F458731

General Info

Members Datasets Scaffolds Average Seq Length
521 305 430 133

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0179093|Ga0466972_0179093_165_623
Length 152
Sequence MSTVRTASRPPSSTTQXXXSSVAEKLSLKATKPVSPKQVRLKLVYIDFWSAVKLAFLWSVALGIVLVVAVLLIWTVLASTGIFDQLSALASDVSGTKTSVSTIVSFAQVIGFTLVIAALNVVVGTVLGAIACVLYNLSVRISGGLLVGFTNQ

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
4 2643221546 Microbacterium sp. Root53 Isolate Unclassified
5 2643221553 Microbacterium sp. Root553 Isolate Unclassified
6 2643221566 Microbacterium sp. Root166 Isolate Unclassified
7 2643221572 Leifsonia sp. Root60 Isolate Unclassified
8 2643221575 Microbacterium sp. Root61 Isolate Unclassified
9 2643221597 Microbacterium sp. Root180 Isolate Unclassified
10 2643221616 Leifsonia sp. Root227 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
13 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
16 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
17 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
18 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
19 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
20 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
21 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
22 2773857759 Microbacterium sp. 1294 Isolate Unclassified
23 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
24 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
25 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
26 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
27 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
28 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
29 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
30 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
31 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
32 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
33 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
34 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
35 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
36 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
37 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
38 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
39 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
40 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
41 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
42 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
43 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
44 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
45 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
46 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
47 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
48 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
49 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
50 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
51 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
52 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
53 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
54 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
55 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
56 2919069694 Microbacterium sp. 1154 Isolate Unclassified
57 2919395869 Microbacterium resistens 2980 Isolate Unclassified
58 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
59 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
60 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
61 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
62 2928153084 Leifsonia sp. 563 Isolate Unclassified
63 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
64 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
65 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
66 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
67 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
68 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
69 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
70 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
71 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
72 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
73 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
74 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
75 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
76 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
77 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
78 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
79 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
80 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
81 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
82 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
83 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
84 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
85 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
86 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
87 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
88 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
89 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
90 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
91 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
94 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
95 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
96 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
97 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
98 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
99 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
100 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
130 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
185 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
298 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
299 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
300 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
301 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
302 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
303 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
304 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
305 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.09
Metatranscriptomes 8.45
Isolates 17.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 8.64
Nodule 0
Rhizoplane 10.75
Rhizosphere 60.84
Stem 0
Stem Tuber 0.19
Unclassified 19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1019606 3300001915 Bacteria 1071
2 JGI24740J21852_10013501 3300001979 Bacteria 3042
3 JGI24740J21852_10022985 3300001979 Bacteria 2137
4 JGI24739J22299_10002217 3300001989 Bacteria 7466
5 JGI24737J22298_10019213 3300001990 Bacteria 2186
6 JGI24735J21928_10000213 3300002067 Bacteria 20363
7 JGI25154J39366_1000755 3300002738 Bacteria 14407
8 Ga0006562J51391_1007922 3300003578 Bacteria 9000
9 Ga0055539_1000060 3300003752 Bacteria 146006
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055532_1012669 3300003758 Bacteria 972
12 Ga0055525_1001446 3300003759 Bacteria 4288
13 Ga0055527_1000004 3300003760 Bacteria 570634
14 Ga0055535_1023037 3300003761 Bacteria 734
15 Ga0055542_1000019 3300003762 Bacteria 341174
16 Ga0055529_1000008 3300003763 Bacteria 394786
17 Ga0055541_1003315 3300003841 Bacteria 3046
18 Ga0070682_100047689 3300005337 Bacteria 2665
19 Ga0070660_100528755 3300005339 Bacteria 983
20 Ga0070660_101604340 3300005339 Bacteria 554
