F458727
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 521 | 308 | 509 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300041413|Ga0439465_0021105|Ga0439465_0021105_61_1047 |
| Length | 297 |
| Sequence | MAKKTSSVKPAKKKGKASAPVVFDAPQKPPLKPDGGNIFTGIGGWTFEPWRGVFYPDGLPHNKELEYAAAHLTSIEINGTFYRTQTPATFHKWASEVPNGFKFSVKGVRYVTNRSVLAEAGDSIKRFIDSGVLELGDRLGPLLWQMNPYKKFDEADFGKFLELLPPKVGDQTIRHVVEVRHDSFKTPAFIALLRQFNVGIVYSEHDTYTEIADVTSDFVYARLQKGDDSLATGYPPKALDAWSERLKVWADGGQPDDLPRVDKTDAPKKPRDVFAYVIHEGKVRAPAAAMELIRRQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 2 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 3 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 4 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 5 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 6 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 7 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 8 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 9 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 10 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 11 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 12 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 153 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 175 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 176 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 177 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 178 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.31 |
| Metatranscriptomes | 0.38 |
| Isolates | 2.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.04 |
| Nodule | 0.38 |
| Rhizoplane | 5.76 |
| Rhizosphere | 70.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10023351 | 3300001989 | Bacteria | 2187 |
| 2 | JGI24735J21928_10004814 | 3300002067 | Bacteria | 4505 |
| 3 | JGI25154J39366_1000950 | 3300002738 | Bacteria | 12003 |
| 4 | JGI25150J39212_1001896 | 3300002774 | Bacteria | 5488 |
| 5 | JGI25150J39212_1008395 | 3300002774 | Bacteria | 2023 |
| 6 | JGI25159J45721_1005133 | 3300002987 | Bacteria | 4156 |
| 7 | JGI25151J46595_10058463 | 3300003187 | Bacteria | 1248 |
| 8 | JGI25153J46596_10004738 | 3300003215 | Bacteria | 7247 |
| 9 | JGI25153J46596_10012733 | 3300003215 | Bacteria | 3604 |
| 10 | rootL2_10008003 | 3300003322 | Bacteria | 3999 |
| 11 | JGI25161J50226_1002163 | 3300003374 | Bacteria | 5251 |
| 12 | Ga0055529_1000185 | 3300003763 | Bacteria | 85584 |
| 13 | Ga0055529_1000208 | 3300003763 | Bacteria | 77951 |
| 14 | Ga0055526_1000077 | 3300003771 | Bacteria | 92111 |
| 15 | Ga0055526_1000094 | 3300003771 | Bacteria | 80954 |
| 16 | Ga0055526_1000520 | 3300003771 | Bacteria | 30566 |
| 17 | Ga0055526_1002339 | 3300003771 | Bacteria | 12884 |
| 18 | Ga0055526_1008933 | 3300003771 | Bacteria | 4911 |
| 19 | Ga0055537_1000072 | 3300003773 | Bacteria | 73276 |
| 20 | Ga0055537_1003085 | 3300003773 | Bacteria | 5241 |
| 21 | Ga0055537_1007247 | 3300003773 | Bacteria | 2697 |
| 22 | Ga0055524_1006612 | 3300003775 | Bacteria | 5014 |
| 23 | Ga0055534_1000136 | 3300003784 | Bacteria | 55242 |
| 24 | Ga0055534_1002853 | 3300003784 | Bacteria | 5751 |
| 25 | Ga0055534_1004569 | 3300003784 | Bacteria | 3961 |
| 26 | Ga0055528_1000025 | 3300003790 | Bacteria | 130730 |
| 27 | Ga0055528_1014804 | 3300003790 | Bacteria | 2860 |
| 28 | Ga0055530_10004993 | 3300003791 | Bacteria | 6550 |
| 29 | Ga0055530_10006345 | 3300003791 | Bacteria | 5308 |
| 30 | Ga0055530_10007919 | 3300003791 | Bacteria | 4358 |
| 31 | Ga0055531_10001881 | 3300003794 | Bacteria | 14703 |
| 32 | Ga0055531_10035924 | 3300003794 | Bacteria | 1540 |
| 33 | Ga0055543_1002960 | 3300004625 | Bacteria | 5289 |
| 34 | Ga0065165_1007580 | 3300005262 | Bacteria | 5289 |
| 35 | Ga0070658_10115505 | 3300005327 | Bacteria | 2227 |
| 36 | Ga0070676_10202610 | 3300005328 | Bacteria | 1301 |
| 37 | Ga0070683_100341906 | 3300005329 | Bacteria | 1425 |
| 38 | Ga0070689_100185066 | 3300005340 | Bacteria | 1693 |
| 39 | Ga0070688_100118359 | 3300005365 | Bacteria | 1771 |
| 40 | Ga0070667_100342851 | 3300005367 | Bacteria | 1352 |
| 41 | Ga0070714_100149349 | 3300005435 | Bacteria | 2104 |
| 42 | Ga0070713_100080136 | 3300005436 | Bacteria | 2783 |
| 43 | Ga0070713_100087020 | 3300005436 | Bacteria | 2680 |
| 44 | Ga0070710_10028780 | 3300005437 | Bacteria | 2975 |
| 45 | Ga0070708_100259762 | 3300005445 | Bacteria | 1633 |
| 46 | Ga0070663_100113642 | 3300005455 | Bacteria | 2038 |
| 47 | Ga0068867_100231836 | 3300005459 | Bacteria | 1493 |
| 48 | Ga0070685_10127856 | 3300005466 | Bacteria | 1585 |
| 49 | Ga0070706_100075971 | 3300005467 | Bacteria | 3109 |
| 50 | Ga0070679_100040224 | 3300005530 | Bacteria | 4651 |
| 51 | Ga0070679_100169266 | 3300005530 | Bacteria | 2158 |
| 52 | Ga0070684_100278496 | 3300005535 | Bacteria | 1532 |
| 53 | Ga0070697_100096736 | 3300005536 | Bacteria | 2450 |
| 54 | Ga0070686_100273528 | 3300005544 | Bacteria | 1243 |
| 55 | Ga0070665_100138295 | 3300005548 | Bacteria | 2439 |
| 56 | Ga0070665_100406801 | 3300005548 | Bacteria | 1369 |
| 57 | Ga0068855_100020137 | 3300005563 | Bacteria | 8011 |
| 58 | Ga0068857_100711295 | 3300005577 | Bacteria | 955 |
| 59 | Ga0068856_100014461 | 3300005614 | Bacteria | 7624 |
| 60 | Ga0068856_100074638 | 3300005614 | Bacteria | 3358 |
| 61 | Ga0068852_100076686 | 3300005616 | Bacteria | 2952 |
| 62 | Ga0081455_10000678 | 3300005937 | Bacteria | 44138 |
| 63 | Ga0081538_10022183 | 3300005981 | Bacteria | 4608 |
| 64 | Ga0081540_1000084 | 3300005983 | Bacteria | 100067 |
| 65 | Ga0070717_10043803 | 3300006028 | Bacteria | 3653 |
| 66 | Ga0070717_10058354 | 3300006028 | Bacteria | 3191 |
| 67 | Ga0070717_10507154 | 3300006028 | Bacteria | 1091 |
| 68 | Ga0070717_10605889 | 3300006028 | Bacteria | 994 |
| 69 | Ga0075365_10172157 | 3300006038 | Bacteria | 1511 |
| 70 | Ga0075364_10331155 | 3300006051 | Bacteria | 1037 |
| 71 | Ga0070712_100290765 | 3300006175 | Bacteria | 1319 |
| 72 | Ga0075367_10016320 | 3300006178 | Bacteria | 4055 |
| 73 | Ga0075367_10021615 | 3300006178 | Bacteria | 3598 |
| 74 | Ga0075367_10027960 | 3300006178 | Bacteria | 3212 |
| 75 | Ga0075367_10089787 | 3300006178 | Bacteria | 1868 |
| 76 | Ga0075367_10174933 | 3300006178 | Bacteria | 1338 |
| 77 | Ga0097621_100263379 | 3300006237 | Bacteria | 1513 |
| 78 | Ga0075370_10031635 | 3300006353 | Bacteria | 2954 |
| 79 | Ga0075428_100117169 | 3300006844 | Bacteria | 2901 |
| 80 | Ga0075430_100176793 | 3300006846 | Bacteria | 1776 |
| 81 | Ga0075430_100258972 | 3300006846 | Bacteria | 1441 |
| 82 | Ga0075431_100002052 | 3300006847 | Bacteria | 19241 |
| 83 | Ga0075431_100140177 | 3300006847 | Bacteria | 2492 |
| 84 | Ga0075431_100244644 | 3300006847 | Bacteria | 1824 |
| 85 | Ga0075434_100077071 | 3300006871 | Bacteria | 3328 |
| 86 | Ga0075436_100036277 | 3300006914 | Bacteria | 3403 |
| 87 | Ga0075436_100081074 | 3300006914 | Bacteria | 2249 |
| 88 | Ga0079104_1007431 | 3300006946 | Bacteria | 3976 |
| 89 | Ga0099795_10002958 | 3300007788 | Bacteria | 4121 |
| 90 | Ga0099795_10057158 | 3300007788 | Unclassified | 1437 |
| 91 | Ga0099795_10201621 | 3300007788 | Bacteria | 839 |
| 92 | Ga0105251_10000899 | 3300009011 | Bacteria | 26656 |
| 93 | Ga0105244_10004717 | 3300009036 | Bacteria | 9276 |
| 94 | Ga0105240_10205763 | 3300009093 | Bacteria | 2304 |
| 95 | Ga0105245_10024271 | 3300009098 | Bacteria | 5324 |
| 96 | Ga0105247_10504888 | 3300009101 | Bacteria | 882 |
| 97 | Ga0105243_10451603 | 3300009148 | Bacteria | 1206 |
| 98 | Ga0105248_10370749 | 3300009177 | Bacteria | 1612 |
| 99 | Ga0105237_10294087 | 3300009545 | Bacteria | 1627 |
| 100 | Ga0105238_10065743 | 3300009551 | Bacteria | 3628 |
| 101 | Ga0105249_10000037 | 3300009553 | Bacteria | 197428 |
| 102 | Ga0099796_10027047 | 3300010159 | Bacteria | 1828 |
| 103 | Ga0105246_10128565 | 3300011119 | Bacteria | 1889 |
| 104 | Ga0157374_10388131 | 3300013296 | Bacteria | 1392 |
| 105 | Ga0157374_10598752 | 3300013296 | Bacteria | 1112 |
| 106 | Ga0157375_10421267 | 3300013308 | Bacteria | 1501 |
| 107 | Ga0163163_10137627 | 3300014325 | Bacteria | 2483 |
| 108 | Ga0157380_10301336 | 3300014326 | Bacteria | 1476 |
| 109 | Ga0182008_10039260 | 3300014497 | Bacteria | 2366 |
| 110 | Ga0182008_10168834 | 3300014497 | Bacteria | 1104 |
| 111 | Ga0157377_10169136 | 3300014745 | Bacteria | 1366 |
| 112 | Ga0182006_1000163 | 3300015261 | Bacteria | 70369 |
| 113 | Ga0182007_10050117 | 3300015262 | Bacteria | 1379 |
| 114 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 115 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 116 | Ga0213872_10011548 | 3300021361 | Bacteria | 4176 |
| 117 | Ga0213872_10029828 | 3300021361 | Bacteria | 2501 |
| 118 | Ga0228598_1009140 | 3300024227 | Bacteria | 1990 |
| 119 | Ga0209436_102686 | 3300025208 | Bacteria | 5148 |
| 120 | Ga0209437_109774 | 3300025233 | Bacteria | 1484 |
| 121 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 122 | Ga0207425_1000322 | 3300025245 | Bacteria | 34215 |
