F1-model_v4 DUF72 domain-containing protein 0.9856 108 195
AF-A0A158C9X0-F1-model_v4 DUF72 domain-containing protein 0.9842 94 272
AF-A0A2N7VI57-F1-model_v4 DUF72 domain-containing protein 0.9841 52 270
AF-A0A1H1J9T9-F1-model_v4 Uncharacterized conserved protein YecE, DUF72 family 0.9836 58 269
AF-A0A3C1NFF2-F1-model_v4 DUF72 domain-containing protein 0.9826 58 182

Feature Viewer

pLDDT pTM Quality
91.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map