21 Ga0070668_101094263 3300005347 Bacteria 719
22 Ga0070714_100869636 3300005435 Bacteria 875
23 Ga0070663_100036018 3300005455 Bacteria 3437
24 Ga0070663_100932125 3300005455 Bacteria 752
25 Ga0070663_100937669 3300005455 Bacteria 750
26 Ga0070663_101200149 3300005455 Bacteria 667
27 Ga0070678_101635063 3300005456 Bacteria 605
28 Ga0070684_100797005 3300005535 Bacteria 883
29 Ga0070684_101908047 3300005535 Bacteria 561
30 Ga0068855_100219036 3300005563 Bacteria 2135
31 Ga0068856_100464053 3300005614 Bacteria 1287
32 Ga0068852_101591509 3300005616 Bacteria 676
33 Ga0075365_10093355 3300006038 Bacteria 2053
34 Ga0075364_10488615 3300006051 Bacteria 842
35 Ga0075364_10552619 3300006051 Bacteria 787
36 Ga0075364_10642608 3300006051 Bacteria 725
37 Ga0075369_10097827 3300006186 Bacteria 1314
38 Ga0075370_10733865 3300006353 Bacteria 601
39 Ga0105251_10172727 3300009011 Bacteria 974
40 Ga0105244_10166972 3300009036 Bacteria 1049
41 Ga0105247_10972470 3300009101 Bacteria 661
42 Ga0105241_10630294 3300009174 Bacteria 972
43 Ga0105237_10075045 3300009545 Bacteria 3373
44 Ga0105238_10947297 3300009551 Bacteria 880
45 Ga0105238_11174370 3300009551 Bacteria 791
46 Ga0105239_11230662 3300010375 Bacteria 863
47 Ga0157371_10382581 3300013102 Bacteria 1028
48 Ga0157371_11115832 3300013102 Bacteria 605
49 Ga0157370_10041389 3300013104 Bacteria 4445
50 Ga0157370_10088299 3300013104 Bacteria 2912
51 Ga0157370_10434474 3300013104 Bacteria 1207
52 Ga0157370_11509729 3300013104 Bacteria 604
53 Ga0157369_10000615 3300013105 Bacteria 46292
54 Ga0157369_10188383 3300013105 Bacteria 2168
55 Ga0157369_10194268 3300013105 Bacteria 2132
56 Ga0157369_10199324 3300013105 Bacteria 2101
57 Ga0157369_10270567 3300013105 Bacteria 1770
58 Ga0157369_10512801 3300013105 Bacteria 1240
59 Ga0157369_10516476 3300013105 Bacteria 1236
60 Ga0163162_10013113 3300013306 Bacteria 8092
61 Ga0157372_10063572 3300013307 Bacteria 4139
62 Ga0157372_10078874 3300013307 Bacteria 3722
63 Ga0157372_10121760 3300013307 Bacteria 2997
64 Ga0157372_10226007 3300013307 Bacteria 2170
65 Ga0157372_10385619 3300013307 Bacteria 1633
66 Ga0157372_10618534 3300013307 Bacteria 1262
67 Ga0157372_11125625 3300013307 Bacteria 908
68 Ga0157372_12041782 3300013307 Bacteria 659
69 Ga0157375_10951877 3300013308 Bacteria 1000
70 Ga0197907_10337578 3300020069 Bacteria 638
71 Ga0197907_11425893 3300020069 Bacteria 717
72 Ga0206356_10396231 3300020070 Bacteria 1425
73 Ga0206349_1451822 3300020075 Bacteria 838
74 Ga0206355_1083495 3300020076 Bacteria 700
75 Ga0206355_1119384 3300020076 Bacteria 1643
76 Ga0206355_1628509 3300020076 Bacteria 598
77 Ga0206351_10063209 3300020077 Bacteria 732
78 Ga0206351_10291208 3300020077 Bacteria 639
79 Ga0206351_10656490 3300020077 Bacteria 1762
80 Ga0206352_10027629 3300020078 Bacteria 629
81 Ga0206350_11532790 3300020080 Bacteria 1486
82 Ga0206354_10458837 3300020081 Bacteria 1616
83 Ga0206353_11788779 3300020082 Bacteria 2967
84 Ga0154015_1237287 3300020610 Bacteria 887
85 Ga0154015_1596553 3300020610 Bacteria 679
86 Ga0154015_1613290 3300020610 Bacteria 1092
87 Ga0224712_10070538 3300022467 Bacteria 1417
88 Ga0224712_10252002 3300022467 Bacteria 816
89 Ga0224712_10274696 3300022467 Bacteria 783
90 Ga0224712_10291360 3300022467 Bacteria 762
91 Ga0209566_100013 3300025225 Bacteria 474033
92 Ga0209674_100001 3300025226 Bacteria 4013750
93 Ga0209672_100011 3300025228 Bacteria 856297
94 Ga0209147_100289 3300025229 Bacteria 42738
95 Ga0209563_100001 3300025230 Bacteria 4013775
96 Ga0209563_101290 3300025230 Bacteria 6850
97 Ga0209437_100243 3300025233 Bacteria 88712
98 Ga0209258_104177 3300025242 Bacteria 2824
99 Ga0209646_1000030 3300025246 Bacteria 384216
100 Ga0209677_100001 3300025253 Bacteria 4013787
101 Ga0209677_104506 3300025253 Bacteria 3991
102 Ga0209148_1000023 3300025254 Bacteria 680511
103 Ga0209455_1000023 3300025272 Bacteria 680449
104 Ga0209455_1002817 3300025272 Bacteria 6468
105 Ga0207647_10006645 3300025904 Bacteria 8403
106 Ga0207647_10045953 3300025904 Bacteria 2722
107 Ga0207647_10096906 3300025904 Bacteria 1754
108 Ga0207705_10000001 3300025909 Bacteria 2061880
109 Ga0207705_10137502 3300025909 Bacteria 1822
110 Ga0207705_10195766 3300025909 Bacteria 1530
111 Ga0207654_10643339 3300025911 Bacteria 759
112 Ga0207671_10236499 3300025914 Bacteria 1434
113 Ga0207657_10756626 3300025919 Bacteria 753
114 Ga0207694_10123347 3300025924 Bacteria 2070
115 Ga0207694_11594834 3300025924 Bacteria 550
116 Ga0207664_10829481 3300025929 Bacteria 831
117 Ga0207661_10733892 3300025944 Bacteria 909
118 Ga0207667_10911800 3300025949 Bacteria 870
119 Ga0207668_10153849 3300025972 Bacteria 1784
120 Ga0207678_10012731 3300026067 Bacteria 7386
121 Ga0207702_10696004 3300026078 Bacteria 1001
122 Ga0307515_10084995 3300028794 Bacteria 4055
123 Ga0307513_10292985 3300031456 Bacteria 1398
124 Ga0307408_101443971 3300031548 Bacteria 649
125 Ga0307408_101903982 3300031548 Bacteria 570
126 Ga0307405_10042190 3300031731 Bacteria 2776
127 Ga0307405_10504656 3300031731 Bacteria 970
128 Ga0307405_10776190 3300031731 Bacteria 801
129 Ga0307405_10921648 3300031731 Bacteria 740
130 Ga0307413_10087189 3300031824 Bacteria 2021
131 Ga0307410_10737867 3300031852 Bacteria 833
132 Ga0307406_10000059 3300031901 Bacteria 61305
133 Ga0307406_10001199 3300031901 Bacteria 14508
134 Ga0307406_10068555 3300031901 Bacteria 2316
135 Ga0307412_10528842 3300031911 Bacteria 987
136 Ga0307412_10894906 3300031911 Bacteria 777
137 Ga0307412_10913546 3300031911 Bacteria 770
138 Ga0307409_101161663 3300031995 Bacteria 794
139 Ga0307416_100086306 3300032002 Bacteria 2675
140 Ga0307416_103116811 3300032002 Bacteria 555
141 Ga0307414_10069076 3300032004 Bacteria 2538
142 Ga0307414_10072176 3300032004 Bacteria 2493
143 Ga0307414_10328158 3300032004 Bacteria 1305
144 Ga0307414_11265080 3300032004 Bacteria 684
145 Ga0307414_11608027 3300032004 Bacteria 606
146 Ga0307411_12004236 3300032005 Bacteria 540
147 Ga0307415_100022434 3300032126 Bacteria 3896
148 Ga0307415_102463889 3300032126 Bacteria 512
149 Ga0395899_0037025 3300037312 Bacteria 3658
150 Ga0395900_0000888 3300037418 Bacteria 39271
151 Ga0395900_0002809 3300037418 Bacteria 19013
152 Ga0395900_0091063 3300037418 Bacteria 3134
153 Ga0395900_0176169 3300037418 Bacteria 2175
154 Ga0395900_1107696 3300037418 Bacteria 709
155 Ga0395898_0000355 3300037466 Bacteria 101003
156 Ga0395898_0076672 3300037466 Bacteria 3228
157 Ga0395898_0379357 3300037466 Bacteria 1348
158 Ga0395901_0097678 3300038443 Bacteria 3079
159 Ga0439465_0217158 3300041413 Bacteria 700
160 Ga0451789_0528770 3300041443 Bacteria 600
161 Ga0451794_02613 3300041446 Bacteria 512
162 Ga0451791_0029892 3300041451 Bacteria 610
163 Ga0451791_0538045 3300041451 Bacteria 747
164 Ga0451791_1910986 3300041451 Bacteria 653
165 Ga0451793_0953522 3300041452 Bacteria 1963
166 Ga0451793_1342768 3300041452 Bacteria 853
167 Ga0451797_0337590 3300041453 Bacteria 952
168 Ga0451802_2185873 3300041460 Bacteria 698
169 Ga0451805_005177 3300041461 Bacteria 832
170 Ga0451806_761023 3300041462 Bacteria 2001
171 Ga0451837_0065652 3300041494 Bacteria 546
172 Ga0451837_1188375 3300041494 Bacteria 697
173 Ga0451841_0005044 3300041498 Bacteria 663
174 Ga0451851_0875429 3300041507 Bacteria 1462
175 Ga0451843_1523110 3300041509 Bacteria 931
176 Ga0451853_1286542 3300041512 Bacteria 623
177 Ga0451853_3294903 3300041512 Bacteria 1497