| 123 | Ga0207425_1000981 | 3300025245 | Bacteria | 13434 |
| 124 | Ga0207425_1042888 | 3300025245 | Bacteria | 854 |
| 125 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 126 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 127 | Ga0209129_1003009 | 3300025258 | Bacteria | 7678 |
| 128 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 129 | Ga0209565_1000705 | 3300025263 | Bacteria | 20479 |
| 130 | Ga0209565_1003734 | 3300025263 | Bacteria | 4821 |
| 131 | Ga0209565_1004134 | 3300025263 | Bacteria | 4512 |
| 132 | Ga0209565_1004591 | 3300025263 | Bacteria | 4166 |
| 133 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 134 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 135 | Ga0209673_1007584 | 3300025273 | Bacteria | 4965 |
| 136 | Ga0209130_1002813 | 3300025284 | Bacteria | 8112 |
| 137 | Ga0209130_1003044 | 3300025284 | Bacteria | 7560 |
| 138 | Ga0209130_1009611 | 3300025284 | Bacteria | 2737 |
| 139 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 140 | Ga0209675_1001114 | 3300025291 | Bacteria | 16367 |
| 141 | Ga0209675_1007283 | 3300025291 | Bacteria | 4277 |
| 142 | Ga0209025_1022619 | 3300025294 | Bacteria | 3325 |
| 143 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 144 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 145 | Ga0209564_1000175 | 3300025295 | Bacteria | 153109 |
| 146 | Ga0209564_1000515 | 3300025295 | Bacteria | 63379 |
| 147 | Ga0209564_1011920 | 3300025295 | Bacteria | 3843 |
| 148 | Ga0209564_1016282 | 3300025295 | Bacteria | 2971 |
| 149 | Ga0209758_1000230 | 3300025297 | Bacteria | 119426 |
| 150 | Ga0209758_1000945 | 3300025297 | Bacteria | 39123 |
| 151 | Ga0209050_1000905 | 3300025298 | Bacteria | 39208 |
| 152 | Ga0209050_1001360 | 3300025298 | Bacteria | 26768 |
| 153 | Ga0209050_1009217 | 3300025298 | Bacteria | 5094 |
| 154 | Ga0209256_1000358 | 3300025299 | Bacteria | 74650 |
| 155 | Ga0209256_1005592 | 3300025299 | Bacteria | 7144 |
| 156 | Ga0209256_1007674 | 3300025299 | Bacteria | 5241 |
| 157 | Ga0207426_1009720 | 3300025302 | Bacteria | 3782 |
| 158 | Ga0209257_1000486 | 3300025304 | Bacteria | 71627 |
| 159 | Ga0209257_1001672 | 3300025304 | Bacteria | 25066 |
| 160 | Ga0209257_1015007 | 3300025304 | Bacteria | 3267 |
| 161 | Ga0207655_1011076 | 3300025728 | Bacteria | 5405 |
| 162 | Ga0207655_1016634 | 3300025728 | Bacteria | 4011 |
| 163 | Ga0207713_1001961 | 3300025735 | Bacteria | 15545 |
| 164 | Ga0207692_10049592 | 3300025898 | Bacteria | 2119 |
| 165 | Ga0207647_10023460 | 3300025904 | Bacteria | 4079 |
| 166 | Ga0207645_10136147 | 3300025907 | Bacteria | 1600 |
| 167 | Ga0207684_10024696 | 3300025910 | Bacteria | 5124 |
| 168 | Ga0207671_10102883 | 3300025914 | Bacteria | 2165 |
| 169 | Ga0207671_10189865 | 3300025914 | Bacteria | 1602 |
| 170 | Ga0207693_10039338 | 3300025915 | Bacteria | 3724 |
| 171 | Ga0207663_10053614 | 3300025916 | Bacteria | 2520 |
| 172 | Ga0207662_10011174 | 3300025918 | Bacteria | 4970 |
| 173 | Ga0207652_10236352 | 3300025921 | Bacteria | 1647 |
| 174 | Ga0207694_10019213 | 3300025924 | Bacteria | 5165 |
| 175 | Ga0207694_10103091 | 3300025924 | Bacteria | 2262 |
| 176 | Ga0207650_10001142 | 3300025925 | Bacteria | 19506 |
| 177 | Ga0207700_10009393 | 3300025928 | Bacteria | 6105 |
| 178 | Ga0207700_10161768 | 3300025928 | Bacteria | 1860 |
| 179 | Ga0207700_10184518 | 3300025928 | Bacteria | 1749 |
| 180 | Ga0207664_10113754 | 3300025929 | Bacteria | 2254 |
| 181 | Ga0207644_10061297 | 3300025931 | Bacteria | 2724 |
| 182 | Ga0207670_10299737 | 3300025936 | Bacteria | 1258 |
| 183 | Ga0207667_10044449 | 3300025949 | Bacteria | 4706 |
| 184 | Ga0207712_10000035 | 3300025961 | Bacteria | 201152 |
| 185 | Ga0207658_10180251 | 3300025986 | Bacteria | 1748 |
| 186 | Ga0207678_10077048 | 3300026067 | Bacteria | 2856 |
| 187 | Ga0207678_10206018 | 3300026067 | Bacteria | 1682 |
| 188 | Ga0207702_10011886 | 3300026078 | Bacteria | 7247 |
| 189 | Ga0207702_10193183 | 3300026078 | Bacteria | 1882 |
| 190 | Ga0207648_10165661 | 3300026089 | Bacteria | 1953 |
| 191 | Ga0207683_10204240 | 3300026121 | Bacteria | 1797 |
| 192 | Ga0207698_10187757 | 3300026142 | Bacteria | 1837 |
| 193 | Ga0209281_1009446 | 3300027111 | Bacteria | 2293 |
| 194 | Ga0209179_1037423 | 3300027512 | Unclassified | 1013 |
| 195 | Ga0268266_10088207 | 3300028379 | Bacteria | 2715 |
| 196 | Ga0307515_10284198 | 3300028794 | Bacteria | 1358 |
| 197 | Ga0265338_10159538 | 3300028800 | Bacteria | 1743 |
| 198 | Ga0265762_1022154 | 3300030760 | Bacteria | 1174 |
| 199 | Ga0265760_10041482 | 3300031090 | Bacteria | 1372 |
| 200 | Ga0265328_10001954 | 3300031239 | Bacteria | 9370 |
| 201 | Ga0265325_10021502 | 3300031241 | Bacteria | 3543 |
| 202 | Ga0265340_10001229 | 3300031247 | Bacteria | 14674 |
| 203 | Ga0265316_10045462 | 3300031344 | Bacteria | 3484 |
| 204 | Ga0307408_100000182 | 3300031548 | Bacteria | 69692 |
| 205 | Ga0307408_100018197 | 3300031548 | Bacteria | 4715 |
| 206 | Ga0307408_100022926 | 3300031548 | Bacteria | 4248 |
| 207 | Ga0307408_100072773 | 3300031548 | Bacteria | 2545 |
| 208 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 209 | Ga0265313_10000712 | 3300031595 | Bacteria | 34316 |
| 210 | Ga0265313_10012923 | 3300031595 | Bacteria | 5061 |
| 211 | Ga0265314_10168522 | 3300031711 | Bacteria | 1325 |
| 212 | Ga0307413_10129592 | 3300031824 | Bacteria | 1724 |
| 213 | Ga0307413_10263531 | 3300031824 | Bacteria | 1286 |
| 214 | Ga0373929_0026892 | 3300035085 | Bacteria | 1205 |
| 215 | Ga0373936_0007469 | 3300035113 | Bacteria | 4111 |
| 216 | Ga0373939_0019460 | 3300035114 | Bacteria | 1832 |
| 217 | Ga0373943_0096282 | 3300035170 | Bacteria | 1541 |
| 218 | Ga0373943_0311422 | 3300035170 | Bacteria | 896 |
| 219 | Ga0373946_0107763 | 3300035171 | Bacteria | 1257 |
| 220 | Ga0373955_0080407 | 3300035172 | Bacteria | 1841 |
| 221 | Ga0373961_0007681 | 3300035241 | Bacteria | 2613 |
| 222 | Ga0373931_0071732 | 3300035691 | Bacteria | 1893 |
| 223 | Ga0373935_0352193 | 3300035692 | Bacteria | 1050 |
| 224 | Ga0373927_0213051 | 3300035695 | Bacteria | 1269 |
| 225 | Ga0373947_0127040 | 3300035725 | Bacteria | 1625 |
| 226 | Ga0373925_0067023 | 3300037068 | Bacteria | 2707 |
| 227 | Ga0395899_0081389 | 3300037312 | Bacteria | 2356 |
| 228 | Ga0395900_0030158 | 3300037418 | Bacteria | 5567 |
| 229 | Ga0395898_0049455 | 3300037466 | Bacteria | 4119 |
| 230 | Ga0395905_0000594 | 3300037471 | Bacteria | 48383 |
| 231 | Ga0436364_0678334 | 3300037853 | Bacteria | 2295 |
| 232 | Ga0436364_1398223 | 3300037853 | Bacteria | 1556 |
| 233 | Ga0395901_0006448 | 3300038443 | Bacteria | 11889 |
| 234 | Ga0436365_0208033 | 3300039437 | Bacteria | 5930 |
| 235 | Ga0436365_0299394 | 3300039437 | Bacteria | 973 |
| 236 | Ga0436361_0012604 | 3300039447 | Bacteria | 4032 |
| 237 | Ga0436361_0084554 | 3300039447 | Bacteria | 3481 |
| 238 | Ga0436361_0570400 | 3300039447 | Bacteria | 111725 |
| 239 | Ga0436361_0815718 | 3300039447 | Bacteria | 1859 |
| 240 | Ga0436361_1210581 | 3300039447 | Bacteria | 3772 |
| 241 | Ga0436362_0512396 | 3300039453 | Bacteria | 1266 |
| 242 | Ga0439465_0021105 | 3300041413 | Bacteria | 2042 |
| 243 | Ga0439445_0004920 | 3300042004 | Bacteria | 3034 |
| 244 | Ga0450909_011505 | 3300042185 | Bacteria | 1296 |
| 245 | Ga0450893_0022753 | 3300042532 | Bacteria | 1087 |
| 246 | Ga0466972_0034160 | 3300044658 | Bacteria | 2493 |
| 247 | Ga0453683_0000921 | 3300044673 | Bacteria | 28022 |
| 248 | Ga0466963_0271432 | 3300044694 | Bacteria | 1191 |
| 249 | Ga0466957_0192372 | 3300044842 | Bacteria | 1337 |
| 250 | Ga0451576_0032096 | 3300045051 | Bacteria | 5597 |
| 251 | Ga0466967_0056663 | 3300045976 | Bacteria | 3456 |
| 252 | Ga0495617_000006 | 3300046452 | Bacteria | 398279 |
| 253 | Ga0495617_002718 | 3300046452 | Bacteria | 6840 |
| 254 | Ga0495617_030614 | 3300046452 | Bacteria | 1808 |
| 255 | Ga0495617_049177 | 3300046452 | Bacteria | 1403 |
| 256 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 257 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 258 | Ga0495590_0000404 | 3300046457 | Bacteria | 21797 |
| 259 | Ga0495590_0035141 | 3300046457 | Bacteria | 1750 |
| 260 | Ga0495629_0217625 | 3300046459 | Bacteria | 1318 |
| 261 | Ga0495638_0000118 | 3300046460 | Bacteria | 127657 |
| 262 | Ga0495638_0258842 | 3300046460 | Bacteria | 955 |
| 263 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 264 | Ga0495650_0000544 | 3300046471 | Bacteria | 53879 |
| 265 | Ga0495650_0003578 | 3300046471 | Bacteria | 11233 |
| 266 | Ga0495639_0011931 | 3300046475 | Bacteria | 3747 |
| 267 | Ga0495584_0001518 | 3300046491 | Bacteria | 13788 |
| 268 | Ga0495584_0092159 | 3300046491 | Bacteria | 1528 |
| 269 | Ga0495585_0012077 | 3300046492 | Bacteria | 5095 |
| 270 | Ga0495585_0105467 | 3300046492 | Bacteria | 1503 |
| 271 | Ga0495585_0117668 | 3300046492 | Bacteria | 1408 |
| 272 | Ga0495607_0018826 | 3300046501 | Bacteria | 4392 |
| 273 | Ga0495607_0102152 | 3300046501 | Bacteria | 1534 |
| 274 | Ga0495607_0126791 | 3300046501 | Bacteria | 1333 |
| 275 | Ga0495607_0127798 | 3300046501 | Bacteria | 1326 |
| 276 | Ga0495583_0000079 | 3300046506 | Bacteria | 169681 |
| 277 | Ga0495583_0000413 | 3300046506 | Bacteria | 64881 |
| 278 | Ga0495606_0000284 | 3300046507 | Bacteria | 88119 |
| 279 | Ga0495606_0000778 | 3300046507 | Bacteria | 48896 |
| 280 | Ga0495606_0001400 | 3300046507 | Bacteria | 32506 |
| 281 | Ga0495606_0002275 | 3300046507 | Bacteria | 22723 |
| 282 | Ga0495606_0012744 | 3300046507 | Bacteria | 6704 |
| 283 | Ga0495606_0033665 | 3300046507 | Bacteria | 3531 |
| 284 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 285 | Ga0495610_0005896 | 3300046512 | Bacteria | 8585 |
| 286 | Ga0495610_0028847 | 3300046512 | Bacteria | 2929 |
| 287 | Ga0495610_0042770 | 3300046512 | Bacteria | 2263 |
| 288 | Ga0495610_0150079 | 3300046512 | Bacteria | 995 |
| 289 | Ga0495616_0001970 | 3300046513 | Bacteria | 13823 |
| 290 | Ga0495618_0079626 | 3300046514 | Bacteria | 2090 |
| 291 | Ga0495630_0084029 | 3300046517 | Bacteria | 2404 |
| 292 | Ga0495630_0108295 | 3300046517 | Bacteria | 2105 |
| 293 | Ga0495637_0002176 | 3300046520 | Bacteria | 10961 |
| 294 | Ga0495637_0003764 | 3300046520 | Bacteria | 8004 |
| 295 | Ga0495643_0000505 | 3300046522 | Bacteria | 48848 |
| 296 | Ga0495643_0000641 | 3300046522 | Bacteria | 41474 |
| 297 | Ga0495644_0000141 | 3300046523 | Bacteria | 34630 |
| 298 | Ga0495644_0011297 | 3300046523 | Bacteria | 3439 |
| 299 | Ga0495648_0000070 | 3300046524 | Bacteria | 136680 |
| 300 | Ga0495648_0003290 | 3300046524 | Bacteria | 14275 |
| 301 | Ga0495648_0012949 | 3300046524 | Bacteria | 6194 |
| 302 | Ga0495648_0029021 | 3300046524 | Bacteria | 3677 |
| 303 | Ga0495648_0048381 | 3300046524 | Bacteria | 2618 |
| 304 | Ga0495654_0000035 | 3300046530 | Bacteria | 192768 |
| 305 | Ga0495640_0067039 | 3300046533 | Bacteria | 2419 |
| 306 | Ga0495609_0001785 | 3300046538 | Bacteria | 13807 |
| 307 | Ga0495609_0003784 | 3300046538 | Bacteria | 8521 |
| 308 | Ga0495609_0019759 | 3300046538 | Bacteria | 3114 |
| 309 | Ga0495609_0020944 | 3300046538 | Bacteria | 3017 |
| 310 | Ga0495597_0000206 | 3300046542 | Bacteria | 53783 |
| 311 | Ga0495597_0000583 | 3300046542 | Bacteria | 30220 |
| 312 | Ga0495597_0010332 | 3300046542 | Bacteria | 4569 |
| 313 | Ga0495645_0207820 | 3300046543 | Bacteria | 1324 |
| 314 | Ga0495622_0000004 | 3300046557 | Bacteria | 258984 |
| 315 | Ga0495622_0000439 | 3300046557 | Bacteria | 26982 |
| 316 | Ga0495622_0061574 | 3300046557 | Bacteria | 1737 |
| 317 | Ga0495633_0000543 | 3300046558 | Bacteria | 37615 |
| 318 | Ga0495633_0015820 | 3300046558 | Bacteria | 3906 |
| 319 | Ga0495633_0027592 | 3300046558 | Bacteria | 2774 |
| 320 | Ga0495633_0034793 | 3300046558 | Bacteria | 2421 |
| 321 | Ga0495633_0042989 | 3300046558 | Bacteria | 2144 |
| 322 | Ga0495668_0000168 | 3300046616 | Bacteria | 97230 |
| 323 | Ga0495668_0007896 | 3300046616 | Bacteria | 6721 |
| 324 | Ga0495634_0002372 | 3300046642 | Bacteria | 15688 |
| 325 | Ga0495611_0006061 | 3300046648 | Bacteria | 5157 |
| 326 | Ga0495611_0028761 | 3300046648 | Bacteria | 2435 |
| 327 | Ga0495611_0039767 | 3300046648 | Bacteria | 2094 |
| 328 | Ga0495625_0000038 | 3300046660 | Bacteria | 211808 |
| 329 | Ga0495625_0009791 | 3300046660 | Bacteria | 7975 |
| 330 | Ga0495625_0025154 | 3300046660 | Bacteria | 4518 |
| 331 | Ga0495625_0025729 | 3300046660 | Bacteria | 4458 |
| 332 | Ga0495635_0169165 | 3300046663 | Bacteria | 1487 |
| 333 | Ga0495635_0349585 | 3300046663 | Bacteria | 986 |
| 334 | Ga0495659_0002213 | 3300046664 | Bacteria | 6331 |
| 335 | Ga0495661_0075199 | 3300046665 | Bacteria | 1963 |
| 336 | Ga0495658_0164715 | 3300046683 | Bacteria | 1369 |
| 337 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 338 | Ga0495671_0014283 | 3300046692 | Bacteria | 4278 |
| 339 | Ga0495671_0165088 | 3300046692 | Bacteria | 1077 |
| 340 | Ga0495649_0004418 | 3300046694 | Bacteria | 9191 |
| 341 | Ga0495660_0010430 | 3300046810 | Bacteria | 5404 |
| 342 | Ga0495660_0010898 | 3300046810 | Bacteria | 5281 |
| 343 | Ga0495660_0017490 | 3300046810 | Bacteria | 4126 |
| 344 | Ga0495581_0181911 | 3300047315 | Bacteria | 1229 |
| 345 | Ga0495636_0001371 | 3300047318 | Bacteria | 9211 |
| 346 | Ga0495672_0000580 | 3300047320 | Bacteria | 41398 |
| 347 | Ga0495672_0006776 | 3300047320 | Bacteria | 8779 |
| 348 | Ga0495672_0157027 | 3300047320 | Bacteria | 1173 |
| 349 | Ga0495683_0003137 | 3300047323 | Bacteria | 9675 |
| 350 | Ga0495683_0130731 | 3300047323 | Bacteria | 1184 |
| 351 | Ga0495687_000235 | 3300047443 | Bacteria | 76976 |
| 352 | Ga0495687_001054 | 3300047443 | Bacteria | 27272 |
| 353 | Ga0495677_0040662 | 3300047445 | Bacteria | 1700 |
| 354 | Ga0495677_0053948 | 3300047445 | Bacteria | 1482 |
| 355 | Ga0495677_0059228 | 3300047445 | Bacteria | 1418 |
| 356 | Ga0495685_000124 | 3300047447 | Bacteria | 26703 |
| 357 | Ga0495685_032572 | 3300047447 | Bacteria | 1791 |
| 358 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 359 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 360 | Ga0495673_0004861 | 3300047469 | Bacteria | 8304 |
| 361 | Ga0495673_0044180 | 3300047469 | Bacteria | 1989 |
| 362 | Ga0495681_0011112 | 3300047470 | Bacteria | 5396 |
| 363 | Ga0495684_0007145 | 3300047471 | Bacteria | 8665 |
| 364 | Ga0495686_0000225 | 3300047472 | Bacteria | 104121 |
| 365 | Ga0495626_0097299 | 3300048091 | Bacteria | 1287 |
| 366 | Ga0496100_0003175 | 3300048903 | Bacteria | 8530 |
| 367 | Ga0496100_0175448 | 3300048903 | Bacteria | 1547 |
| 368 | Ga0496101_0011334 | 3300048904 | Bacteria | 5912 |
| 369 | Ga0496102_0024423 | 3300048905 | Bacteria | 5374 |
| 370 | Ga0496103_0001584 | 3300048906 | Bacteria | 14992 |
| 371 | Ga0496103_0010749 | 3300048906 | Bacteria | 5414 |
| 372 | Ga0496104_0162024 | 3300048907 | Bacteria | 2145 |
| 373 | Ga0496104_0203200 | 3300048907 | Bacteria | 1893 |
| 374 | Ga0496105_0013582 | 3300048908 | Bacteria | 6469 |
| 375 | Ga0496105_0038921 | 3300048908 | Bacteria | 3918 |
| 376 | Ga0496106_0004419 | 3300048909 | Bacteria | 10416 |
| 377 | Ga0496106_0047800 | 3300048909 | Bacteria | 3221 |
| 378 | Ga0496106_0162800 | 3300048909 | Bacteria | 1765 |
| 379 | Ga0496107_0004070 | 3300048910 | Bacteria | 9846 |
| 380 | Ga0496107_0363438 | 3300048910 | Bacteria | 1077 |
| 381 | Ga0496108_0098055 | 3300048911 | Bacteria | 2498 |
| 382 | Ga0496108_0119816 | 3300048911 | Bacteria | 2256 |
| 383 | Ga0496108_0561610 | 3300048911 | Bacteria | 995 |
| 384 | Ga0496109_0122010 | 3300048912 | Bacteria | 2428 |
| 385 | Ga0496109_0356991 | 3300048912 | Bacteria | 1381 |
| 386 | Ga0496110_0004592 | 3300048913 | Bacteria | 10727 |
| 387 | Ga0496110_0082147 | 3300048913 | Bacteria | 2873 |
| 388 | Ga0496111_0002330 | 3300048914 | Bacteria | 11440 |
| 389 | Ga0496111_0012075 | 3300048914 | Bacteria | 5840 |
| 390 | Ga0496111_0446967 | 3300048914 | Bacteria | 954 |
| 391 | Ga0496112_0429502 | 3300048915 | Bacteria | 1259 |
| 392 | Ga0496113_0003040 | 3300048916 | Bacteria | 9934 |
| 393 | Ga0496113_0246690 | 3300048916 | Bacteria | 1425 |
| 394 | Ga0496114_0357938 | 3300048917 | Bacteria | 1291 |
| 395 | Ga0496115_0077196 | 3300048918 | Bacteria | 2708 |
| 396 | Ga0496116_0002803 | 3300048919 | Bacteria | 17907 |
| 397 | Ga0496116_0112840 | 3300048919 | Bacteria | 1591 |
| 398 | Ga0496117_0004917 | 3300048920 | Bacteria | 14352 |
| 399 | Ga0496118_0011800 | 3300048921 | Bacteria | 8481 |
| 400 | Ga0496120_0062985 | 3300048923 | Bacteria | 2065 |
| 401 | Ga0496121_0026163 | 3300048924 | Bacteria | 5509 |
| 402 | Ga0496121_0106374 | 3300048924 | Bacteria | 2150 |
| 403 | Ga0496122_0010350 | 3300048925 | Bacteria | 9639 |
| 404 | Ga0496123_0001851 | 3300048926 | Bacteria | 27757 |
| 405 | Ga0496123_0005622 | 3300048926 | Bacteria | 12520 |
| 406 | Ga0496124_0029688 | 3300048927 | Bacteria | 4865 |
| 407 | Ga0496124_0054969 | 3300048927 | Bacteria | 3367 |
| 408 | Ga0496125_0006825 | 3300048928 | Bacteria | 12248 |
| 409 | Ga0496126_0016990 | 3300048929 | Bacteria | 7259 |
| 410 | Ga0495678_000016 | 3300049459 | Bacteria | 303426 |
| 411 | Ga0495678_000459 | 3300049459 | Bacteria | 40493 |
| 412 | Ga0495678_001634 | 3300049459 | Bacteria | 17062 |
| 413 | Ga0495682_0000233 | 3300049460 | Bacteria | 43866 |
| 414 | Ga0495682_0000357 | 3300049460 | Bacteria | 33463 |
| 415 | Ga0501031_0068465 | 3300049568 | Bacteria | 2313 |
| 416 | Ga0501032_0054250 | 3300049569 | Bacteria | 2698 |
| 417 | Ga0501032_0084420 | 3300049569 | Bacteria | 2111 |
| 418 | Ga0501032_0283834 | 3300049569 | Bacteria | 1072 |
| 419 | Ga0501033_0010717 | 3300049570 | Bacteria | 7026 |
| 420 | Ga0501033_0190894 | 3300049570 | Bacteria | 1466 |
| 421 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 422 | Ga0501034_0004997 | 3300049571 | Bacteria | 14594 |
| 423 | Ga0501034_0010486 | 3300049571 | Bacteria | 9648 |
| 424 | Ga0501034_0132590 | 3300049571 | Bacteria | 2474 |
| 425 | Ga0501034_0232628 | 3300049571 | Bacteria | 1791 |