178 Ga0439449_0145030 3300042007 Bacteria 885
179 Ga0466972_0097604 3300044658 Bacteria 1391
180 Ga0466972_0143513 3300044658 Bacteria 1123
181 Ga0466972_0179093 3300044658 Bacteria 994
182 Ga0466972_0182641 3300044658 Bacteria 983
183 Ga0466965_0006784 3300044683 Bacteria 5226
184 Ga0466965_0027300 3300044683 Bacteria 2770
185 Ga0466965_0217001 3300044683 Bacteria 1019
186 Ga0466966_0034919 3300044684 Bacteria 3250
187 Ga0466966_0125781 3300044684 Bacteria 1572
188 Ga0466966_0720205 3300044684 Bacteria 601
189 Ga0466961_0032724 3300044693 Bacteria 3342
190 Ga0466961_0034046 3300044693 Bacteria 3271
191 Ga0466961_0112139 3300044693 Bacteria 1715
192 Ga0466961_0307078 3300044693 Bacteria 968
193 Ga0466961_0496785 3300044693 Bacteria 737
194 Ga0466963_0445731 3300044694 Bacteria 913
195 Ga0466964_0134956 3300044706 Bacteria 1128
196 Ga0466971_0095188 3300044719 Bacteria 1365
197 Ga0466971_0138719 3300044719 Bacteria 1132
198 Ga0466968_0099395 3300044735 Bacteria 1297
199 Ga0466970_0000324 3300044765 Bacteria 23213
200 Ga0466970_0020120 3300044765 Bacteria 3464
201 Ga0466970_0047078 3300044765 Bacteria 2297
202 Ga0466970_0051289 3300044765 Bacteria 2201
203 Ga0466970_0081655 3300044765 Bacteria 1748
204 Ga0466970_0103911 3300044765 Bacteria 1548
205 Ga0466970_0116450 3300044765 Bacteria 1461
206 Ga0466970_0321679 3300044765 Bacteria 874
207 Ga0466970_0433401 3300044765 Bacteria 752
208 Ga0466970_0523943 3300044765 Bacteria 684
209 Ga0466957_0020339 3300044842 Bacteria 3905
210 Ga0466957_0082826 3300044842 Bacteria 2000
211 Ga0466957_0111458 3300044842 Bacteria 1735
212 Ga0466957_0465070 3300044842 Bacteria 873
213 Ga0466960_0162016 3300044901 Bacteria 1201
214 Ga0466960_0227507 3300044901 Bacteria 1028
215 Ga0466959_0227289 3300045049 Bacteria 1292
216 Ga0466959_0505801 3300045049 Bacteria 816
217 Ga0466958_0038660 3300045836 Bacteria 2863
218 Ga0466958_0763523 3300045836 Bacteria 630
219 Ga0466967_0159066 3300045976 Bacteria 2119
220 Ga0466967_0383595 3300045976 Bacteria 1365
221 Ga0466967_1286956 3300045976 Bacteria 728
222 Ga0495627_000725 3300046453 Bacteria 24959
223 Ga0495650_0113292 3300046471 Bacteria 1005
224 Ga0495654_0130061 3300046530 Bacteria 1131
225 Ga0495672_0029027 3300047320 Bacteria 3490
226 Ga0495673_0157088 3300047469 Bacteria 875
227 Ga0495686_0205228 3300047472 Bacteria 1129
228 Ga0495626_0035806 3300048091 Bacteria 2368
229 Ga0496100_0088991 3300048903 Bacteria 2102
230 Ga0496100_0125190 3300048903 Bacteria 1803
231 Ga0496100_0436939 3300048903 Bacteria 1001
232 Ga0496100_1522983 3300048903 Bacteria 528
233 Ga0496101_0010815 3300048904 Bacteria 6037
234 Ga0496101_0112414 3300048904 Bacteria 2051
235 Ga0496101_0346846 3300048904 Bacteria 1166
236 Ga0496101_0782020 3300048904 Bacteria 753
237 Ga0496102_0046814 3300048905 Bacteria 3929
238 Ga0496102_0124496 3300048905 Bacteria 2409
239 Ga0496102_0172802 3300048905 Bacteria 2034
240 Ga0496102_0211026 3300048905 Bacteria 1831
241 Ga0496102_0357708 3300048905 Bacteria 1374
242 Ga0496103_0056356 3300048906 Bacteria 2439
243 Ga0496103_0121420 3300048906 Bacteria 1664
244 Ga0496104_0028377 3300048907 Bacteria 5187
245 Ga0496104_0081435 3300048907 Bacteria 3087
246 Ga0496104_0245166 3300048907 Bacteria 1704
247 Ga0496105_0045176 3300048908 Bacteria 3634
248 Ga0496105_0174871 3300048908 Bacteria 1759
249 Ga0496105_0247754 3300048908 Bacteria 1444
250 Ga0496105_0266445 3300048908 Bacteria 1384
251 Ga0496106_0365712 3300048909 Bacteria 1159
252 Ga0496107_0397843 3300048910 Bacteria 1024
253 Ga0496108_0419648 3300048911 Bacteria 1168
254 Ga0496108_1031305 3300048911 Bacteria 701
255 Ga0496109_0070238 3300048912 Bacteria 3213
256 Ga0496109_0176248 3300048912 Bacteria 2007
257 Ga0496110_0109525 3300048913 Bacteria 2480
258 Ga0496110_0411223 3300048913 Bacteria 1233
259 Ga0496110_0578530 3300048913 Bacteria 1020
260 Ga0496111_0333506 3300048914 Bacteria 1123
261 Ga0496112_0193635 3300048915 Bacteria 1994
262 Ga0496112_0396566 3300048915 Bacteria 1320
263 Ga0496113_0055645 3300048916 Bacteria 2966
264 Ga0496113_0140916 3300048916 Bacteria 1897
265 Ga0496114_0018079 3300048917 Bacteria 5695
266 Ga0496114_0055683 3300048917 Bacteria 3298
267 Ga0496114_0107089 3300048917 Bacteria 2392
268 Ga0496114_0270741 3300048917 Bacteria 1496
269 Ga0496115_0005263 3300048918 Bacteria 9402
270 Ga0496115_0046936 3300048918 Bacteria 3453
271 Ga0496115_0063330 3300048918 Bacteria 2983
272 Ga0496115_0128678 3300048918 Bacteria 2086
273 Ga0496115_0457202 3300048918 Bacteria 1030
274 Ga0496116_0055969 3300048919 Bacteria 2588
275 Ga0496117_0000184 3300048920 Bacteria 127675
276 Ga0496117_0000994 3300048920 Bacteria 43381
277 Ga0496117_0007338 3300048920 Bacteria 10806
278 Ga0496117_0040420 3300048920 Bacteria 3430
279 Ga0496118_0000985 3300048921 Bacteria 44347
280 Ga0496118_0003621 3300048921 Bacteria 19177
281 Ga0496118_0086041 3300048921 Bacteria 2186
282 Ga0496119_0000553 3300048922 Bacteria 50775
283 Ga0496119_0023653 3300048922 Bacteria 4347
284 Ga0496119_0170277 3300048922 Bacteria 1151
285 Ga0496119_0218234 3300048922 Bacteria 977
286 Ga0496120_0099152 3300048923 Bacteria 1543
287 Ga0496120_0276258 3300048923 Bacteria 778
288 Ga0496120_0285381 3300048923 Bacteria 761
289 Ga0496121_0000046 3300048924 Bacteria 335942
290 Ga0496121_0211190 3300048924 Bacteria 1375
291 Ga0496121_0402925 3300048924 Bacteria 895
292 Ga0496122_0014421 3300048925 Bacteria 7645
293 Ga0496122_0155606 3300048925 Bacteria 1403
294 Ga0496122_0161476 3300048925 Bacteria 1366
295 Ga0496122_0259148 3300048925 Bacteria 966
296 Ga0496122_0294853 3300048925 Bacteria 878
297 Ga0496122_0537898 3300048925 Bacteria 559
298 Ga0496123_0183649 3300048926 Bacteria 1089
299 Ga0496123_0358475 3300048926 Bacteria 676
300 Ga0496124_0000090 3300048927 Bacteria 192095
301 Ga0496124_0091325 3300048927 Bacteria 2481
302 Ga0496124_0163652 3300048927 Bacteria 1731
303 Ga0496124_0186424 3300048927 Bacteria 1592
304 Ga0496124_0506982 3300048927 Bacteria 807
305 Ga0496125_0002075 3300048928 Bacteria 27049
306 Ga0496125_0003205 3300048928 Bacteria 20201
307 Ga0496125_0061604 3300048928 Bacteria 3008
308 Ga0496125_0508058 3300048928 Bacteria 677
309 Ga0496125_0631310 3300048928 Bacteria 580
310 Ga0496126_0042560 3300048929 Bacteria 4194
311 Ga0496126_0047599 3300048929 Bacteria 3925
312 Ga0496126_0084945 3300048929 Bacteria 2791
313 Ga0496126_0156680 3300048929 Bacteria 1949
314 Ga0496126_0206345 3300048929 Bacteria 1656
315 Ga0496126_0595759 3300048929 Bacteria 871
316 Ga0496126_1126322 3300048929 Bacteria 581
317 Ga0501318_048685 3300049534 Bacteria 625
318 Ga0501031_0128626 3300049568 Bacteria 1654
319 Ga0501032_0004227 3300049569 Bacteria 10857
320 Ga0501032_0051595 3300049569 Bacteria 2773
321 Ga0501032_0151470 3300049569 Bacteria 1525
322 Ga0501032_0751961 3300049569 Bacteria 617
323 Ga0501033_0017185 3300049570 Bacteria 5466
324 Ga0501033_0073921 3300049570 Bacteria 2502
325 Ga0501033_0217704 3300049570 Bacteria 1360
326 Ga0501033_0567747 3300049570 Bacteria 780
327 Ga0501033_0904220 3300049570 Bacteria 593
328 Ga0501034_0000453 3300049571 Bacteria 67858
329 Ga0501034_0005919 3300049571 Bacteria 13268
330 Ga0501034_0015232 3300049571 Bacteria 7902
331 Ga0501034_0027869 3300049571 Bacteria 5744
332 Ga0501034_0086975 3300049571 Bacteria 3126
333 Ga0501034_0100253 3300049571 Bacteria 2890
334 Ga0501036_0017384 3300049572 Bacteria 6012
335 Ga0501036_0102245 3300049572 Bacteria 2424