| 426 | Ga0501034_0251510 | 3300049571 | Bacteria | 1711 |
| 427 | Ga0501036_0000609 | 3300049572 | Bacteria | 25966 |
| 428 | Ga0501036_0018572 | 3300049572 | Bacteria | 5829 |
| 429 | Ga0501037_0007475 | 3300049573 | Bacteria | 7994 |
| 430 | Ga0501037_0007550 | 3300049573 | Bacteria | 7963 |
| 431 | Ga0501037_0281813 | 3300049573 | Bacteria | 1158 |
| 432 | Ga0501038_0024084 | 3300049574 | Bacteria | 5433 |
| 433 | Ga0501038_0053657 | 3300049574 | Bacteria | 3469 |
| 434 | Ga0501043_0002387 | 3300049579 | Bacteria | 15915 |
| 435 | Ga0501043_0011113 | 3300049579 | Bacteria | 7052 |
| 436 | Ga0501043_0053814 | 3300049579 | Bacteria | 3160 |
| 437 | Ga0501046_0019105 | 3300049580 | Bacteria | 5685 |
| 438 | Ga0501046_0074015 | 3300049580 | Bacteria | 2643 |
| 439 | Ga0501047_0000228 | 3300049581 | Bacteria | 66588 |
| 440 | Ga0501047_0076291 | 3300049581 | Bacteria | 3226 |
| 441 | Ga0501047_0082985 | 3300049581 | Bacteria | 3080 |
| 442 | Ga0501047_0114817 | 3300049581 | Bacteria | 2575 |
| 443 | Ga0501047_0525586 | 3300049581 | Bacteria | 1009 |
| 444 | Ga0501048_0000467 | 3300049582 | Bacteria | 28373 |
| 445 | Ga0501048_0002713 | 3300049582 | Bacteria | 13503 |
| 446 | Ga0501048_0426513 | 3300049582 | Bacteria | 949 |
| 447 | Ga0501069_0096343 | 3300049585 | Bacteria | 1676 |
| 448 | Ga0501070_0003235 | 3300049586 | Bacteria | 14160 |
| 449 | Ga0501070_0012221 | 3300049586 | Bacteria | 7244 |
| 450 | Ga0501070_0054946 | 3300049586 | Bacteria | 3301 |
| 451 | Ga0501070_0085942 | 3300049586 | Bacteria | 2604 |
| 452 | Ga0501070_0160053 | 3300049586 | Bacteria | 1856 |
| 453 | Ga0501070_0643803 | 3300049586 | Bacteria | 842 |
| 454 | Ga0501071_0266457 | 3300049587 | Bacteria | 1294 |
| 455 | Ga0501072_0022171 | 3300049588 | Bacteria | 4927 |
| 456 | Ga0501073_0045122 | 3300049589 | Bacteria | 3105 |
| 457 | Ga0501073_0142232 | 3300049589 | Bacteria | 1662 |
| 458 | Ga0501074_0005965 | 3300049590 | Bacteria | 8789 |
| 459 | Ga0501074_0247914 | 3300049590 | Bacteria | 1266 |
| 460 | Ga0501077_0129152 | 3300049593 | Bacteria | 1602 |
| 461 | Ga0501222_004602 | 3300049662 | Bacteria | 1873 |
| 462 | Ga0501079_0187878 | 3300049741 | Bacteria | 1613 |
| 463 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 464 | Ga0501080_0035703 | 3300049742 | Bacteria | 4640 |
| 465 | Ga0501080_0206742 | 3300049742 | Bacteria | 1800 |
| 466 | Ga0501081_0073391 | 3300049743 | Bacteria | 2386 |
| 467 | Ga0501083_0030548 | 3300049744 | Bacteria | 3701 |
| 468 | Ga0501083_0045082 | 3300049744 | Bacteria | 2983 |
| 469 | Ga0501083_0285804 | 3300049744 | Bacteria | 1073 |
| 470 | Ga0501269_000203 | 3300049766 | Bacteria | 17659 |
| 471 | Ga0501279_000515 | 3300049775 | Bacteria | 5081 |
| 472 | Ga0501035_0061354 | 3300049822 | Bacteria | 3346 |
| 473 | Ga0501044_0000960 | 3300049823 | Bacteria | 34653 |
| 474 | Ga0501044_0006265 | 3300049823 | Bacteria | 13150 |
| 475 | Ga0501044_0158666 | 3300049823 | Bacteria | 2240 |
| 476 | Ga0501044_0161662 | 3300049823 | Bacteria | 2216 |
| 477 | nmdc:mga0yw44_243625_c1 | 3300050492 | Bacteria | 1195 |
| 478 | nmdc:mga0yw44_89954_c1 | 3300050492 | Bacteria | 1938 |
| 479 | nmdc:mga06z11_175972_c1 | 3300050494 | Bacteria | 1231 |
| 480 | nmdc:mga06z11_240786_c1 | 3300050494 | Bacteria | 1062 |
| 481 | nmdc:mga06z11_29458_c1 | 3300050494 | Bacteria | 2645 |
| 482 | nmdc:mga07m45_196015_c1 | 3300050496 | Bacteria | 1175 |
| 483 | nmdc:mga05p37_471662_c1 | 3300050507 | Bacteria | 1448 |
| 484 | nmdc:mga09592_586717_c1 | 3300050508 | Bacteria | 956 |
| 485 | nmdc:mga0qj67_14048_c1 | 3300050509 | Bacteria | 6048 |
| 486 | nmdc:mga06r32_10182_c1 | 3300050510 | Bacteria | 8488 |
| 487 | nmdc:mga06r32_17129_c1 | 3300050510 | Bacteria | 6614 |
| 488 | nmdc:mga0n895_307653_c1 | 3300050512 | Bacteria | 1606 |
| 489 | nmdc:mga0n895_75902_c1 | 3300050512 | Bacteria | 3342 |
| 490 | nmdc:mga08x19_25889_c1 | 3300050514 | Bacteria | 3658 |
| 491 | nmdc:mga08x19_85080_c1 | 3300050514 | Bacteria | 2081 |
| 492 | nmdc:mga0sz30_132948_c1 | 3300050516 | Bacteria | 1097 |
| 493 | nmdc:mga0sz30_62938_c1 | 3300050516 | Bacteria | 1587 |
| 494 | Ga0495601_0028359 | 3300053077 | Bacteria | 3468 |
| 495 | Ga0495595_0012310 | 3300053084 | Bacteria | 3593 |
| 496 | Ga0500643_000654 | 3300053087 | Bacteria | 23285 |
| 497 | Ga0500643_041841 | 3300053087 | Bacteria | 1343 |
| 498 | Ga0500566_0000712 | 3300053094 | Bacteria | 18710 |
| 499 | Ga0500618_000371 | 3300053125 | Bacteria | 31102 |
| 500 | Ga0500586_001509 | 3300053145 | Bacteria | 4938 |
| 501 | Ga0500616_0002488 | 3300053153 | Bacteria | 15274 |
| 502 | Ga0500616_0045965 | 3300053153 | Bacteria | 2323 |
| 503 | Ga0501084_0118206 | 3300054114 | Bacteria | 2228 |
| 504 | Ga0501084_0320321 | 3300054114 | Bacteria | 1310 |
| 505 | Ga0501082_0007806 | 3300060353 | Bacteria | 9234 |
| 506 | Ga0501082_0077933 | 3300060353 | Bacteria | 2858 |
| 507 | Ga0501082_0375660 | 3300060353 | Bacteria | 1240 |
| 508 | Ga0501082_0530875 | 3300060353 | Bacteria | 1029 |
| 509 | Ga0530510_0409872 | 3300061734 | Bacteria | 1022 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046501 | Ga0495607_0126791 | Ga0495607_0126791_481_1182 | 220 |
| 2 | 3300053125 | Ga0500618_000371 | Ga0500618_000371_20997_21740 | 235 |
| 3 | 3300037471 | Ga0395905_0000594 | Ga0395905_0000594_30328_31077 | 238 |
| 4 | 3300046507 | Ga0495606_0002275 | Ga0495606_0002275_2315_3058 | 238 |
| 5 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_291435_292181 | 239 |
| 6 | 3300049582 | Ga0501048_0426513 | Ga0501048_0426513_218_937 | 239 |
| 7 | 3300053087 | Ga0500643_000654 | Ga0500643_000654_21559_22284 | 241 |
| 8 | 3300053087 | Ga0500643_041841 | Ga0500643_041841_104_829 | 241 |
| 9 | 3300046457 | Ga0495590_0000003 | Ga0495590_0000003_70646_71374 | 242 |
| 10 | 3300046460 | Ga0495638_0000118 | Ga0495638_0000118_27528_28256 | 242 |
| 11 | 3300046471 | Ga0495650_0003578 | Ga0495650_0003578_1530_2258 | 242 |
| 12 | 3300046501 | Ga0495607_0102152 | Ga0495607_0102152_569_1297 | 242 |
| 13 | 3300046506 | Ga0495583_0000079 | Ga0495583_0000079_70423_71151 | 242 |
| 14 | 3300046522 | Ga0495643_0000641 | Ga0495643_0000641_20057_20785 | 242 |
| 15 | 3300046524 | Ga0495648_0000070 | Ga0495648_0000070_27605_28333 | 242 |
| 16 | 3300046542 | Ga0495597_0000206 | Ga0495597_0000206_22299_23027 | 242 |
| 17 | 3300046557 | Ga0495622_0000439 | Ga0495622_0000439_1497_2225 | 242 |
| 18 | 3300046558 | Ga0495633_0015820 | Ga0495633_0015820_622_1350 | 242 |
| 19 | 3300046616 | Ga0495668_0000168 | Ga0495668_0000168_26524_27252 | 242 |
| 20 | 3300046660 | Ga0495625_0000038 | Ga0495625_0000038_686_1414 | 242 |
| 21 | iso_pu_bacteria | 2643221554 | 2643788201 | 242 |
| 22 | 3300039447 | Ga0436361_0012604 | Ga0436361_0012604_2447_3178 | 243 |
| 23 | iso_pu_bacteria | 2643221638 | 2644213858 | 243 |
| 24 | iso_pu_bacteria | 2821131069 | 2821133618 | 243 |
| 25 | iso_pu_bacteria | 2857564685 | 2857565407 | 243 |
| 26 | 3300005437 | Ga0070710_10028780 | Ga0070710_100287804 | 245 |
| 27 | 3300025898 | Ga0207692_10049592 | Ga0207692_100495922 | 245 |
| 28 | 3300002738 | JGI25154J39366_1000950 | JGI25154J39366_100095011 | 246 |
| 29 | 3300002774 | JGI25150J39212_1008395 | JGI25150J39212_10083951 | 246 |
| 30 | 3300003187 | JGI25151J46595_10058463 | JGI25151J46595_100584632 | 246 |
| 31 | 3300003215 | JGI25153J46596_10012733 | JGI25153J46596_100127331 | 246 |
| 32 | 3300003322 | rootL2_10008003 | rootL2_100080037 | 246 |
| 33 | 3300003763 | Ga0055529_1000185 | Ga0055529_100018564 | 246 |
| 34 | 3300003763 | Ga0055529_1000208 | Ga0055529_10002086 | 246 |
| 35 | 3300003771 | Ga0055526_1000077 | Ga0055526_100007769 | 246 |
| 36 | 3300003771 | Ga0055526_1000094 | Ga0055526_10000944 | 246 |
| 37 | 3300003771 | Ga0055526_1000520 | Ga0055526_10005207 | 246 |
| 38 | 3300003771 | Ga0055526_1002339 | Ga0055526_100233914 | 246 |
| 39 | 3300003773 | Ga0055537_1000072 | Ga0055537_100007244 | 246 |
| 40 | 3300003773 | Ga0055537_1003085 | Ga0055537_10030859 | 246 |
| 41 | 3300003784 | Ga0055534_1000136 | Ga0055534_100013631 | 246 |
| 42 | 3300003784 | Ga0055534_1002853 | Ga0055534_10028537 | 246 |
| 43 | 3300003790 | Ga0055528_1000025 | Ga0055528_100002598 | 246 |
| 44 | 3300003790 | Ga0055528_1014804 | Ga0055528_10148043 | 246 |
| 45 | 3300003791 | Ga0055530_10004993 | Ga0055530_100049932 | 246 |
| 46 | 3300003794 | Ga0055531_10001881 | Ga0055531_1000188116 | 246 |
| 47 | 3300005445 | Ga0070708_100259762 | Ga0070708_1002597621 | 246 |
| 48 | 3300005467 | Ga0070706_100075971 | Ga0070706_1000759713 | 246 |
| 49 | 3300005536 | Ga0070697_100096736 | Ga0070697_1000967363 | 246 |
| 50 | 3300006175 | Ga0070712_100290765 | Ga0070712_1002907651 | 246 |
| 51 | 3300007788 | Ga0099795_10201621 | Ga0099795_102016211 | 246 |
| 52 | 3300009036 | Ga0105244_10004717 | Ga0105244_1000471711 | 246 |
| 53 | 3300010159 | Ga0099796_10027047 | Ga0099796_100270472 | 246 |
| 54 | 3300025233 | Ga0209437_109774 | Ga0209437_1097742 | 246 |