336 Ga0501036_1057645 3300049572 Bacteria 663
337 Ga0501037_0012926 3300049573 Bacteria 6152
338 Ga0501037_0037888 3300049573 Bacteria 3554
339 Ga0501038_0043781 3300049574 Bacteria 3891
340 Ga0501038_0054100 3300049574 Bacteria 3452
341 Ga0501038_0780762 3300049574 Bacteria 711
342 Ga0501039_0004737 3300049575 Bacteria 10303
343 Ga0501039_0296377 3300049575 Bacteria 1271
344 Ga0501042_0001952 3300049578 Bacteria 12421
345 Ga0501042_0017306 3300049578 Bacteria 4969
346 Ga0501043_0116567 3300049579 Bacteria 2096
347 Ga0501043_0123154 3300049579 Bacteria 2033
348 Ga0501043_0183890 3300049579 Bacteria 1628
349 Ga0501043_0237486 3300049579 Bacteria 1406
350 Ga0501046_0001009 3300049580 Bacteria 27472
351 Ga0501046_0010596 3300049580 Bacteria 7911
352 Ga0501046_0015316 3300049580 Bacteria 6448
353 Ga0501047_0025990 3300049581 Bacteria 5630
354 Ga0501047_0058443 3300049581 Bacteria 3725
355 Ga0501047_0153576 3300049581 Bacteria 2176
356 Ga0501047_0478271 3300049581 Bacteria 1073
357 Ga0501048_0003662 3300049582 Bacteria 11709
358 Ga0501048_0005777 3300049582 Bacteria 9405
359 Ga0501048_0317015 3300049582 Bacteria 1110
360 Ga0501069_0019681 3300049585 Bacteria 3652
361 Ga0501070_0000269 3300049586 Bacteria 49060
362 Ga0501070_0030006 3300049586 Bacteria 4556
363 Ga0501070_0040697 3300049586 Bacteria 3875
364 Ga0501070_0664739 3300049586 Bacteria 826
365 Ga0501071_0002444 3300049587 Bacteria 11271
366 Ga0501073_0000025 3300049589 Bacteria 127490
367 Ga0501073_0031149 3300049589 Bacteria 3807
368 Ga0501073_0557115 3300049589 Bacteria 792
369 Ga0501074_0054991 3300049590 Bacteria 2870
370 Ga0501079_0459311 3300049741 Bacteria 1000
371 Ga0501080_0447405 3300049742 Bacteria 1158
372 Ga0501080_0712694 3300049742 Bacteria 884
373 Ga0501080_1241786 3300049742 Bacteria 639
374 Ga0501083_0013295 3300049744 Bacteria 5755
375 Ga0501083_0366427 3300049744 Bacteria 937
376 Ga0501083_0461628 3300049744 Bacteria 826
377 Ga0501035_0010169 3300049822 Bacteria 8732
378 Ga0501035_0024142 3300049822 Bacteria 5577
379 Ga0501035_0131151 3300049822 Bacteria 2185
380 Ga0501035_0191625 3300049822 Bacteria 1757
381 Ga0501035_0265634 3300049822 Bacteria 1453
382 Ga0501035_0647156 3300049822 Bacteria 857
383 Ga0501035_0774213 3300049822 Bacteria 768
384 Ga0501044_0025196 3300049823 Bacteria 6307
385 Ga0501044_0081064 3300049823 Bacteria 3285
386 Ga0501044_0101504 3300049823 Bacteria 2894
387 Ga0501044_0139266 3300049823 Bacteria 2415
388 Ga0501044_0153576 3300049823 Bacteria 2283
389 Ga0501044_0457963 3300049823 Bacteria 1181
390 Ga0501044_0705576 3300049823 Bacteria 894
391 Ga0501045_0133533 3300049824 Bacteria 1845
392 nmdc:mga00v17_264286_c1 3300050491 Bacteria 1116
393 nmdc:mga00v17_51943_c1 3300050491 Bacteria 2493
394 nmdc:mga0yw44_185583_c1 3300050492 Bacteria 1370
395 nmdc:mga07m45_197807_c1 3300050496 Bacteria 1169
396 nmdc:mga0sz30_308658_c1 3300050516 Bacteria 706
397 Ga0500635_0000066 3300053080 Bacteria 69274
398 Ga0500651_0457543 3300053093 Bacteria 709
399 Ga0500650_0020330 3300053098 Bacteria 2911
400 Ga0500562_007738 3300053108 Bacteria 2710
401 Ga0500559_0001122 3300053136 Bacteria 16129
402 Ga0500573_0000005 3300053140 Bacteria 315762
403 Ga0500573_0345182 3300053140 Bacteria 725
404 Ga0500577_0007558 3300053142 Bacteria 3055
405 Ga0500577_0043725 3300053142 Bacteria 1647
406 Ga0500577_0044906 3300053142 Bacteria 1630
407 Ga0500577_0080374 3300053142 Bacteria 1299
408 Ga0500616_0000010 3300053153 Bacteria 761410
409 Ga0587090_156412 3300059510 Bacteria 520
410 Ga0587094_123476 3300059513 Bacteria 521
411 Ga0587095_035668 3300059514 Bacteria 529
412 Ga0587098_061434 3300059604 Bacteria 591
413 Ga0587106_021455 3300059605 Bacteria 962
414 Ga0587129_023363 3300059608 Bacteria 561
415 Ga0587099_035669 3300059622 Bacteria 621
416 Ga0587101_152873 3300059623 Bacteria 501
417 Ga0587128_083639 3300059630 Bacteria 643
418 Ga0587128_117201 3300059630 Bacteria 576
419 Ga0587130_017259 3300059631 Bacteria 757
420 Ga0587067_109881 3300059640 Bacteria 649
421 Ga0587069_072611 3300059642 Bacteria 656
422 Ga0587072_081868 3300059643 Bacteria 699
423 Ga0587076_174586 3300059645 Bacteria 537
424 Ga0587102_047206 3300059649 Bacteria 571
425 Ga0587107_025842 3300059652 Bacteria 857
426 Ga0587114_030655 3300059655 Bacteria 820
427 Ga0587071_134274 3300060344 Bacteria 602
428 Ga0501082_0400472 3300060353 Bacteria 1198
429 Ga0466962_0060492 3300061719 Bacteria 1808
430 Ga0466962_0089915 3300061719 Bacteria 1471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_101604340 Ga0070660_1016043402 110
2 3300025919 Ga0207657_10756626 Ga0207657_107566261 110
3 3300013105 Ga0157369_10516476 Ga0157369_105164761 111
4 3300013308 Ga0157375_10951877 Ga0157375_109518772 111
5 3300048907 Ga0496104_0028377 Ga0496104_0028377_160_564 111
6 3300048908 Ga0496105_0266445 Ga0496105_0266445_411_815 111
7 3300048911 Ga0496108_0419648 Ga0496108_0419648_172_576 111
8 3300048911 Ga0496108_1031305 Ga0496108_1031305_270_674 111
9 3300048913 Ga0496110_0109525 Ga0496110_0109525_1024_1428 111
10 3300048914 Ga0496111_0333506 Ga0496111_0333506_700_1104 111
11 3300048917 Ga0496114_0107089 Ga0496114_0107089_1914_2318 111
12 3300048918 Ga0496115_0457202 Ga0496115_0457202_470_874 111
13 3300048927 Ga0496124_0186424 Ga0496124_0186424_1132_1533 111
14 3300037418 Ga0395900_1107696 Ga0395900_1107696_104_442 112
15 3300009036 Ga0105244_10166972 Ga0105244_101669722 113
16 3300031901 Ga0307406_10068555 Ga0307406_100685555 113
17 3300031911 Ga0307412_10894906 Ga0307412_108949062 113
18 3300032002 Ga0307416_100086306 Ga0307416_1000863062 113
19 3300032004 Ga0307414_11265080 Ga0307414_112650802 113
20 3300032126 Ga0307415_100022434 Ga0307415_1000224342 113
21 3300031731 Ga0307405_10042190 Ga0307405_100421902 114
22 3300031731 Ga0307405_10921648 Ga0307405_109216482 114
23 3300031824 Ga0307413_10087189 Ga0307413_100871891 114
24 3300031995 Ga0307409_101161663 Ga0307409_1011616632 114
25 3300032005 Ga0307411_12004236 Ga0307411_120042362 114
26 3300049571 Ga0501034_0000453 Ga0501034_0000453_45943_46347 114
27 3300006051 Ga0075364_10642608 Ga0075364_106426081 115
28 3300006353 Ga0075370_10733865 Ga0075370_107338652 115
29 3300050496 nmdc:mga07m45_197807_c1 nmdc:mga07m45_197807_c1_572_976 115
30 3300009101 Ga0105247_10972470 Ga0105247_109724702 118
31 3300006038 Ga0075365_10093355 Ga0075365_100933554 122
32 3300006051 Ga0075364_10552619 Ga0075364_105526191 122
33 3300050492 nmdc:mga0yw44_185583_c1 nmdc:mga0yw44_185583_c1_150_554 122
34 3300031852 Ga0307410_10737867 Ga0307410_107378671 123
35 3300031911 Ga0307412_10913546 Ga0307412_109135461 123
36 3300032126 Ga0307415_102463889 Ga0307415_1024638892 123
37 3300046453 Ga0495627_000725 Ga0495627_000725_12344_12748 123
38 3300061719 Ga0466962_0089915 Ga0466962_0089915_124_519 123
39 3300013104 Ga0157370_11509729 Ga0157370_115097292 124
40 3300042007 Ga0439449_0145030 Ga0439449_0145030_334_738 125
41 3300044683 Ga0466965_0217001 Ga0466965_0217001_179_556 125
42 3300048912 Ga0496109_0070238 Ga0496109_0070238_2042_2446 125
43 3300048915 Ga0496112_0396566 Ga0496112_0396566_76_480 125
44 3300048928 Ga0496125_0631310 Ga0496125_0631310_70_474 125
45 3300013105 Ga0157369_10000615 Ga0157369_1000061538 128
46 3300049824 Ga0501045_0133533 Ga0501045_0133533_272_658 128
47 3300037312 Ga0395899_0037025 Ga0395899_0037025_3246_3635 129
48 iso_pu_bacteria 2643221575 2643887526 129
49 iso_pu_bacteria 2773857758 2774379420 129
50 iso_pu_bacteria 2870628048 2870628665 129
51 iso_pu_bacteria 2904509784 2904512294 129
52 iso_pu_bacteria 2908678064 2908679551 129
53 iso_pu_bacteria 2919069694 2919070197 129
54 iso_pu_bacteria 2946080515 2946083056 129
55 iso_pu_bacteria 2974294766 2974295474 129
56 iso_pu_bacteria 2974324384 2974324723 129
57 iso_pu_bacteria 2977228692 2977229755 129
58 iso_pu_bacteria 2977236895 2977238199 129
59 iso_pu_bacteria 2977264416 2977265009 129
60 iso_pu_bacteria 2984542743 2984544017 129
61 3300003758 Ga0055532_1012669 Ga0055532_10126691 130
62 3300003760 Ga0055527_1000004 Ga0055527_1000004310 130
63 3300003761 Ga0055535_1023037 Ga0055535_10230373 130
64 3300003762 Ga0055542_1000019 Ga0055542_100001998 130
65 3300003763 Ga0055529_1000008 Ga0055529_1000008267 130
66 3300009011 Ga0105251_10172727 Ga0105251_101727272 130
67 3300025228 Ga0209672_100011 Ga0209672_100011310 130
68 3300025229 Ga0209147_100289 Ga0209147_10028938 130
69 3300025242 Ga0209258_104177 Ga0209258_1041777 130
70 3300025254 Ga0209148_1000023 Ga0209148_1000023148 130
71 3300025272 Ga0209455_1000023 Ga0209455_1000023148 130
72 3300041507 Ga0451851_0875429 Ga0451851_0875429_225_632 130
73 3300044765 Ga0466970_0020120 Ga0466970_0020120_1769_2176 130
74 3300046471 Ga0495650_0113292 Ga0495650_0113292_22_429 130
75 3300046530 Ga0495654_0130061 Ga0495654_0130061_43_450 130
76 3300048091 Ga0495626_0035806 Ga0495626_0035806_1706_2113 130
77 3300048903 Ga0496100_1522983 Ga0496100_1522983_99_506 130
78 3300048904 Ga0496101_0782020 Ga0496101_0782020_307_714 130
79 3300048905 Ga0496102_0172802 Ga0496102_0172802_371_778 130
80 3300048913 Ga0496110_0578530 Ga0496110_0578530_325_732 130
81 3300048920 Ga0496117_0000184 Ga0496117_0000184_117718_118125 130
82 3300048921 Ga0496118_0000985 Ga0496118_0000985_6547_6954 130
83 3300048922 Ga0496119_0023653 Ga0496119_0023653_662_1069 130
84 3300048922 Ga0496119_0218234 Ga0496119_0218234_394_801 130
85 3300048923 Ga0496120_0276258 Ga0496120_0276258_214_621 130
86 3300048923 Ga0496120_0285381 Ga0496120_0285381_205_612 130
87 3300048924 Ga0496121_0211190 Ga0496121_0211190_247_654 130
88 3300048925 Ga0496122_0259148 Ga0496122_0259148_214_621 130
89 3300048925 Ga0496122_0294853 Ga0496122_0294853_25_432 130
90 3300048926 Ga0496123_0183649 Ga0496123_0183649_487_894 130
91 3300048927 Ga0496124_0000090 Ga0496124_0000090_160027_160434 130
92 3300048927 Ga0496124_0091325 Ga0496124_0091325_1069_1476 130
93 3300048927 Ga0496124_0163652 Ga0496124_0163652_153_560 130
94 3300048927 Ga0496124_0506982 Ga0496124_0506982_197_604 130
95 iso_pu_bacteria 2585428094 2587861995 130
96 iso_pu_bacteria 2585428157 2588107536 130
97 iso_pu_bacteria 2643221542 2643735274 130
98 iso_pu_bacteria 2643221546 2643752348 130
99 iso_pu_bacteria 2643221553 2643784440 130
100 iso_pu_bacteria 2643221566 2643847363 130
101 iso_pu_bacteria 2643221572 2643877160 130
102 iso_pu_bacteria 2643221597 2643997352 130
103 iso_pu_bacteria 2643221630 2644172112 130
104 iso_pu_bacteria 2643221649 2644280148 130
105 iso_pu_bacteria 2643221669 2644384215 130
106 iso_pu_bacteria 2643221724 2644678384 130
107 iso_pu_bacteria 2728369380 2730227896 130
108 iso_pu_bacteria 2747842429 2747954996 130
109 iso_pu_bacteria 2757320536 2758225276 130
110 iso_pu_bacteria 2773857763 2774397460 130
111 iso_pu_bacteria 2808606306 2808629416 130
112 iso_pu_bacteria 2808606368 2808884339 130
113 iso_pu_bacteria 2808606447 2809225825 130
114 iso_pu_bacteria 2811994872 2812325202 130
115 iso_pu_bacteria 2821268502 2821271857 130
116 iso_pu_bacteria 2833709550 2833712901 130
117 iso_pu_bacteria 2852632344 2852635299 130
118 iso_pu_bacteria 2852646457 2852649654 130
119 iso_pu_bacteria 2852663356 2852666747 130
120 iso_pu_bacteria 2857720070 2857722679 130
121 iso_pu_bacteria 2857723135 2857726049 130
122 iso_pu_bacteria 2895660088 2895662053 130
123 iso_pu_bacteria 2906799679 2906802559 130
124 iso_pu_bacteria 2919395869 2919398438 130
125 iso_pu_bacteria 2928090899 2928093459 130
126 iso_pu_bacteria 2939660829 2939661982 130
127 iso_pu_bacteria 2945968032 2945969767 130
128 iso_pu_bacteria 2946033335 2946035642 130
129 iso_pu_bacteria 2946041624 2946042150 130
130 iso_pu_bacteria 2984580707 2984582907 130
131 iso_pu_bacteria 8004182704 8004182788 130
132 iso_pu_bacteria 8004212874 8004215529 130
133 iso_pu_bacteria 8016254467 8016255675 130
134 iso_pu_bacteria 8045830549 8045833216 130
135 3300048929 Ga0496126_0206345 Ga0496126_0206345_897_1307 131
136 iso_pu_bacteria 2643221635 2644197592 131
137 iso_pu_bacteria 2751185788 2753300159 131
138 iso_pu_bacteria 2773857759 2774382463 131
139 iso_pu_bacteria 2844852863 2844853640 131
140 iso_pu_bacteria 2852643534 2852643990 131
141 iso_pu_bacteria 2852677369 2852677558 131
142 iso_pu_bacteria 2857729791 2857730875 131
143 iso_pu_bacteria 2862993130 2862994093 131
144 iso_pu_bacteria 2870622029 2870625352 131
145 iso_pu_bacteria 2897561785 2897561824 131
146 iso_pu_bacteria 2904430863 2904432161 131
147 iso_pu_bacteria 2904501621 2904502054 131
148 iso_pu_bacteria 2908674828 2908677839 131
149 iso_pu_bacteria 2909074476 2909076384 131
150 iso_pu_bacteria 2919039151 2919040341 131
151 iso_pu_bacteria 2919042368 2919044437 131
152 iso_pu_bacteria 2928104781 2928105715 131
153 iso_pu_bacteria 2928121344 2928122546 131
154 iso_pu_bacteria 2928500415 2928502499 131
155 iso_pu_bacteria 2939657138 2939660461 131
156 iso_pu_bacteria 2964326757 2964327876 131
157 iso_pu_bacteria 2966924647 2966926074 131
158 iso_pu_bacteria 2977251589 2977252656 131
159 iso_pu_bacteria 2984551494 2984552220 131
160 iso_pu_bacteria 2995726249 2995726306 131
161 iso_pu_bacteria 8002811521 8002813195 131
162 iso_pu_bacteria 8055034563 8055037713 131
163 iso_pu_bacteria 8055037949 8055039943 131
164 iso_pu_bacteria 8056037122 8056040436 131
165 iso_pu_bacteria 8057345674 8057346631 131
166 iso_pu_bacteria 2643221632 2644181822 132
167 iso_pu_bacteria 2966921586 2966924469 132
168 3300013307 Ga0157372_10063572 Ga0157372_100635725 133
169 3300044765 Ga0466970_0000324 Ga0466970_0000324_4762_5163 133
170 3300044842 Ga0466957_0082826 Ga0466957_0082826_1557_1958 133
171 3300045976 Ga0466967_0159066 Ga0466967_0159066_787_1188 133
172 3300049569 Ga0501032_0051595 Ga0501032_0051595_1791_2195 133
173 3300049572 Ga0501036_1057645 Ga0501036_1057645_23_427 133
174 3300049575 Ga0501039_0296377 Ga0501039_0296377_50_454 133
175 3300049579 Ga0501043_0123154 Ga0501043_0123154_1441_1845 133
176 3300049581 Ga0501047_0058443 Ga0501047_0058443_681_1085 133
177 3300049582 Ga0501048_0317015 Ga0501048_0317015_112_516 133
178 3300049586 Ga0501070_0040697 Ga0501070_0040697_1297_1701 133
179 3300049589 Ga0501073_0031149 Ga0501073_0031149_76_480 133
180 3300049590 Ga0501074_0054991 Ga0501074_0054991_425_829 133
181 3300049742 Ga0501080_0447405 Ga0501080_0447405_672_1076 133
182 3300049742 Ga0501080_1241786 Ga0501080_1241786_50_454 133
183 3300049822 Ga0501035_0265634 Ga0501035_0265634_999_1403 133
184 3300049823 Ga0501044_0081064 Ga0501044_0081064_241_645 133
185 iso_pu_bacteria 2643221616 2644097391 133
186 iso_pu_bacteria 2844841374 2844844340 133
187 iso_pu_bacteria 2884763398 2884763405 133
188 iso_pu_bacteria 2919055335 2919056290 133
189 iso_pu_bacteria 2919523602 2919526292 133
190 iso_pu_bacteria 2928153084 2928154423 133
191 3300002738 JGI25154J39366_1000755 JGI25154J39366_100075513 134