| 55 | 3300025245 | Ga0207425_1000322 | Ga0207425_100032223 | 246 |
| 56 | 3300025245 | Ga0207425_1000981 | Ga0207425_10009813 | 246 |
| 57 | 3300025246 | Ga0209646_1000028 | Ga0209646_1000028264 | 246 |
| 58 | 3300025258 | Ga0209129_1003009 | Ga0209129_10030092 | 246 |
| 59 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009441 | 246 |
| 60 | 3300025263 | Ga0209565_1000705 | Ga0209565_100070514 | 246 |
| 61 | 3300025272 | Ga0209455_1000049 | Ga0209455_100004966 | 246 |
| 62 | 3300025273 | Ga0209673_1000036 | Ga0209673_1000036241 | 246 |
| 63 | 3300025273 | Ga0209673_1007584 | Ga0209673_10075842 | 246 |
| 64 | 3300025284 | Ga0209130_1002813 | Ga0209130_100281310 | 246 |
| 65 | 3300025291 | Ga0209675_1000013 | Ga0209675_1000013241 | 246 |
| 66 | 3300025291 | Ga0209675_1001114 | Ga0209675_100111416 | 246 |
| 67 | 3300025294 | Ga0209025_1022619 | Ga0209025_10226194 | 246 |
| 68 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009861 | 246 |
| 69 | 3300025295 | Ga0209564_1000045 | Ga0209564_1000045279 | 246 |
| 70 | 3300025295 | Ga0209564_1000515 | Ga0209564_100051516 | 246 |
| 71 | 3300025295 | Ga0209564_1016282 | Ga0209564_10162822 | 246 |
| 72 | 3300025297 | Ga0209758_1000945 | Ga0209758_10009454 | 246 |
| 73 | 3300025298 | Ga0209050_1000905 | Ga0209050_10009053 | 246 |
| 74 | 3300025299 | Ga0209256_1000358 | Ga0209256_10003584 | 246 |
| 75 | 3300025299 | Ga0209256_1005592 | Ga0209256_10055928 | 246 |
| 76 | 3300025304 | Ga0209257_1000486 | Ga0209257_100048612 | 246 |
| 77 | 3300025304 | Ga0209257_1001672 | Ga0209257_10016724 | 246 |
| 78 | 3300025728 | Ga0207655_1016634 | Ga0207655_10166345 | 246 |
| 79 | 3300025910 | Ga0207684_10024696 | Ga0207684_100246966 | 246 |
| 80 | 3300035114 | Ga0373939_0019460 | Ga0373939_0019460_1002_1745 | 246 |
| 81 | 3300046452 | Ga0495617_000006 | Ga0495617_000006_224023_224766 | 246 |
| 82 | 3300046463 | Ga0495653_0000011 | Ga0495653_0000011_118449_119192 | 246 |
| 83 | 3300046471 | Ga0495650_0000544 | Ga0495650_0000544_25527_26270 | 246 |
| 84 | 3300046501 | Ga0495607_0018826 | Ga0495607_0018826_2999_3742 | 246 |
| 85 | 3300046507 | Ga0495606_0000284 | Ga0495606_0000284_68044_68787 | 246 |
| 86 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_221077_221820 | 246 |
| 87 | 3300046512 | Ga0495610_0150079 | Ga0495610_0150079_52_795 | 246 |
| 88 | 3300046520 | Ga0495637_0002176 | Ga0495637_0002176_8142_8891 | 246 |
| 89 | 3300046520 | Ga0495637_0003764 | Ga0495637_0003764_3876_4619 | 246 |
| 90 | 3300046524 | Ga0495648_0029021 | Ga0495648_0029021_717_1460 | 246 |
| 91 | 3300046530 | Ga0495654_0000035 | Ga0495654_0000035_171076_171819 | 246 |
| 92 | 3300046558 | Ga0495633_0034793 | Ga0495633_0034793_1041_1784 | 246 |
| 93 | 3300046616 | Ga0495668_0007896 | Ga0495668_0007896_5102_5845 | 246 |
| 94 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_872587_873330 | 246 |
| 95 | 3300046692 | Ga0495671_0014283 | Ga0495671_0014283_3217_3960 | 246 |
| 96 | 3300047323 | Ga0495683_0130731 | Ga0495683_0130731_158_907 | 246 |
| 97 | 3300047469 | Ga0495673_0000014 | Ga0495673_0000014_111179_111922 | 246 |
| 98 | 3300048903 | Ga0496100_0175448 | Ga0496100_0175448_756_1502 | 246 |
| 99 | 3300048910 | Ga0496107_0363438 | Ga0496107_0363438_114_857 | 246 |
| 100 | 3300048914 | Ga0496111_0012075 | Ga0496111_0012075_4586_5329 | 246 |
| 101 | 3300048923 | Ga0496120_0062985 | Ga0496120_0062985_388_1131 | 246 |
| 102 | 3300048924 | Ga0496121_0106374 | Ga0496121_0106374_1371_2114 | 246 |
| 103 | 3300048926 | Ga0496123_0001851 | Ga0496123_0001851_4944_5687 | 246 |
| 104 | 3300048929 | Ga0496126_0016990 | Ga0496126_0016990_6252_6995 | 246 |
| 105 | iso_pu_bacteria | 2857558681 | 2857563893 | 246 |
| 106 | 3300002774 | JGI25150J39212_1001896 | JGI25150J39212_10018963 | 247 |
| 107 | 3300002987 | JGI25159J45721_1005133 | JGI25159J45721_10051333 | 247 |
| 108 | 3300003215 | JGI25153J46596_10004738 | JGI25153J46596_100047382 | 247 |
| 109 | 3300003374 | JGI25161J50226_1002163 | JGI25161J50226_10021634 | 247 |
| 110 | 3300003771 | Ga0055526_1008933 | Ga0055526_10089333 | 247 |
| 111 | 3300003773 | Ga0055537_1007247 | Ga0055537_10072472 | 247 |
| 112 | 3300003775 | Ga0055524_1006612 | Ga0055524_10066124 | 247 |
| 113 | 3300003784 | Ga0055534_1004569 | Ga0055534_10045693 | 247 |
| 114 | 3300003791 | Ga0055530_10006345 | Ga0055530_100063454 | 247 |
| 115 | 3300003791 | Ga0055530_10007919 | Ga0055530_100079194 | 247 |
| 116 | 3300003794 | Ga0055531_10035924 | Ga0055531_100359242 | 247 |
| 117 | 3300004625 | Ga0055543_1002960 | Ga0055543_10029603 | 247 |
| 118 | 3300005262 | Ga0065165_1007580 | Ga0065165_10075803 | 247 |
| 119 | 3300005436 | Ga0070713_100080136 | Ga0070713_1000801362 | 247 |
| 120 | 3300005614 | Ga0068856_100014461 | Ga0068856_1000144616 | 247 |
| 121 | 3300006028 | Ga0070717_10058354 | Ga0070717_100583542 | 247 |
| 122 | 3300006914 | Ga0075436_100081074 | Ga0075436_1000810743 | 247 |
| 123 | 3300014497 | Ga0182008_10039260 | Ga0182008_100392603 | 247 |
| 124 | 3300025208 | Ga0209436_102686 | Ga0209436_1026863 | 247 |
| 125 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011997 | 247 |
| 126 | 3300025245 | Ga0207425_1042888 | Ga0207425_10428881 | 247 |
| 127 | 3300025258 | Ga0209129_1000001 | Ga0209129_10000011174 | 247 |
| 128 | 3300025263 | Ga0209565_1003734 | Ga0209565_10037344 | 247 |
| 129 | 3300025263 | Ga0209565_1004134 | Ga0209565_10041343 | 247 |
| 130 | 3300025263 | Ga0209565_1004591 | Ga0209565_10045913 | 247 |
| 131 | 3300025284 | Ga0209130_1003044 | Ga0209130_10030446 | 247 |
| 132 | 3300025284 | Ga0209130_1009611 | Ga0209130_10096112 | 247 |
| 133 | 3300025291 | Ga0209675_1007283 | Ga0209675_10072833 | 247 |
| 134 | 3300025295 | Ga0209564_1000175 | Ga0209564_100017575 | 247 |
| 135 | 3300025295 | Ga0209564_1011920 | Ga0209564_10119203 | 247 |
| 136 | 3300025297 | Ga0209758_1000230 | Ga0209758_100023042 | 247 |
| 137 | 3300025298 | Ga0209050_1001360 | Ga0209050_10013603 | 247 |
| 138 | 3300025298 | Ga0209050_1009217 | Ga0209050_10092174 | 247 |
| 139 | 3300025299 | Ga0209256_1007674 | Ga0209256_10076743 | 247 |
| 140 | 3300025304 | Ga0209257_1015007 | Ga0209257_10150074 | 247 |
| 141 | 3300025916 | Ga0207663_10053614 | Ga0207663_100536143 | 247 |
| 142 | 3300025928 | Ga0207700_10009393 | Ga0207700_100093937 | 247 |
| 143 | 3300025928 | Ga0207700_10161768 | Ga0207700_101617682 | 247 |
| 144 | 3300025929 | Ga0207664_10113754 | Ga0207664_101137543 | 247 |
| 145 | 3300026067 | Ga0207678_10206018 | Ga0207678_102060182 | 247 |
| 146 | 3300026078 | Ga0207702_10011886 | Ga0207702_100118866 | 247 |
| 147 | 3300031548 | Ga0307408_100000182 | Ga0307408_10000018249 | 247 |
| 148 | 3300031548 | Ga0307408_100018197 | Ga0307408_1000181975 | 247 |
| 149 | 3300031548 | Ga0307408_100022926 | Ga0307408_1000229264 | 247 |
| 150 | 3300035085 | Ga0373929_0026892 | Ga0373929_0026892_380_1135 | 247 |
| 151 | 3300042532 | Ga0450893_0022753 | Ga0450893_0022753_56_805 | 247 |
| 152 | 3300044673 | Ga0453683_0000921 | Ga0453683_0000921_8177_8932 | 247 |
| 153 | 3300045051 | Ga0451576_0032096 | Ga0451576_0032096_3857_4612 | 247 |
| 154 | 3300046475 | Ga0495639_0011931 | Ga0495639_0011931_2401_3153 | 247 |
| 155 | 3300046538 | Ga0495609_0019759 | Ga0495609_0019759_1916_2668 | 247 |
| 156 | 3300046660 | Ga0495625_0025154 | Ga0495625_0025154_3753_4508 | 247 |
| 157 | 3300046810 | Ga0495660_0017490 | Ga0495660_0017490_1484_2236 | 247 |
| 158 | 3300047443 | Ga0495687_001054 | Ga0495687_001054_25527_26279 | 247 |
| 159 | 3300047445 | Ga0495677_0059228 | Ga0495677_0059228_419_1171 | 247 |
| 160 | 3300048914 | Ga0496111_0446967 | Ga0496111_0446967_139_894 | 247 |
| 161 | 3300048915 | Ga0496112_0429502 | Ga0496112_0429502_23_778 | 247 |
| 162 | 3300048916 | Ga0496113_0246690 | Ga0496113_0246690_603_1358 | 247 |
| 163 | 3300049587 | Ga0501071_0266457 | Ga0501071_0266457_10_753 | 247 |
| 164 | 3300049662 | Ga0501222_004602 | Ga0501222_004602_270_1013 | 247 |
| 165 | 3300049775 | Ga0501279_000515 | Ga0501279_000515_1229_1978 | 247 |
| 166 | 3300050514 | nmdc:mga08x19_85080_c1 | nmdc:mga08x19_85080_c1_231_986 | 247 |
| 167 | iso_pu_bacteria | 2842711865 | 2842716771 | 247 |
| 168 | 3300005435 | Ga0070714_100149349 | Ga0070714_1001493492 | 248 |
| 169 | 3300006028 | Ga0070717_10043803 | Ga0070717_100438033 | 248 |
| 170 | 3300006028 | Ga0070717_10605889 | Ga0070717_106058892 | 248 |
| 171 | 3300007788 | Ga0099795_10002958 | Ga0099795_100029583 | 248 |
| 172 | 3300014497 | Ga0182008_10168834 | Ga0182008_101688342 | 248 |
| 173 | 3300028794 | Ga0307515_10284198 | Ga0307515_102841982 | 248 |
| 174 | 3300039447 | Ga0436361_0815718 | Ga0436361_0815718_1036_1788 | 248 |
| 175 | 3300046512 | Ga0495610_0005896 | Ga0495610_0005896_4873_5631 | 248 |
| 176 | 3300046522 | Ga0495643_0000505 | Ga0495643_0000505_24906_25664 | 248 |
| 177 | 3300046524 | Ga0495648_0012949 | Ga0495648_0012949_680_1438 | 248 |
| 178 | 3300046538 | Ga0495609_0020944 | Ga0495609_0020944_1962_2720 | 248 |
| 179 | 3300046542 | Ga0495597_0000583 | Ga0495597_0000583_27805_28566 | 248 |
| 180 | 3300046558 | Ga0495633_0000543 | Ga0495633_0000543_622_1386 | 248 |
| 181 | 3300046558 | Ga0495633_0027592 | Ga0495633_0027592_1817_2581 | 248 |
| 182 | 3300046692 | Ga0495671_0165088 | Ga0495671_0165088_199_957 | 248 |
| 183 | 3300047320 | Ga0495672_0000580 | Ga0495672_0000580_20493_21251 | 248 |
| 184 | 3300047445 | Ga0495677_0040662 | Ga0495677_0040662_667_1425 | 248 |
| 185 | 3300049459 | Ga0495678_000459 | Ga0495678_000459_10676_11434 | 248 |
| 186 | 3300053145 | Ga0500586_001509 | Ga0500586_001509_1976_2740 | 248 |
| 187 | 3300035691 | Ga0373931_0071732 | Ga0373931_0071732_351_1115 | 249 |
| 188 | 3300009148 | Ga0105243_10451603 | Ga0105243_104516031 | 250 |
| 189 | 3300037853 | Ga0436364_0678334 | Ga0436364_0678334_710_1474 | 250 |
| 190 | 3300042185 | Ga0450909_011505 | Ga0450909_011505_189_956 | 250 |
| 191 | 3300046507 | Ga0495606_0001400 | Ga0495606_0001400_29061_29855 | 250 |
| 192 | 3300005577 | Ga0068857_100711295 | Ga0068857_1007112952 | 251 |
| 193 | 3300009098 | Ga0105245_10024271 | Ga0105245_100242712 | 253 |
| 194 | 3300046452 | Ga0495617_002718 | Ga0495617_002718_4905_5738 | 253 |
| 195 | 3300046507 | Ga0495606_0012744 | Ga0495606_0012744_518_1339 | 253 |
| 196 | 3300046507 | Ga0495606_0033665 | Ga0495606_0033665_588_1433 | 253 |
| 197 | 3300046512 | Ga0495610_0028847 | Ga0495610_0028847_50_871 | 253 |
| 198 | 3300047447 | Ga0495685_032572 | Ga0495685_032572_849_1664 | 253 |
| 199 | 3300006178 | Ga0075367_10174933 | Ga0075367_101749331 | 254 |
| 200 | 3300046660 | Ga0495625_0009791 | Ga0495625_0009791_4800_5621 | 255 |
| 201 | 3300046694 | Ga0495649_0004418 | Ga0495649_0004418_3530_4351 | 255 |
| 202 | 3300013308 | Ga0157375_10421267 | Ga0157375_104212672 | 257 |
| 203 | 3300049581 | Ga0501047_0082985 | Ga0501047_0082985_820_1599 | 257 |
| 204 | iso_pu_bacteria | 2891088606 | 2891089438 | 257 |
| 205 | 3300006237 | Ga0097621_100263379 | Ga0097621_1002633791 | 258 |
| 206 | 3300053153 | Ga0500616_0002488 | Ga0500616_0002488_13709_14485 | 258 |
| 207 | iso_pu_bacteria | 2857553236 | 2857553724 | 259 |
| 208 | iso_pu_bacteria | 2904424332 | 2904430455 | 259 |
| 209 | iso_pu_bacteria | 2919476304 | 2919480352 | 259 |
| 210 | 3300005340 | Ga0070689_100185066 | Ga0070689_1001850661 | 260 |
| 211 | 3300005466 | Ga0070685_10127856 | Ga0070685_101278563 | 260 |
| 212 | 3300025918 | Ga0207662_10011174 | Ga0207662_100111742 | 260 |
| 213 | 3300025936 | Ga0207670_10299737 | Ga0207670_102997372 | 260 |
| 214 | 3300031247 | Ga0265340_10001229 | Ga0265340_1000122916 | 260 |
| 215 | 3300031344 | Ga0265316_10045462 | Ga0265316_100454624 | 260 |
| 216 | 3300031595 | Ga0265313_10000712 | Ga0265313_1000071230 | 260 |
| 217 | 3300039437 | Ga0436365_0299394 | Ga0436365_0299394_62_850 | 260 |
| 218 | 3300049568 | Ga0501031_0068465 | Ga0501031_0068465_1355_2137 | 260 |
| 219 | 3300049569 | Ga0501032_0283834 | Ga0501032_0283834_232_1014 | 260 |
| 220 | 3300049571 | Ga0501034_0132590 | Ga0501034_0132590_498_1280 | 260 |
| 221 | 3300049572 | Ga0501036_0018572 | Ga0501036_0018572_2002_2784 | 260 |
| 222 | 3300049574 | Ga0501038_0053657 | Ga0501038_0053657_2067_2849 | 260 |
| 223 | 3300049581 | Ga0501047_0114817 | Ga0501047_0114817_1227_2009 | 260 |
| 224 | 3300049586 | Ga0501070_0054946 | Ga0501070_0054946_611_1393 | 260 |
| 225 | 3300049742 | Ga0501080_0206742 | Ga0501080_0206742_386_1168 | 260 |
| 226 | 3300049823 | Ga0501044_0158666 | Ga0501044_0158666_322_1104 | 260 |
| 227 | 3300006946 | Ga0079104_1007431 | Ga0079104_10074314 | 261 |
| 228 | 3300027111 | Ga0209281_1009446 | Ga0209281_10094462 | 261 |
| 229 | 3300031239 | Ga0265328_10001954 | Ga0265328_100019542 | 261 |
| 230 | 3300046558 | Ga0495633_0042989 | Ga0495633_0042989_849_1646 | 261 |
| 231 | 3300046810 | Ga0495660_0010430 | Ga0495660_0010430_1706_2497 | 261 |
| 232 | 3300048906 | Ga0496103_0001584 | Ga0496103_0001584_5084_5881 | 261 |
| 233 | 3300048917 | Ga0496114_0357938 | Ga0496114_0357938_123_920 | 261 |
| 234 | 3300048919 | Ga0496116_0112840 | Ga0496116_0112840_706_1497 | 261 |
| 235 | 3300049588 | Ga0501072_0022171 | Ga0501072_0022171_2465_3250 | 261 |
| 236 | 3300049589 | Ga0501073_0142232 | Ga0501073_0142232_382_1167 | 261 |
| 237 | 3300049742 | Ga0501080_0035703 | Ga0501080_0035703_2618_3403 | 261 |
| 238 | 3300049744 | Ga0501083_0045082 | Ga0501083_0045082_1543_2328 | 261 |
| 239 | 3300053084 | Ga0495595_0012310 | Ga0495595_0012310_2692_3498 | 261 |
| 240 | 3300054114 | Ga0501084_0118206 | Ga0501084_0118206_255_1040 | 261 |
| 241 | 3300005367 | Ga0070667_100342851 | Ga0070667_1003428512 | 262 |
| 242 | 3300006847 | Ga0075431_100002052 | Ga0075431_10000205219 | 262 |
| 243 | 3300046557 | Ga0495622_0000004 | Ga0495622_0000004_236567_237358 | 262 |
| 244 | 3300050510 | nmdc:mga06r32_17129_c1 | nmdc:mga06r32_17129_c1_4818_5612 | 262 |
| 245 | iso_pu_bacteria | 2889790730 | 2889795965 | 262 |
| 246 | iso_pu_bacteria | 2889914905 | 2889918682 | 262 |
| 247 | 3300021361 | Ga0213872_10000002 | Ga0213872_1000000274 | 263 |
| 248 | 3300021361 | Ga0213872_10011548 | Ga0213872_100115485 | 263 |
| 249 | 3300039447 | Ga0436361_0570400 | Ga0436361_0570400_28137_28937 | 263 |
| 250 | 3300039447 | Ga0436361_1210581 | Ga0436361_1210581_2032_2832 | 263 |
| 251 | 3300046507 | Ga0495606_0000778 | Ga0495606_0000778_39031_39825 | 263 |
| 252 | 3300049581 | Ga0501047_0525586 | Ga0501047_0525586_18_818 | 263 |
| 253 | 3300005327 | Ga0070658_10115505 | Ga0070658_101155053 | 264 |
| 254 | 3300005530 | Ga0070679_100040224 | Ga0070679_1000402244 | 264 |
| 255 | 3300005530 | Ga0070679_100169266 | Ga0070679_1001692662 | 264 |
| 256 | 3300005535 | Ga0070684_100278496 | Ga0070684_1002784962 | 264 |
| 257 | 3300005563 | Ga0068855_100020137 | Ga0068855_1000201378 | 264 |
| 258 | 3300005614 | Ga0068856_100074638 | Ga0068856_1000746383 | 264 |
| 259 | 3300005616 | Ga0068852_100076686 | Ga0068852_1000766863 | 264 |
| 260 | 3300006051 | Ga0075364_10331155 | Ga0075364_103311552 | 264 |
| 261 | 3300021361 | Ga0213872_10029828 | Ga0213872_100298282 | 264 |
| 262 | 3300025728 | Ga0207655_1011076 | Ga0207655_10110762 | 264 |
| 263 | 3300025921 | Ga0207652_10236352 | Ga0207652_102363522 | 264 |
| 264 | 3300025924 | Ga0207694_10103091 | Ga0207694_101030912 | 264 |
| 265 | 3300025949 | Ga0207667_10044449 | Ga0207667_100444492 | 264 |
| 266 | 3300026078 | Ga0207702_10193183 | Ga0207702_101931832 | 264 |
| 267 | 3300026142 | Ga0207698_10187757 | Ga0207698_101877572 | 264 |
| 268 | 3300035171 | Ga0373946_0107763 | Ga0373946_0107763_324_1127 | 264 |
| 269 | 3300037312 | Ga0395899_0081389 | Ga0395899_0081389_141_935 | 264 |
| 270 | 3300037418 | Ga0395900_0030158 | Ga0395900_0030158_2925_3719 | 264 |
| 271 | 3300037466 | Ga0395898_0049455 | Ga0395898_0049455_883_1677 | 264 |
| 272 | 3300038443 | Ga0395901_0006448 | Ga0395901_0006448_2993_3787 | 264 |
| 273 | 3300039447 | Ga0436361_0084554 | Ga0436361_0084554_1474_2277 | 264 |
| 274 | 3300046453 | Ga0495627_000005 | Ga0495627_000005_162350_163165 | 264 |
| 275 | 3300046459 | Ga0495629_0217625 | Ga0495629_0217625_207_1010 | 264 |
| 276 | 3300046517 | Ga0495630_0108295 | Ga0495630_0108295_919_1722 | 264 |
| 277 | 3300046523 | Ga0495644_0011297 | Ga0495644_0011297_1717_2532 | 264 |
| 278 | 3300046538 | Ga0495609_0003784 | Ga0495609_0003784_2074_2889 | 264 |
| 279 | 3300046810 | Ga0495660_0010898 | Ga0495660_0010898_2988_3803 | 264 |
| 280 | 3300047320 | Ga0495672_0157027 | Ga0495672_0157027_346_1149 | 264 |
| 281 | 3300047470 | Ga0495681_0011112 | Ga0495681_0011112_2563_3378 | 264 |
| 282 | 3300048911 | Ga0496108_0561610 | Ga0496108_0561610_164_964 | 264 |
| 283 | 3300048927 | Ga0496124_0029688 | Ga0496124_0029688_3760_4575 | 264 |
| 284 | 3300049459 | Ga0495678_000016 | Ga0495678_000016_138168_138983 | 264 |
| 285 | 3300049569 | Ga0501032_0054250 | Ga0501032_0054250_558_1358 | 264 |
| 286 | 3300049569 | Ga0501032_0084420 | Ga0501032_0084420_743_1543 | 264 |
| 287 | 3300049571 | Ga0501034_0004997 | Ga0501034_0004997_11453_12253 | 264 |
| 288 | 3300049571 | Ga0501034_0251510 | Ga0501034_0251510_816_1616 | 264 |
| 289 | 3300049572 | Ga0501036_0000609 | Ga0501036_0000609_12411_13211 | 264 |
| 290 | 3300049573 | Ga0501037_0007475 | Ga0501037_0007475_2014_2814 | 264 |
| 291 | 3300049573 | Ga0501037_0007550 | Ga0501037_0007550_534_1334 | 264 |
| 292 | 3300049574 | Ga0501038_0024084 | Ga0501038_0024084_3120_3920 | 264 |
| 293 | 3300049579 | Ga0501043_0002387 | Ga0501043_0002387_2422_3222 | 264 |
| 294 | 3300049579 | Ga0501043_0011113 | Ga0501043_0011113_652_1452 | 264 |
| 295 | 3300049579 | Ga0501043_0053814 | Ga0501043_0053814_1541_2341 | 264 |
| 296 | 3300049580 | Ga0501046_0019105 | Ga0501046_0019105_3272_4072 | 264 |
| 297 | 3300049580 | Ga0501046_0074015 | Ga0501046_0074015_596_1396 | 264 |
| 298 | 3300049581 | Ga0501047_0000228 | Ga0501047_0000228_25023_25823 | 264 |
| 299 | 3300049582 | Ga0501048_0000467 | Ga0501048_0000467_25023_25838 | 264 |
| 300 | 3300049586 | Ga0501070_0003235 | Ga0501070_0003235_8755_9555 | 264 |