192 3300005347 Ga0070668_101094263 Ga0070668_1010942631 134
193 3300005535 Ga0070684_100797005 Ga0070684_1007970051 134
194 3300005614 Ga0068856_100464053 Ga0068856_1004640532 134
195 3300009545 Ga0105237_10075045 Ga0105237_100750452 134
196 3300009551 Ga0105238_10947297 Ga0105238_109472972 134
197 3300013104 Ga0157370_10434474 Ga0157370_104344742 134
198 3300013105 Ga0157369_10194268 Ga0157369_101942682 134
199 3300013306 Ga0163162_10013113 Ga0163162_100131133 134
200 3300013307 Ga0157372_10078874 Ga0157372_100788745 134
201 3300025246 Ga0209646_1000030 Ga0209646_1000030216 134
202 3300025914 Ga0207671_10236499 Ga0207671_102364992 134
203 3300025924 Ga0207694_11594834 Ga0207694_115948341 134
204 3300025972 Ga0207668_10153849 Ga0207668_101538492 134
205 3300026078 Ga0207702_10696004 Ga0207702_106960042 134
206 3300028794 Ga0307515_10084995 Ga0307515_100849952 134
207 3300031548 Ga0307408_101903982 Ga0307408_1019039822 134
208 3300031731 Ga0307405_10504656 Ga0307405_105046562 134
209 3300031731 Ga0307405_10776190 Ga0307405_107761901 134
210 3300031901 Ga0307406_10000059 Ga0307406_1000005940 134
211 3300031901 Ga0307406_10001199 Ga0307406_100011996 134
212 3300031911 Ga0307412_10528842 Ga0307412_105288421 134
213 3300032004 Ga0307414_10069076 Ga0307414_100690762 134
214 3300032004 Ga0307414_10072176 Ga0307414_100721762 134
215 3300032004 Ga0307414_10328158 Ga0307414_103281582 134
216 3300032004 Ga0307414_11608027 Ga0307414_116080271 134
217 3300041451 Ga0451791_0029892 Ga0451791_0029892_102_506 134
218 3300041451 Ga0451791_1910986 Ga0451791_1910986_174_578 134
219 3300041509 Ga0451843_1523110 Ga0451843_1523110_147_551 134
220 3300041512 Ga0451853_1286542 Ga0451853_1286542_120_524 134
221 3300041512 Ga0451853_3294903 Ga0451853_3294903_231_635 134
222 3300044765 Ga0466970_0081655 Ga0466970_0081655_1289_1693 134
223 3300048903 Ga0496100_0088991 Ga0496100_0088991_93_497 134
224 3300048904 Ga0496101_0010815 Ga0496101_0010815_5223_5627 134
225 3300048905 Ga0496102_0046814 Ga0496102_0046814_3194_3598 134
226 3300048906 Ga0496103_0056356 Ga0496103_0056356_342_746 134
227 3300048909 Ga0496106_0365712 Ga0496106_0365712_566_970 134
228 3300048912 Ga0496109_0176248 Ga0496109_0176248_342_746 134
229 3300048913 Ga0496110_0411223 Ga0496110_0411223_391_795 134
230 3300048915 Ga0496112_0193635 Ga0496112_0193635_357_761 134
231 3300048916 Ga0496113_0055645 Ga0496113_0055645_1392_1796 134
232 3300048917 Ga0496114_0055683 Ga0496114_0055683_1737_2141 134
233 3300048918 Ga0496115_0005263 Ga0496115_0005263_3087_3491 134
234 3300048920 Ga0496117_0000994 Ga0496117_0000994_21951_22355 134
235 3300048922 Ga0496119_0170277 Ga0496119_0170277_92_496 134
236 3300048925 Ga0496122_0014421 Ga0496122_0014421_5894_6298 134
237 3300048925 Ga0496122_0161476 Ga0496122_0161476_915_1319 134
238 3300048925 Ga0496122_0537898 Ga0496122_0537898_94_498 134
239 3300048926 Ga0496123_0358475 Ga0496123_0358475_241_645 134
240 3300048928 Ga0496125_0002075 Ga0496125_0002075_24826_25230 134
241 3300048928 Ga0496125_0003205 Ga0496125_0003205_6094_6498 134
242 3300048928 Ga0496125_0061604 Ga0496125_0061604_1717_2121 134
243 3300048929 Ga0496126_0047599 Ga0496126_0047599_3345_3749 134
244 3300048929 Ga0496126_0084945 Ga0496126_0084945_363_767 134
245 3300049589 Ga0501073_0000025 Ga0501073_0000025_1367_1771 134
246 3300049741 Ga0501079_0459311 Ga0501079_0459311_10_414 134
247 3300050491 nmdc:mga00v17_264286_c1 nmdc:mga00v17_264286_c1_478_882 134
248 3300050491 nmdc:mga00v17_51943_c1 nmdc:mga00v17_51943_c1_35_439 134
249 3300053093 Ga0500651_0457543 Ga0500651_0457543_103_510 134
250 3300053108 Ga0500562_007738 Ga0500562_007738_714_1118 134
251 3300053140 Ga0500573_0000005 Ga0500573_0000005_115114_115521 134
252 3300005339 Ga0070660_100528755 Ga0070660_1005287554 135
253 3300005455 Ga0070663_100036018 Ga0070663_1000360188 135
254 3300005563 Ga0068855_100219036 Ga0068855_1002190361 135
255 3300006051 Ga0075364_10488615 Ga0075364_104886152 135
256 3300009174 Ga0105241_10630294 Ga0105241_106302942 135
257 3300013104 Ga0157370_10088299 Ga0157370_100882996 135
258 3300025904 Ga0207647_10096906 Ga0207647_100969062 135
259 3300025909 Ga0207705_10000001 Ga0207705_100000011035 135
260 3300025911 Ga0207654_10643339 Ga0207654_106433392 135
261 3300025944 Ga0207661_10733892 Ga0207661_107338923 135
262 3300026067 Ga0207678_10012731 Ga0207678_100127312 135
263 3300031456 Ga0307513_10292985 Ga0307513_102929853 135
264 3300031548 Ga0307408_101443971 Ga0307408_1014439712 135
265 3300032002 Ga0307416_103116811 Ga0307416_1031168112 135
266 3300037418 Ga0395900_0002809 Ga0395900_0002809_11089_11499 135
267 3300037466 Ga0395898_0076672 Ga0395898_0076672_1199_1609 135
268 3300041413 Ga0439465_0217158 Ga0439465_0217158_98_505 135
269 3300041443 Ga0451789_0528770 Ga0451789_0528770_16_423 135
270 3300041446 Ga0451794_02613 Ga0451794_02613_68_475 135
271 3300041451 Ga0451791_0538045 Ga0451791_0538045_28_435 135
272 3300041452 Ga0451793_0953522 Ga0451793_0953522_36_443 135
273 3300041452 Ga0451793_1342768 Ga0451793_1342768_70_477 135
274 3300041453 Ga0451797_0337590 Ga0451797_0337590_248_655 135
275 3300041460 Ga0451802_2185873 Ga0451802_2185873_26_433 135
276 3300041461 Ga0451805_005177 Ga0451805_005177_300_707 135
277 3300041462 Ga0451806_761023 Ga0451806_761023_972_1379 135
278 3300041494 Ga0451837_0065652 Ga0451837_0065652_13_420 135
279 3300041494 Ga0451837_1188375 Ga0451837_1188375_168_575 135
280 3300041498 Ga0451841_0005044 Ga0451841_0005044_225_632 135
281 3300044658 Ga0466972_0179093 Ga0466972_0179093_165_623 135
282 3300044684 Ga0466966_0720205 Ga0466966_0720205_11_469 135
283 3300044693 Ga0466961_0112139 Ga0466961_0112139_263_721 135
284 3300044694 Ga0466963_0445731 Ga0466963_0445731_314_772 135
285 3300044719 Ga0466971_0138719 Ga0466971_0138719_78_536 135
286 3300044765 Ga0466970_0047078 Ga0466970_0047078_320_727 135
287 3300044765 Ga0466970_0523943 Ga0466970_0523943_51_509 135
288 3300044842 Ga0466957_0465070 Ga0466957_0465070_297_749 135
289 3300044901 Ga0466960_0227507 Ga0466960_0227507_203_661 135
290 3300045049 Ga0466959_0505801 Ga0466959_0505801_84_542 135
291 3300045836 Ga0466958_0763523 Ga0466958_0763523_119_577 135
292 3300045976 Ga0466967_0383595 Ga0466967_0383595_330_788 135
293 3300047320 Ga0495672_0029027 Ga0495672_0029027_848_1255 135
294 3300047469 Ga0495673_0157088 Ga0495673_0157088_34_441 135
295 3300048920 Ga0496117_0040420 Ga0496117_0040420_236_643 135
296 3300048922 Ga0496119_0000553 Ga0496119_0000553_37949_38356 135
297 3300048923 Ga0496120_0099152 Ga0496120_0099152_636_1043 135
298 3300048924 Ga0496121_0000046 Ga0496121_0000046_190789_191196 135
299 3300048924 Ga0496121_0402925 Ga0496121_0402925_289_696 135
300 3300048925 Ga0496122_0155606 Ga0496122_0155606_945_1352 135
301 3300048928 Ga0496125_0508058 Ga0496125_0508058_186_593 135
302 3300048929 Ga0496126_0595759 Ga0496126_0595759_154_561 135
303 3300049534 Ga0501318_048685 Ga0501318_048685_165_572 135
304 3300049571 Ga0501034_0027869 Ga0501034_0027869_2687_3094 135
305 3300049579 Ga0501043_0116567 Ga0501043_0116567_423_830 135
306 3300049585 Ga0501069_0019681 Ga0501069_0019681_708_1115 135
307 3300049586 Ga0501070_0030006 Ga0501070_0030006_345_752 135
308 3300049587 Ga0501071_0002444 Ga0501071_0002444_5613_6020 135
309 3300049589 Ga0501073_0557115 Ga0501073_0557115_109_516 135
310 3300049742 Ga0501080_0712694 Ga0501080_0712694_278_685 135
311 3300049744 Ga0501083_0366427 Ga0501083_0366427_210_617 135
312 3300050516 nmdc:mga0sz30_308658_c1 nmdc:mga0sz30_308658_c1_60_467 135
313 3300053098 Ga0500650_0020330 Ga0500650_0020330_497_904 135
314 3300053136 Ga0500559_0001122 Ga0500559_0001122_13212_13619 135
315 3300053140 Ga0500573_0345182 Ga0500573_0345182_29_439 135
316 3300053142 Ga0500577_0007558 Ga0500577_0007558_491_898 135
317 3300053142 Ga0500577_0043725 Ga0500577_0043725_667_1074 135
318 3300053142 Ga0500577_0044906 Ga0500577_0044906_1079_1486 135
319 3300053142 Ga0500577_0080374 Ga0500577_0080374_314_721 135
320 3300053153 Ga0500616_0000010 Ga0500616_0000010_273497_273904 135
321 3300005455 Ga0070663_101200149 Ga0070663_1012001492 136
322 3300013102 Ga0157371_10382581 Ga0157371_103825812 136
323 3300013105 Ga0157369_10512801 Ga0157369_105128012 136
324 3300013307 Ga0157372_10618534 Ga0157372_106185344 136
325 3300020069 Ga0197907_10337578 Ga0197907_103375781 136
326 3300020069 Ga0197907_11425893 Ga0197907_114258931 136
327 3300020076 Ga0206355_1083495 Ga0206355_10834952 136
328 3300020077 Ga0206351_10063209 Ga0206351_100632092 136
329 3300020077 Ga0206351_10291208 Ga0206351_102912081 136
330 3300020077 Ga0206351_10656490 Ga0206351_106564905 136
331 3300020610 Ga0154015_1596553 Ga0154015_15965531 136
332 3300020610 Ga0154015_1613290 Ga0154015_16132902 136
333 3300022467 Ga0224712_10070538 Ga0224712_100705382 136
334 3300022467 Ga0224712_10274696 Ga0224712_102746962 136
335 3300025909 Ga0207705_10137502 Ga0207705_101375023 136
336 3300025949 Ga0207667_10911800 Ga0207667_109118002 136
337 3300037418 Ga0395900_0176169 Ga0395900_0176169_1518_1973 136
338 3300038443 Ga0395901_0097678 Ga0395901_0097678_221_676 136
339 3300044693 Ga0466961_0307078 Ga0466961_0307078_159_614 136
340 3300044765 Ga0466970_0433401 Ga0466970_0433401_148_603 136
341 3300049568 Ga0501031_0128626 Ga0501031_0128626_1188_1601 136
342 3300049569 Ga0501032_0004227 Ga0501032_0004227_9857_10267 136
343 3300049569 Ga0501032_0151470 Ga0501032_0151470_290_700 136
344 3300049569 Ga0501032_0751961 Ga0501032_0751961_168_578 136
345 3300049570 Ga0501033_0017185 Ga0501033_0017185_2630_3043 136
346 3300049570 Ga0501033_0073921 Ga0501033_0073921_915_1328 136
347 3300049570 Ga0501033_0217704 Ga0501033_0217704_813_1223 136
348 3300049570 Ga0501033_0567747 Ga0501033_0567747_325_738 136
349 3300049570 Ga0501033_0904220 Ga0501033_0904220_61_471 136
350 3300049571 Ga0501034_0005919 Ga0501034_0005919_12268_12678 136
351 3300049571 Ga0501034_0015232 Ga0501034_0015232_792_1205 136
352 3300049571 Ga0501034_0086975 Ga0501034_0086975_837_1247 136
353 3300049571 Ga0501034_0100253 Ga0501034_0100253_175_588 136
354 3300049572 Ga0501036_0017384 Ga0501036_0017384_3697_4110 136
355 3300049572 Ga0501036_0102245 Ga0501036_0102245_1313_1723 136
356 3300049573 Ga0501037_0012926 Ga0501037_0012926_4808_5221 136
357 3300049573 Ga0501037_0037888 Ga0501037_0037888_1399_1809 136
358 3300049574 Ga0501038_0043781 Ga0501038_0043781_1964_2374 136
359 3300049574 Ga0501038_0054100 Ga0501038_0054100_2632_3045 136
360 3300049574 Ga0501038_0780762 Ga0501038_0780762_102_512 136
361 3300049575 Ga0501039_0004737 Ga0501039_0004737_5833_6243 136
362 3300049578 Ga0501042_0001952 Ga0501042_0001952_7630_8040 136
363 3300049578 Ga0501042_0017306 Ga0501042_0017306_384_797 136
364 3300049579 Ga0501043_0183890 Ga0501043_0183890_485_895 136
365 3300049579 Ga0501043_0237486 Ga0501043_0237486_680_1090 136
366 3300049580 Ga0501046_0001009 Ga0501046_0001009_15136_15546 136
367 3300049580 Ga0501046_0010596 Ga0501046_0010596_3103_3516 136
368 3300049580 Ga0501046_0015316 Ga0501046_0015316_190_600 136
369 3300049581 Ga0501047_0025990 Ga0501047_0025990_4789_5202 136
370 3300049581 Ga0501047_0153576 Ga0501047_0153576_1177_1587 136
371 3300049581 Ga0501047_0478271 Ga0501047_0478271_598_1008 136
372 3300049582 Ga0501048_0003662 Ga0501048_0003662_4395_4805 136
373 3300049582 Ga0501048_0005777 Ga0501048_0005777_27_440 136
374 3300049586 Ga0501070_0664739 Ga0501070_0664739_122_532 136
375 3300049744 Ga0501083_0013295 Ga0501083_0013295_1361_1771 136
376 3300049744 Ga0501083_0461628 Ga0501083_0461628_387_797 136
377 3300049822 Ga0501035_0010169 Ga0501035_0010169_6985_7398 136
378 3300049822 Ga0501035_0024142 Ga0501035_0024142_357_770 136
379 3300049822 Ga0501035_0131151 Ga0501035_0131151_263_673 136
380 3300049822 Ga0501035_0191625 Ga0501035_0191625_1177_1587 136
381 3300049822 Ga0501035_0647156 Ga0501035_0647156_335_745 136
382 3300049822 Ga0501035_0774213 Ga0501035_0774213_161_571 136
383 3300049823 Ga0501044_0025196 Ga0501044_0025196_1484_1894 136
384 3300049823 Ga0501044_0101504 Ga0501044_0101504_1732_2145 136
385 3300049823 Ga0501044_0139266 Ga0501044_0139266_102_515 136
386 3300049823 Ga0501044_0153576 Ga0501044_0153576_277_687 136
387 3300049823 Ga0501044_0457963 Ga0501044_0457963_361_771 136
388 3300049823 Ga0501044_0705576 Ga0501044_0705576_213_623 136
389 3300060353 Ga0501082_0400472 Ga0501082_0400472_414_824 136
390 3300001915 JGI24741J21665_1019606 JGI24741J21665_10196063 137
391 3300001979 JGI24740J21852_10013501 JGI24740J21852_100135014 137
392 3300001979 JGI24740J21852_10022985 JGI24740J21852_100229854 137
393 3300001989 JGI24739J22299_10002217 JGI24739J22299_100022175 137
394 3300001990 JGI24737J22298_10019213 JGI24737J22298_100192132 137
395 3300002067 JGI24735J21928_10000213 JGI24735J21928_1000021318 137
396 3300003578 Ga0006562J51391_1007922 Ga0006562J51391_10079227 137
397 3300003752 Ga0055539_1000060 Ga0055539_1000060159 137
398 3300003756 Ga0055533_1000002 Ga0055533_1000002787 137
399 3300003759 Ga0055525_1001446 Ga0055525_100144610 137
400 3300003841 Ga0055541_1003315 Ga0055541_10033154 137
401 3300005337 Ga0070682_100047689 Ga0070682_1000476892 137
402 3300005435 Ga0070714_100869636 Ga0070714_1008696363 137
403 3300005455 Ga0070663_100932125 Ga0070663_1009321253 137
404 3300005455 Ga0070663_100937669 Ga0070663_1009376692 137
405 3300005456 Ga0070678_101635063 Ga0070678_1016350631 137
406 3300005535 Ga0070684_101908047 Ga0070684_1019080471 137
407 3300005616 Ga0068852_101591509 Ga0068852_1015915091 137
408 3300006186 Ga0075369_10097827 Ga0075369_100978272 137
409 3300009551 Ga0105238_11174370 Ga0105238_111743703 137
410 3300010375 Ga0105239_11230662 Ga0105239_112306622 137
411 3300013102 Ga0157371_11115832 Ga0157371_111158322 137
412 3300013104 Ga0157370_10041389 Ga0157370_100413892 137
413 3300013105 Ga0157369_10188383 Ga0157369_101883832 137
414 3300013105 Ga0157369_10199324 Ga0157369_101993242 137
415 3300013105 Ga0157369_10270567 Ga0157369_102705672 137
416 3300013307 Ga0157372_10121760 Ga0157372_101217605 137
417 3300013307 Ga0157372_10226007 Ga0157372_102260072 137
418 3300013307 Ga0157372_10385619 Ga0157372_103856192 137
419 3300013307 Ga0157372_11125625 Ga0157372_111256252 137
420 3300013307 Ga0157372_12041782 Ga0157372_120417822 137
421 3300020070 Ga0206356_10396231 Ga0206356_103962311 137
422 3300020075 Ga0206349_1451822 Ga0206349_14518222 137
423 3300020076 Ga0206355_1119384 Ga0206355_11193842 137
424 3300020076 Ga0206355_1628509 Ga0206355_16285092 137
425 3300020078 Ga0206352_10027629 Ga0206352_100276291 137
426 3300020080 Ga0206350_11532790 Ga0206350_115327902 137
427 3300020081 Ga0206354_10458837 Ga0206354_104588372 137
428 3300020082 Ga0206353_11788779 Ga0206353_117887792 137
429 3300020610 Ga0154015_1237287 Ga0154015_12372872 137
430 3300022467 Ga0224712_10252002 Ga0224712_102520022 137