| 301 | 3300049586 | Ga0501070_0012221 | Ga0501070_0012221_4921_5721 | 264 |
| 302 | 3300049590 | Ga0501074_0005965 | Ga0501074_0005965_6459_7259 | 264 |
| 303 | 3300049742 | Ga0501080_0000112 | Ga0501080_0000112_53583_54383 | 264 |
| 304 | 3300049744 | Ga0501083_0030548 | Ga0501083_0030548_2816_3616 | 264 |
| 305 | 3300049766 | Ga0501269_000203 | Ga0501269_000203_15566_16384 | 264 |
| 306 | 3300049822 | Ga0501035_0061354 | Ga0501035_0061354_1342_2142 | 264 |
| 307 | 3300049823 | Ga0501044_0006265 | Ga0501044_0006265_1794_2594 | 264 |
| 308 | 3300053094 | Ga0500566_0000712 | Ga0500566_0000712_13839_14633 | 264 |
| 309 | 3300005329 | Ga0070683_100341906 | Ga0070683_1003419062 | 265 |
| 310 | 3300006178 | Ga0075367_10089787 | Ga0075367_100897873 | 265 |
| 311 | 3300006353 | Ga0075370_10031635 | Ga0075370_100316353 | 265 |
| 312 | 3300031824 | Ga0307413_10263531 | Ga0307413_102635312 | 265 |
| 313 | 3300035170 | Ga0373943_0311422 | Ga0373943_0311422_76_882 | 265 |
| 314 | 3300042004 | Ga0439445_0004920 | Ga0439445_0004920_1023_1820 | 265 |
| 315 | 3300044694 | Ga0466963_0271432 | Ga0466963_0271432_146_943 | 265 |
| 316 | 3300044842 | Ga0466957_0192372 | Ga0466957_0192372_286_1086 | 265 |
| 317 | 3300045976 | Ga0466967_0056663 | Ga0466967_0056663_2488_3285 | 265 |
| 318 | 3300046452 | Ga0495617_030614 | Ga0495617_030614_699_1511 | 265 |
| 319 | 3300046452 | Ga0495617_049177 | Ga0495617_049177_294_1106 | 265 |
| 320 | 3300046457 | Ga0495590_0035141 | Ga0495590_0035141_904_1716 | 265 |
| 321 | 3300046460 | Ga0495638_0258842 | Ga0495638_0258842_95_907 | 265 |
| 322 | 3300046491 | Ga0495584_0001518 | Ga0495584_0001518_2495_3307 | 265 |
| 323 | 3300046491 | Ga0495584_0092159 | Ga0495584_0092159_181_993 | 265 |
| 324 | 3300046492 | Ga0495585_0012077 | Ga0495585_0012077_678_1490 | 265 |
| 325 | 3300046492 | Ga0495585_0105467 | Ga0495585_0105467_408_1220 | 265 |
| 326 | 3300046492 | Ga0495585_0117668 | Ga0495585_0117668_166_978 | 265 |
| 327 | 3300046501 | Ga0495607_0127798 | Ga0495607_0127798_119_931 | 265 |
| 328 | 3300046506 | Ga0495583_0000413 | Ga0495583_0000413_11713_12525 | 265 |
| 329 | 3300046512 | Ga0495610_0042770 | Ga0495610_0042770_822_1634 | 265 |
| 330 | 3300046513 | Ga0495616_0001970 | Ga0495616_0001970_793_1605 | 265 |
| 331 | 3300046523 | Ga0495644_0000141 | Ga0495644_0000141_2046_2858 | 265 |
| 332 | 3300046524 | Ga0495648_0003290 | Ga0495648_0003290_5228_6040 | 265 |
| 333 | 3300046524 | Ga0495648_0048381 | Ga0495648_0048381_1693_2514 | 265 |
| 334 | 3300046533 | Ga0495640_0067039 | Ga0495640_0067039_1374_2180 | 265 |
| 335 | 3300046538 | Ga0495609_0001785 | Ga0495609_0001785_704_1516 | 265 |
| 336 | 3300046557 | Ga0495622_0061574 | Ga0495622_0061574_483_1295 | 265 |
| 337 | 3300046648 | Ga0495611_0006061 | Ga0495611_0006061_3660_4472 | 265 |
| 338 | 3300046648 | Ga0495611_0028761 | Ga0495611_0028761_466_1278 | 265 |
| 339 | 3300046648 | Ga0495611_0039767 | Ga0495611_0039767_377_1189 | 265 |
| 340 | 3300046660 | Ga0495625_0025729 | Ga0495625_0025729_1489_2301 | 265 |
| 341 | 3300046664 | Ga0495659_0002213 | Ga0495659_0002213_1815_2627 | 265 |
| 342 | 3300046665 | Ga0495661_0075199 | Ga0495661_0075199_425_1237 | 265 |
| 343 | 3300047318 | Ga0495636_0001371 | Ga0495636_0001371_1977_2789 | 265 |
| 344 | 3300047320 | Ga0495672_0006776 | Ga0495672_0006776_207_1019 | 265 |
| 345 | 3300047323 | Ga0495683_0003137 | Ga0495683_0003137_41_853 | 265 |
| 346 | 3300047443 | Ga0495687_000235 | Ga0495687_000235_64020_64832 | 265 |
| 347 | 3300047445 | Ga0495677_0053948 | Ga0495677_0053948_318_1130 | 265 |
| 348 | 3300047447 | Ga0495685_000124 | Ga0495685_000124_24583_25395 | 265 |
| 349 | 3300047469 | Ga0495673_0004861 | Ga0495673_0004861_2318_3130 | 265 |
| 350 | 3300049459 | Ga0495678_001634 | Ga0495678_001634_2433_3245 | 265 |
| 351 | 3300049460 | Ga0495682_0000233 | Ga0495682_0000233_36665_37477 | 265 |
| 352 | 3300049460 | Ga0495682_0000357 | Ga0495682_0000357_20390_21202 | 265 |
| 353 | 3300049570 | Ga0501033_0010717 | Ga0501033_0010717_4010_4834 | 265 |
| 354 | 3300049570 | Ga0501033_0190894 | Ga0501033_0190894_421_1227 | 265 |
| 355 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_192739_193542 | 265 |
| 356 | 3300049571 | Ga0501034_0010486 | Ga0501034_0010486_878_1681 | 265 |
| 357 | 3300049571 | Ga0501034_0232628 | Ga0501034_0232628_830_1654 | 265 |
| 358 | 3300049573 | Ga0501037_0281813 | Ga0501037_0281813_142_945 | 265 |
| 359 | 3300049586 | Ga0501070_0085942 | Ga0501070_0085942_916_1719 | 265 |
| 360 | 3300049586 | Ga0501070_0643803 | Ga0501070_0643803_21_827 | 265 |
| 361 | 3300049593 | Ga0501077_0129152 | Ga0501077_0129152_568_1374 | 265 |
| 362 | 3300049743 | Ga0501081_0073391 | Ga0501081_0073391_31_837 | 265 |
| 363 | 3300049744 | Ga0501083_0285804 | Ga0501083_0285804_79_885 | 265 |
| 364 | 3300049823 | Ga0501044_0000960 | Ga0501044_0000960_27255_28079 | 265 |
| 365 | 3300049823 | Ga0501044_0161662 | Ga0501044_0161662_290_1093 | 265 |
| 366 | 3300060353 | Ga0501082_0007806 | Ga0501082_0007806_8095_8901 | 265 |
| 367 | 3300060353 | Ga0501082_0375660 | Ga0501082_0375660_376_1179 | 265 |
| 368 | 3300060353 | Ga0501082_0530875 | Ga0501082_0530875_139_948 | 265 |
| 369 | 3300061734 | Ga0530510_0409872 | Ga0530510_0409872_89_895 | 265 |
| 370 | 3300005455 | Ga0070663_100113642 | Ga0070663_1001136422 | 266 |
| 371 | 3300005459 | Ga0068867_100231836 | Ga0068867_1002318362 | 266 |
| 372 | 3300006844 | Ga0075428_100117169 | Ga0075428_1001171693 | 266 |
| 373 | 3300006846 | Ga0075430_100258972 | Ga0075430_1002589722 | 266 |
| 374 | 3300006847 | Ga0075431_100244644 | Ga0075431_1002446442 | 266 |
| 375 | 3300009177 | Ga0105248_10370749 | Ga0105248_103707492 | 266 |
| 376 | 3300009553 | Ga0105249_10000037 | Ga0105249_10000037168 | 266 |
| 377 | 3300014325 | Ga0163163_10137627 | Ga0163163_101376273 | 266 |
| 378 | 3300014326 | Ga0157380_10301336 | Ga0157380_103013362 | 266 |
| 379 | 3300015261 | Ga0182006_1000163 | Ga0182006_100016366 | 266 |
| 380 | 3300015262 | Ga0182007_10050117 | Ga0182007_100501171 | 266 |
| 381 | 3300015265 | Ga0182005_1000020 | Ga0182005_1000020179 | 266 |
| 382 | 3300025925 | Ga0207650_10001142 | Ga0207650_100011426 | 266 |
| 383 | 3300025961 | Ga0207712_10000035 | Ga0207712_10000035168 | 266 |
| 384 | 3300026067 | Ga0207678_10077048 | Ga0207678_100770483 | 266 |
| 385 | 3300026089 | Ga0207648_10165661 | Ga0207648_101656612 | 266 |
| 386 | 3300028800 | Ga0265338_10159538 | Ga0265338_101595382 | 266 |
| 387 | 3300031824 | Ga0307413_10129592 | Ga0307413_101295922 | 266 |
| 388 | 3300035695 | Ga0373927_0213051 | Ga0373927_0213051_365_1171 | 266 |
| 389 | 3300037068 | Ga0373925_0067023 | Ga0373925_0067023_43_849 | 266 |
| 390 | 3300046683 | Ga0495658_0164715 | Ga0495658_0164715_213_1019 | 266 |
| 391 | 3300047472 | Ga0495686_0000225 | Ga0495686_0000225_81472_82311 | 266 |
| 392 | 3300048905 | Ga0496102_0024423 | Ga0496102_0024423_2003_2809 | 266 |
| 393 | 3300048907 | Ga0496104_0162024 | Ga0496104_0162024_571_1377 | 266 |
| 394 | 3300048907 | Ga0496104_0203200 | Ga0496104_0203200_162_971 | 266 |
| 395 | 3300048908 | Ga0496105_0038921 | Ga0496105_0038921_1668_2474 | 266 |
| 396 | 3300048909 | Ga0496106_0162800 | Ga0496106_0162800_823_1629 | 266 |
| 397 | 3300048911 | Ga0496108_0119816 | Ga0496108_0119816_482_1288 | 266 |
| 398 | 3300050507 | nmdc:mga05p37_471662_c1 | nmdc:mga05p37_471662_c1_279_1091 | 266 |
| 399 | 3300050508 | nmdc:mga09592_586717_c1 | nmdc:mga09592_586717_c1_40_846 | 266 |
| 400 | 3300050509 | nmdc:mga0qj67_14048_c1 | nmdc:mga0qj67_14048_c1_822_1628 | 266 |
| 401 | 3300050510 | nmdc:mga06r32_10182_c1 | nmdc:mga06r32_10182_c1_3286_4092 | 266 |
| 402 | 3300050516 | nmdc:mga0sz30_62938_c1 | nmdc:mga0sz30_62938_c1_668_1474 | 266 |
| 403 | 3300060353 | Ga0501082_0077933 | Ga0501082_0077933_1712_2551 | 266 |
| 404 | 3300005981 | Ga0081538_10022183 | Ga0081538_100221835 | 267 |
| 405 | 3300006178 | Ga0075367_10021615 | Ga0075367_100216152 | 267 |
| 406 | 3300006178 | Ga0075367_10027960 | Ga0075367_100279602 | 267 |
| 407 | 3300031241 | Ga0265325_10021502 | Ga0265325_100215024 | 267 |
| 408 | 3300031595 | Ga0265313_10000041 | Ga0265313_1000004176 | 267 |
| 409 | 3300031595 | Ga0265313_10012923 | Ga0265313_100129232 | 267 |
| 410 | 3300048928 | Ga0496125_0006825 | Ga0496125_0006825_8777_9580 | 267 |
| 411 | 3300050494 | nmdc:mga06z11_175972_c1 | nmdc:mga06z11_175972_c1_172_1137 | 267 |
| 412 | 3300050494 | nmdc:mga06z11_29458_c1 | nmdc:mga06z11_29458_c1_741_1700 | 267 |
| 413 | 3300050512 | nmdc:mga0n895_307653_c1 | nmdc:mga0n895_307653_c1_479_1282 | 267 |
| 414 | 3300054114 | Ga0501084_0320321 | Ga0501084_0320321_22_828 | 267 |
| 415 | 3300005436 | Ga0070713_100087020 | Ga0070713_1000870202 | 268 |
| 416 | 3300006028 | Ga0070717_10507154 | Ga0070717_105071542 | 268 |
| 417 | 3300006178 | Ga0075367_10016320 | Ga0075367_100163201 | 268 |
| 418 | 3300006846 | Ga0075430_100176793 | Ga0075430_1001767931 | 268 |
| 419 | 3300006847 | Ga0075431_100140177 | Ga0075431_1001401773 | 268 |