431 3300022467 Ga0224712_10291360 Ga0224712_102913602 137
432 3300025225 Ga0209566_100013 Ga0209566_1000132 137
433 3300025226 Ga0209674_100001 Ga0209674_1000012777 137
434 3300025230 Ga0209563_100001 Ga0209563_1000012777 137
435 3300025230 Ga0209563_101290 Ga0209563_1012902 137
436 3300025233 Ga0209437_100243 Ga0209437_10024369 137
437 3300025253 Ga0209677_100001 Ga0209677_1000012777 137
438 3300025253 Ga0209677_104506 Ga0209677_1045069 137
439 3300025272 Ga0209455_1002817 Ga0209455_10028179 137
440 3300025904 Ga0207647_10006645 Ga0207647_1000664513 137
441 3300025904 Ga0207647_10045953 Ga0207647_100459532 137
442 3300025909 Ga0207705_10195766 Ga0207705_101957665 137
443 3300025924 Ga0207694_10123347 Ga0207694_101233475 137
444 3300025929 Ga0207664_10829481 Ga0207664_108294812 137
445 3300037418 Ga0395900_0000888 Ga0395900_0000888_10632_11045 137
446 3300037418 Ga0395900_0091063 Ga0395900_0091063_86_499 137
447 3300037466 Ga0395898_0000355 Ga0395898_0000355_68657_69070 137
448 3300037466 Ga0395898_0379357 Ga0395898_0379357_97_510 137
449 3300044658 Ga0466972_0097604 Ga0466972_0097604_96_509 137
450 3300044658 Ga0466972_0143513 Ga0466972_0143513_364_777 137
451 3300044658 Ga0466972_0182641 Ga0466972_0182641_330_743 137
452 3300044683 Ga0466965_0006784 Ga0466965_0006784_1683_2096 137
453 3300044683 Ga0466965_0027300 Ga0466965_0027300_260_673 137
454 3300044684 Ga0466966_0034919 Ga0466966_0034919_430_843 137
455 3300044684 Ga0466966_0125781 Ga0466966_0125781_548_961 137
456 3300044693 Ga0466961_0032724 Ga0466961_0032724_2637_3050 137
457 3300044693 Ga0466961_0034046 Ga0466961_0034046_558_971 137
458 3300044693 Ga0466961_0496785 Ga0466961_0496785_47_460 137
459 3300044706 Ga0466964_0134956 Ga0466964_0134956_363_776 137
460 3300044719 Ga0466971_0095188 Ga0466971_0095188_380_793 137
461 3300044735 Ga0466968_0099395 Ga0466968_0099395_646_1059 137
462 3300044765 Ga0466970_0051289 Ga0466970_0051289_1516_1929 137
463 3300044765 Ga0466970_0103911 Ga0466970_0103911_975_1388 137
464 3300044765 Ga0466970_0116450 Ga0466970_0116450_181_594 137
465 3300044765 Ga0466970_0321679 Ga0466970_0321679_226_639 137
466 3300044842 Ga0466957_0020339 Ga0466957_0020339_2988_3401 137
467 3300044842 Ga0466957_0111458 Ga0466957_0111458_1088_1501 137
468 3300044901 Ga0466960_0162016 Ga0466960_0162016_151_564 137
469 3300045049 Ga0466959_0227289 Ga0466959_0227289_615_1028 137
470 3300045836 Ga0466958_0038660 Ga0466958_0038660_2206_2619 137
471 3300045976 Ga0466967_1286956 Ga0466967_1286956_122_535 137
472 3300047472 Ga0495686_0205228 Ga0495686_0205228_585_998 137
473 3300048903 Ga0496100_0125190 Ga0496100_0125190_153_566 137
474 3300048903 Ga0496100_0436939 Ga0496100_0436939_524_937 137
475 3300048904 Ga0496101_0112414 Ga0496101_0112414_130_543 137
476 3300048904 Ga0496101_0346846 Ga0496101_0346846_356_769 137
477 3300048905 Ga0496102_0124496 Ga0496102_0124496_805_1218 137
478 3300048905 Ga0496102_0211026 Ga0496102_0211026_773_1186 137
479 3300048905 Ga0496102_0357708 Ga0496102_0357708_684_1097 137
480 3300048906 Ga0496103_0121420 Ga0496103_0121420_784_1197 137
481 3300048907 Ga0496104_0081435 Ga0496104_0081435_1779_2192 137
482 3300048907 Ga0496104_0245166 Ga0496104_0245166_642_1055 137
483 3300048908 Ga0496105_0045176 Ga0496105_0045176_2163_2576 137
484 3300048908 Ga0496105_0174871 Ga0496105_0174871_280_693 137
485 3300048908 Ga0496105_0247754 Ga0496105_0247754_821_1234 137
486 3300048910 Ga0496107_0397843 Ga0496107_0397843_566_979 137
487 3300048916 Ga0496113_0140916 Ga0496113_0140916_157_570 137
488 3300048917 Ga0496114_0018079 Ga0496114_0018079_703_1116 137
489 3300048917 Ga0496114_0270741 Ga0496114_0270741_344_757 137
490 3300048918 Ga0496115_0046936 Ga0496115_0046936_1520_1933 137
491 3300048918 Ga0496115_0063330 Ga0496115_0063330_1173_1586 137
492 3300048918 Ga0496115_0128678 Ga0496115_0128678_1609_2022 137
493 3300048919 Ga0496116_0055969 Ga0496116_0055969_869_1282 137
494 3300048920 Ga0496117_0007338 Ga0496117_0007338_8488_8901 137
495 3300048921 Ga0496118_0003621 Ga0496118_0003621_2820_3233 137
496 3300048921 Ga0496118_0086041 Ga0496118_0086041_1187_1600 137
497 3300048929 Ga0496126_0042560 Ga0496126_0042560_3275_3688 137
498 3300048929 Ga0496126_0156680 Ga0496126_0156680_776_1189 137
499 3300048929 Ga0496126_1126322 Ga0496126_1126322_140_553 137
500 3300049586 Ga0501070_0000269 Ga0501070_0000269_20901_21314 137
501 3300053080 Ga0500635_0000066 Ga0500635_0000066_30399_30812 137
502 3300059510 Ga0587090_156412 Ga0587090_156412_89_502 137
503 3300059513 Ga0587094_123476 Ga0587094_123476_10_423 137
504 3300059514 Ga0587095_035668 Ga0587095_035668_66_479 137
505 3300059604 Ga0587098_061434 Ga0587098_061434_17_430 137
506 3300059605 Ga0587106_021455 Ga0587106_021455_402_815 137
507 3300059608 Ga0587129_023363 Ga0587129_023363_138_551 137
508 3300059622 Ga0587099_035669 Ga0587099_035669_54_467 137
509 3300059623 Ga0587101_152873 Ga0587101_152873_59_472 137
510 3300059630 Ga0587128_083639 Ga0587128_083639_42_455 137
511 3300059630 Ga0587128_117201 Ga0587128_117201_11_424 137
512 3300059631 Ga0587130_017259 Ga0587130_017259_322_735 137
513 3300059640 Ga0587067_109881 Ga0587067_109881_54_467 137
514 3300059642 Ga0587069_072611 Ga0587069_072611_128_541 137
515 3300059643 Ga0587072_081868 Ga0587072_081868_171_584 137
516 3300059645 Ga0587076_174586 Ga0587076_174586_56_469 137
517 3300059649 Ga0587102_047206 Ga0587102_047206_11_424 137
518 3300059652 Ga0587107_025842 Ga0587107_025842_303_716 137
519 3300059655 Ga0587114_030655 Ga0587114_030655_44_457 137
520 3300060344 Ga0587071_134274 Ga0587071_134274_151_564 137
521 3300061719 Ga0466962_0060492 Ga0466962_0060492_1121_1534 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12089

DUF3566

Transmembrane domain of unknown function (DUF3566)

36

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b5w-assembly3.cif.gz_F crystal structure of eschericia coli msba 0.4133 24 135
7f9l-assembly6.cif.gz_F crystal structure of the variable region of plasmodium rifin #6 (pf3d7_1400600) in complex with lair1 (with t67l, n69s and a77t mutations) 0.3709 32 125
3b5w-assembly3.cif.gz_F crystal structure of eschericia coli msba 0.3474 24 135
6zbf-assembly1.cif.gz_D merozoite surface protein 1 (msp-1) from plasmodium falciparum, alternative conformation 3 0.3214 32 127
5c22-assembly3.cif.gz_C crystal structure of zn-bound hlyd from e. coli 0.313 40 131
ID Description Score Start End Superfamily
af_A0A1D8PED5_5_115_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4851 32 137 1.25.10.10
af_Q4DWZ4_112_252_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.4702 32 133 3.30.40.10
af_A0A1D8PED5_5_115_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.406 32 137 1.25.10.10
af_K7L2Z3_1873_1969_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.365 17 122 1.25.10.10
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.363 32 127 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A7Z7BYC4-F1-model_v4 DUF3566 domain-containing protein 0.9076 25 129 GO:0016020
AF-A0A6J6DTB3-F1-model_v4 Unannotated protein 0.881 26 137 GO:0016020
AF-C7R4R4-F1-model_v4 DUF3566 domain-containing protein 0.8775 23 130 GO:0016020
AF-K6X9B7-F1-model_v4 DUF3566 domain-containing protein 0.8724 25 129 GO:0016020
AF-A0A085LI35-F1-model_v4 Membrane protein 0.8659 23 129 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.86 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map