| 420 | 3300006871 | Ga0075434_100077071 | Ga0075434_1000770712 | 268 |
| 421 | 3300007788 | Ga0099795_10057158 | Ga0099795_100571582 | 268 |
| 422 | 3300009545 | Ga0105237_10294087 | Ga0105237_102940872 | 268 |
| 423 | 3300009551 | Ga0105238_10065743 | Ga0105238_100657433 | 268 |
| 424 | 3300013296 | Ga0157374_10598752 | Ga0157374_105987521 | 268 |
| 425 | 3300014745 | Ga0157377_10169136 | Ga0157377_101691361 | 268 |
| 426 | 3300025914 | Ga0207671_10189865 | Ga0207671_101898651 | 268 |
| 427 | 3300025924 | Ga0207694_10019213 | Ga0207694_100192134 | 268 |
| 428 | 3300025928 | Ga0207700_10184518 | Ga0207700_101845182 | 268 |
| 429 | 3300027512 | Ga0209179_1037423 | Ga0209179_10374231 | 268 |
| 430 | 3300031548 | Ga0307408_100072773 | Ga0307408_1000727731 | 268 |
| 431 | 3300035113 | Ga0373936_0007469 | Ga0373936_0007469_2370_3185 | 268 |
| 432 | 3300035170 | Ga0373943_0096282 | Ga0373943_0096282_424_1239 | 268 |
| 433 | 3300035241 | Ga0373961_0007681 | Ga0373961_0007681_1795_2601 | 268 |
| 434 | 3300035692 | Ga0373935_0352193 | Ga0373935_0352193_56_862 | 268 |
| 435 | 3300035725 | Ga0373947_0127040 | Ga0373947_0127040_547_1362 | 268 |
| 436 | 3300041413 | Ga0439465_0021105 | Ga0439465_0021105_61_1047 | 268 |
| 437 | 3300046543 | Ga0495645_0207820 | Ga0495645_0207820_472_1278 | 268 |
| 438 | 3300046663 | Ga0495635_0169165 | Ga0495635_0169165_174_980 | 268 |
| 439 | 3300048909 | Ga0496106_0047800 | Ga0496106_0047800_1857_2663 | 268 |
| 440 | 3300048912 | Ga0496109_0356991 | Ga0496109_0356991_133_939 | 268 |
| 441 | 3300048913 | Ga0496110_0082147 | Ga0496110_0082147_2020_2826 | 268 |
| 442 | 3300048918 | Ga0496115_0077196 | Ga0496115_0077196_153_959 | 268 |
| 443 | 3300050494 | nmdc:mga06z11_240786_c1 | nmdc:mga06z11_240786_c1_190_996 | 268 |
| 444 | 3300050496 | nmdc:mga07m45_196015_c1 | nmdc:mga07m45_196015_c1_249_1055 | 268 |
| 445 | 3300050512 | nmdc:mga0n895_75902_c1 | nmdc:mga0n895_75902_c1_796_1602 | 268 |
| 446 | 3300050516 | nmdc:mga0sz30_132948_c1 | nmdc:mga0sz30_132948_c1_27_833 | 268 |
| 447 | 3300053077 | Ga0495601_0028359 | Ga0495601_0028359_2269_3075 | 268 |
| 448 | 3300053153 | Ga0500616_0045965 | Ga0500616_0045965_495_1301 | 268 |
| 449 | 3300005328 | Ga0070676_10202610 | Ga0070676_102026102 | 269 |
| 450 | 3300005365 | Ga0070688_100118359 | Ga0070688_1001183592 | 269 |
| 451 | 3300005544 | Ga0070686_100273528 | Ga0070686_1002735282 | 269 |
| 452 | 3300005548 | Ga0070665_100406801 | Ga0070665_1004068013 | 269 |
| 453 | 3300005937 | Ga0081455_10000678 | Ga0081455_1000067822 | 269 |
| 454 | 3300005983 | Ga0081540_1000084 | Ga0081540_100008468 | 269 |
| 455 | 3300006038 | Ga0075365_10172157 | Ga0075365_101721572 | 269 |
| 456 | 3300006914 | Ga0075436_100036277 | Ga0075436_1000362772 | 269 |
| 457 | 3300024227 | Ga0228598_1009140 | Ga0228598_10091401 | 269 |
| 458 | 3300025907 | Ga0207645_10136147 | Ga0207645_101361472 | 269 |
| 459 | 3300025914 | Ga0207671_10102883 | Ga0207671_101028832 | 269 |
| 460 | 3300025915 | Ga0207693_10039338 | Ga0207693_100393382 | 269 |
| 461 | 3300025931 | Ga0207644_10061297 | Ga0207644_100612973 | 269 |
| 462 | 3300025986 | Ga0207658_10180251 | Ga0207658_101802512 | 269 |
| 463 | 3300026121 | Ga0207683_10204240 | Ga0207683_102042402 | 269 |
| 464 | 3300030760 | Ga0265762_1022154 | Ga0265762_10221542 | 269 |
| 465 | 3300031090 | Ga0265760_10041482 | Ga0265760_100414821 | 269 |
| 466 | 3300031711 | Ga0265314_10168522 | Ga0265314_101685221 | 269 |
| 467 | 3300035172 | Ga0373955_0080407 | Ga0373955_0080407_631_1455 | 269 |
| 468 | 3300037853 | Ga0436364_1398223 | Ga0436364_1398223_630_1439 | 269 |
| 469 | 3300039437 | Ga0436365_0208033 | Ga0436365_0208033_3077_3895 | 269 |
| 470 | 3300039453 | Ga0436362_0512396 | Ga0436362_0512396_195_1013 | 269 |
| 471 | 3300046514 | Ga0495618_0079626 | Ga0495618_0079626_1162_1971 | 269 |
| 472 | 3300046517 | Ga0495630_0084029 | Ga0495630_0084029_141_950 | 269 |
| 473 | 3300046642 | Ga0495634_0002372 | Ga0495634_0002372_1189_1998 | 269 |
| 474 | 3300046663 | Ga0495635_0349585 | Ga0495635_0349585_161_970 | 269 |
| 475 | 3300047315 | Ga0495581_0181911 | Ga0495581_0181911_107_916 | 269 |
| 476 | 3300047471 | Ga0495684_0007145 | Ga0495684_0007145_7337_8146 | 269 |
| 477 | 3300049581 | Ga0501047_0076291 | Ga0501047_0076291_1689_2534 | 269 |
| 478 | 3300049582 | Ga0501048_0002713 | Ga0501048_0002713_6353_7189 | 269 |
| 479 | 3300049585 | Ga0501069_0096343 | Ga0501069_0096343_415_1260 | 269 |
| 480 | 3300049586 | Ga0501070_0160053 | Ga0501070_0160053_396_1241 | 269 |
| 481 | 3300049589 | Ga0501073_0045122 | Ga0501073_0045122_1701_2546 | 269 |
| 482 | 3300049590 | Ga0501074_0247914 | Ga0501074_0247914_202_1047 | 269 |
| 483 | 3300049741 | Ga0501079_0187878 | Ga0501079_0187878_247_1092 | 269 |
| 484 | 3300050492 | nmdc:mga0yw44_243625_c1 | nmdc:mga0yw44_243625_c1_144_956 | 269 |
| 485 | 3300050492 | nmdc:mga0yw44_89954_c1 | nmdc:mga0yw44_89954_c1_202_1032 | 269 |
| 486 | 3300050514 | nmdc:mga08x19_25889_c1 | nmdc:mga08x19_25889_c1_2365_3174 | 269 |
| 487 | 3300044658 | Ga0466972_0034160 | Ga0466972_0034160_1602_2480 | 271 |
| 488 | 3300001989 | JGI24739J22299_10023351 | JGI24739J22299_100233513 | 272 |
| 489 | 3300002067 | JGI24735J21928_10004814 | JGI24735J21928_100048143 | 272 |
| 490 | 3300005548 | Ga0070665_100138295 | Ga0070665_1001382952 | 272 |
| 491 | 3300009011 | Ga0105251_10000899 | Ga0105251_100008997 | 272 |
| 492 | 3300009093 | Ga0105240_10205763 | Ga0105240_102057632 | 272 |
| 493 | 3300009101 | Ga0105247_10504888 | Ga0105247_105048881 | 272 |
| 494 | 3300011119 | Ga0105246_10128565 | Ga0105246_101285653 | 272 |
| 495 | 3300013296 | Ga0157374_10388131 | Ga0157374_103881312 | 272 |
| 496 | 3300025302 | Ga0207426_1009720 | Ga0207426_10097203 | 272 |
| 497 | 3300025735 | Ga0207713_1001961 | Ga0207713_10019615 | 272 |
| 498 | 3300025904 | Ga0207647_10023460 | Ga0207647_100234606 | 272 |
| 499 | 3300028379 | Ga0268266_10088207 | Ga0268266_100882073 | 272 |
| 500 | 3300046457 | Ga0495590_0000404 | Ga0495590_0000404_7725_8543 | 272 |
| 501 | 3300046542 | Ga0495597_0010332 | Ga0495597_0010332_2346_3164 | 272 |
| 502 | 3300047469 | Ga0495673_0044180 | Ga0495673_0044180_654_1472 | 272 |
| 503 | 3300048091 | Ga0495626_0097299 | Ga0495626_0097299_298_1116 | 272 |
| 504 | 3300048903 | Ga0496100_0003175 | Ga0496100_0003175_127_945 | 272 |
| 505 | 3300048904 | Ga0496101_0011334 | Ga0496101_0011334_521_1339 | 272 |
| 506 | 3300048906 | Ga0496103_0010749 | Ga0496103_0010749_3837_4655 | 272 |
| 507 | 3300048908 | Ga0496105_0013582 | Ga0496105_0013582_5085_5903 | 272 |
| 508 | 3300048909 | Ga0496106_0004419 | Ga0496106_0004419_3012_3830 | 272 |
| 509 | 3300048910 | Ga0496107_0004070 | Ga0496107_0004070_1424_2242 | 272 |
| 510 | 3300048911 | Ga0496108_0098055 | Ga0496108_0098055_395_1213 | 272 |
| 511 | 3300048912 | Ga0496109_0122010 | Ga0496109_0122010_205_1023 | 272 |
| 512 | 3300048913 | Ga0496110_0004592 | Ga0496110_0004592_9789_10607 | 272 |
| 513 | 3300048914 | Ga0496111_0002330 | Ga0496111_0002330_2534_3352 | 272 |
| 514 | 3300048916 | Ga0496113_0003040 | Ga0496113_0003040_7637_8455 | 272 |
| 515 | 3300048919 | Ga0496116_0002803 | Ga0496116_0002803_14825_15643 | 272 |
| 516 | 3300048920 | Ga0496117_0004917 | Ga0496117_0004917_11141_11959 | 272 |
| 517 | 3300048921 | Ga0496118_0011800 | Ga0496118_0011800_94_912 | 272 |
| 518 | 3300048924 | Ga0496121_0026163 | Ga0496121_0026163_4000_4818 | 272 |
| 519 | 3300048925 | Ga0496122_0010350 | Ga0496122_0010350_7457_8275 | 272 |
| 520 | 3300048926 | Ga0496123_0005622 | Ga0496123_0005622_9120_9938 | 272 |
| 521 | 3300048927 | Ga0496124_0054969 | Ga0496124_0054969_1272_2090 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.7499 | 10 | 272 |
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.7446 | 10 | 272 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7246 | 9 | 271 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7064 | 9 | 271 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.6736 | 11 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7499 | 10 | 272 | 3.20.20.410 |
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7446 | 10 | 272 | 3.20.20.410 |
| af_P37348_1_259_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7273 | 11 | 271 | 3.20.20.410 |
| 1vpyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7187 | 8 | 272 | 3.20.20.410 |
| af_Q4E4B4_140_369_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7181 | 74 | 271 | 3.20.20.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R9WRZ7-F1-model_v4 | DUF72 domain-containing protein | 0.9856 | 108 | 195 |
|
| AF-A0A158C9X0-F1-model_v4 | DUF72 domain-containing protein | 0.9842 | 94 | 272 |
|
| AF-A0A2N7VI57-F1-model_v4 | DUF72 domain-containing protein | 0.9841 | 52 | 270 |
|
| AF-A0A1H1J9T9-F1-model_v4 | Uncharacterized conserved protein YecE, DUF72 family | 0.9836 | 58 | 269 |
|
| AF-A0A3C1NFF2-F1-model_v4 | DUF72 domain-containing protein | 0.9826 | 58 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar