F458737
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 521 | 268 | 1042 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0098620|Ga0453684_0098620_2299_3141 |
| Length | 280 |
| Sequence | MKALRPMIAEAVAHLRTHTAASPRVGIILGTGLGGLVDEIVASAIIDYGDIPHFPVSTVESHRGRLIFGTLSGVNVVVMQGRFHYYEGYTLKQVTFPVRVMKELGVDTLLISNAAGGMNPLFRRGDIMVIYDHINLIGDNPLIGPNDDSLGPRFPDMSEPYSLDLIRLAEQVALDRRIALQKGVFVAVAGPNLETRAEYRFLRGIGADAVGMSTVPEDIVAVHAGMRVLGFSIITDECFPDALEPVDVPAIIRTANDTEPRLRAIMRGVVEALAPAPGKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 168 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 169 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 170 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 171 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 172 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 175 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 201 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 202 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 216 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 217 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 218 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 219 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 220 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 221 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 224 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 227 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 228 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 229 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 232 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 238 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 239 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 245 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 246 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 250 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 252 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 253 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 254 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 255 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 256 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 258 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 260 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 261 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 263 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 264 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 265 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 267 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 268 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.52 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 83.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0098620 | 3300044712 | Bacteria | 3581 |
| 2 | MRS1b_contig_4179915 | 2162886011 | Unclassified | 1483 |
| 3 | JGI25153J46596_10022911 | 3300003215 | Bacteria | 2291 |
| 4 | rootH2_10009544 | 3300003320 | Bacteria | 42409 |
| 5 | rootH2_10040616 | 3300003320 | Bacteria | 2374 |
| 6 | rootH2_10079703 | 3300003320 | Bacteria | 7820 |
| 7 | rootH2_10144318 | 3300003320 | Bacteria | 5257 |
| 8 | rootL2_10039568 | 3300003322 | Bacteria | 3705 |
| 9 | rootL2_10055887 | 3300003322 | Bacteria | 4232 |
| 10 | rootL2_10086867 | 3300003322 | Bacteria | 1685 |
| 11 | rootL2_10088141 | 3300003322 | Bacteria | 3165 |
| 12 | rootL2_10225346 | 3300003322 | Unclassified | 1734 |
| 13 | rootH1_10043705 | 3300003323 | Bacteria | 7618 |
| 14 | JGI25160J50197_1005348 | 3300003354 | Bacteria | 5361 |
| 15 | Ga0055535_1001325 | 3300003761 | Bacteria | 13183 |
| 16 | Ga0055526_1029785 | 3300003771 | Bacteria | 1610 |
| 17 | Ga0055528_1001409 | 3300003790 | Bacteria | 14726 |
| 18 | Ga0055528_1003892 | 3300003790 | Bacteria | 7340 |
| 19 | Ga0055530_10000629 | 3300003791 | Bacteria | 30409 |
| 20 | Ga0055530_10014473 | 3300003791 | Bacteria | 2625 |
| 21 | Ga0055531_10000237 | 3300003794 | Bacteria | 60479 |
| 22 | Ga0055531_10042374 | 3300003794 | Bacteria | 1304 |
| 23 | Ga0055543_1018264 | 3300004625 | Bacteria | 1310 |
| 24 | Ga0065165_1000190 | 3300005262 | Bacteria | 107377 |
| 25 | Ga0065714_10074356 | 3300005288 | Bacteria | 3049 |
| 26 | Ga0065712_10141767 | 3300005290 | Bacteria | 1444 |
| 27 | Ga0070658_10000857 | 3300005327 | Bacteria | 25975 |
| 28 | Ga0070676_10000507 | 3300005328 | Bacteria | 18654 |
| 29 | Ga0070670_100022675 | 3300005331 | Bacteria | 5402 |
| 30 | Ga0070670_100107969 | 3300005331 | Unclassified | 2398 |
| 31 | Ga0070677_10004868 | 3300005333 | Bacteria | 4407 |
| 32 | Ga0068869_100019836 | 3300005334 | Unclassified | 4602 |
| 33 | Ga0068869_100096186 | 3300005334 | Bacteria | 2235 |
| 34 | Ga0070666_10000043 | 3300005335 | Bacteria | 111402 |
| 35 | Ga0070680_100002208 | 3300005336 | Bacteria | 14351 |
| 36 | Ga0070682_100000054 | 3300005337 | Bacteria | 112635 |
| 37 | Ga0070682_100002478 | 3300005337 | Bacteria | 10193 |
| 38 | Ga0070682_100049741 | 3300005337 | Bacteria | 2614 |
| 39 | Ga0068868_100000346 | 3300005338 | Bacteria | 31447 |
| 40 | Ga0068868_100238434 | 3300005338 | Unclassified | 1527 |
| 41 | Ga0068868_100416739 | 3300005338 | Bacteria | 1162 |
| 42 | Ga0070660_100045014 | 3300005339 | Unclassified | 3377 |
| 43 | Ga0070691_10009814 | 3300005341 | Bacteria | 4366 |
| 44 | Ga0070661_100094196 | 3300005344 | Bacteria | 2219 |
| 45 | Ga0070668_100005211 | 3300005347 | Bacteria | 9642 |
| 46 | Ga0070668_100149663 | 3300005347 | Unclassified | 1887 |
| 47 | Ga0070669_100073610 | 3300005353 | Bacteria | 2531 |
| 48 | Ga0070675_100095157 | 3300005354 | Bacteria | 2500 |
| 49 | Ga0070671_100039412 | 3300005355 | Bacteria | 3922 |
| 50 | Ga0070671_100048885 | 3300005355 | Bacteria | 3519 |
| 51 | Ga0070671_100052230 | 3300005355 | Unclassified | 3399 |
| 52 | Ga0070671_100131695 | 3300005355 | Bacteria | 2106 |
| 53 | Ga0070671_100193903 | 3300005355 | Bacteria | 1722 |
| 54 | Ga0070674_100084086 | 3300005356 | Bacteria | 2281 |
| 55 | Ga0070673_100001042 | 3300005364 | Bacteria | 15733 |
| 56 | Ga0070673_100215763 | 3300005364 | Bacteria | 1659 |
| 57 | Ga0070673_100286627 | 3300005364 | Unclassified | 1446 |
| 58 | Ga0070667_100003119 | 3300005367 | Bacteria | 14241 |
| 59 | Ga0070667_100011774 | 3300005367 | Bacteria | 7228 |
| 60 | Ga0070667_100039591 | 3300005367 | Bacteria | 3951 |
| 61 | Ga0070667_100040189 | 3300005367 | Unclassified | 3922 |
| 62 | Ga0070678_100258875 | 3300005456 | Bacteria | 1462 |
| 63 | Ga0070662_100020993 | 3300005457 | Bacteria | 4455 |
| 64 | Ga0070681_10025897 | 3300005458 | Bacteria | 5896 |
| 65 | Ga0068867_100007630 | 3300005459 | Bacteria | 7653 |
| 66 | Ga0068867_100016825 | 3300005459 | Bacteria | 5196 |
| 67 | Ga0070706_100334039 | 3300005467 | Bacteria | 1413 |
| 68 | Ga0070698_100095714 | 3300005471 | Bacteria | 2947 |
| 69 | Ga0070698_100381166 | 3300005471 | Bacteria | 1343 |
| 70 | Ga0070679_100017428 | 3300005530 | Bacteria | 6951 |
| 71 | Ga0070684_100003150 | 3300005535 | Bacteria | 12313 |
| 72 | Ga0068853_100039537 | 3300005539 | Bacteria | 4024 |
| 73 | Ga0068853_100063568 | 3300005539 | Bacteria | 3197 |
| 74 | Ga0068853_100102767 | 3300005539 | Bacteria | 2529 |
| 75 | Ga0070672_100001246 | 3300005543 | Bacteria | 15660 |
| 76 | Ga0070672_100050208 | 3300005543 | Bacteria | 3248 |
| 77 | Ga0070672_100419978 | 3300005543 | Bacteria | 1149 |
| 78 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 79 | Ga0070665_100055304 | 3300005548 | Bacteria | 3980 |
| 80 | Ga0068855_100015722 | 3300005563 | Bacteria | 9103 |
| 81 | Ga0068855_100042337 | 3300005563 | Bacteria | 5396 |
| 82 | Ga0068855_100813493 | 3300005563 | Unclassified | 992 |
| 83 | Ga0070664_100010422 | 3300005564 | Bacteria | 7537 |
| 84 | Ga0068857_100047951 | 3300005577 | Bacteria | 3794 |
| 85 | Ga0068857_100224689 | 3300005577 | Unclassified | 1716 |
| 86 | Ga0068856_100049922 | 3300005614 | Bacteria | 4124 |
| 87 | Ga0068856_100092965 | 3300005614 | Bacteria | 3001 |
| 88 | Ga0068852_100011311 | 3300005616 | Bacteria | 6714 |
| 89 | Ga0068852_100109435 | 3300005616 | Unclassified | 2509 |
| 90 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 91 | Ga0068859_100016532 | 3300005617 | Bacteria | 7407 |
| 92 | Ga0068859_100080764 | 3300005617 | Bacteria | 3293 |
| 93 | Ga0068859_100294773 | 3300005617 | Bacteria | 1715 |
| 94 | Ga0068864_100003733 | 3300005618 | Bacteria | 12569 |
| 95 | Ga0068864_100018754 | 3300005618 | Bacteria | 5782 |
| 96 | Ga0068864_100602624 | 3300005618 | Bacteria | 1066 |
| 97 | Ga0068866_10089124 | 3300005718 | Bacteria | 1676 |
| 98 | Ga0068861_100021142 | 3300005719 | Bacteria | 4676 |
| 99 | Ga0068861_100117197 | 3300005719 | Bacteria | 2143 |
| 100 | Ga0068851_10004819 | 3300005834 | Bacteria | 6107 |
| 101 | Ga0068851_10150961 | 3300005834 | Bacteria | 1270 |
| 102 | Ga0068851_10152277 | 3300005834 | Bacteria | 1265 |
| 103 | Ga0068863_100004641 | 3300005841 | Bacteria | 13546 |
| 104 | Ga0068863_100007625 | 3300005841 | Bacteria | 10584 |
| 105 | Ga0068863_100045334 | 3300005841 | Viruses | 4173 |
| 106 | Ga0068863_100518628 | 3300005841 | Bacteria | 1175 |
| 107 | Ga0068858_100000505 | 3300005842 | Bacteria | 40920 |
| 108 | Ga0068858_100004161 | 3300005842 | Bacteria | 14235 |
| 109 | Ga0068860_100000383 | 3300005843 | Bacteria | 57999 |
| 110 | Ga0068860_100000700 | 3300005843 | Bacteria | 38538 |
| 111 | Ga0068860_100000764 | 3300005843 | Bacteria | 36178 |
| 112 | Ga0068860_100007672 | 3300005843 | Bacteria | 10783 |
| 113 | Ga0068860_100011318 | 3300005843 | Bacteria | 8793 |
| 114 | Ga0068860_100016430 | 3300005843 | Bacteria | 7217 |
| 115 | Ga0068860_100238690 | 3300005843 | Bacteria | 1768 |
| 116 | Ga0075366_10000063 | 3300006195 | Bacteria | 39802 |
| 117 | Ga0075366_10181946 | 3300006195 | Bacteria | 1277 |
| 118 | Ga0075366_10204265 | 3300006195 | Unclassified | 1202 |
| 119 | Ga0075366_10266675 | 3300006195 | Bacteria | 1045 |
| 120 | Ga0097621_100001591 | 3300006237 | Bacteria | 15526 |
| 121 | Ga0097621_100042363 | 3300006237 | Bacteria | 3667 |
| 122 | Ga0068871_100000737 | 3300006358 | Bacteria | 22233 |
| 123 | Ga0068871_100132346 | 3300006358 | Bacteria | 2115 |
| 124 | Ga0068865_100006644 | 3300006881 | Bacteria | 7076 |
| 125 | Ga0068865_100112213 | 3300006881 | Unclassified | 2013 |
| 126 | Ga0068865_100405096 | 3300006881 | Bacteria | 1118 |
| 127 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 128 | Ga0097620_100016532 | 3300006931 | Bacteria | 7407 |
| 129 | Ga0097620_100080762 | 3300006931 | Bacteria | 3293 |
| 130 | Ga0097620_100294778 | 3300006931 | Bacteria | 1715 |
| 131 | Ga0075435_100475427 | 3300007076 | Bacteria | 1079 |
| 132 | Ga0105240_10000224 | 3300009093 | Bacteria | 113175 |
| 133 | Ga0105240_10003457 | 3300009093 | Bacteria | 24509 |
| 134 | Ga0105240_10005749 | 3300009093 | Bacteria | 18399 |
| 135 | Ga0105240_10078578 | 3300009093 | Bacteria | 4063 |
| 136 | Ga0105240_10192364 | 3300009093 | Bacteria | 2398 |
| 137 | Ga0105245_10218401 | 3300009098 | Bacteria | 1838 |
| 138 | Ga0105245_10277984 | 3300009098 | Unclassified | 1635 |
| 139 | Ga0105247_10009650 | 3300009101 | Bacteria | 5854 |
| 140 | Ga0114129_10001869 | 3300009147 | Bacteria | 28696 |
| 141 | Ga0105241_10000493 | 3300009174 | Bacteria | 29814 |
| 142 | Ga0105241_10000621 | 3300009174 | Bacteria | 26706 |
| 143 | Ga0105241_10001522 | 3300009174 | Bacteria | 17775 |
| 144 | Ga0105241_10077133 | 3300009174 | Bacteria | 2600 |
| 145 | Ga0105241_10078344 | 3300009174 | Bacteria | 2582 |
| 146 | Ga0105241_10561278 | 3300009174 | Unclassified | 1026 |
| 147 | Ga0105242_10031987 | 3300009176 | Bacteria | 4206 |
| 148 | Ga0105242_10124521 | 3300009176 | Unclassified | 2217 |
| 149 | Ga0105248_10283289 | 3300009177 | Bacteria | 1866 |
| 150 | Ga0105237_10000719 | 3300009545 | Bacteria | 45812 |
| 151 | Ga0105237_10000725 | 3300009545 | Bacteria | 45577 |
| 152 | Ga0105237_10002801 | 3300009545 | Bacteria | 21180 |
| 153 | Ga0105237_10003801 | 3300009545 | Bacteria | 17746 |
| 154 | Ga0105237_10004541 | 3300009545 | Bacteria | 16041 |
| 155 | Ga0105237_10151168 | 3300009545 | Bacteria | 2318 |
| 156 | Ga0105238_10000247 | 3300009551 | Bacteria | 60300 |
| 157 | Ga0105238_10144195 | 3300009551 | Bacteria | 2358 |
| 158 | Ga0105238_10337814 | 3300009551 | Bacteria | 1494 |
| 159 | Ga0105249_10002694 | 3300009553 | Bacteria | 15357 |
| 160 | Ga0105249_10060790 | 3300009553 | Bacteria | 3466 |
| 161 | Ga0105249_10329490 | 3300009553 | Bacteria | 1540 |
| 162 | Ga0105239_10000685 | 3300010375 | Bacteria | 48269 |
| 163 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 164 | Ga0105239_10025508 | 3300010375 | Bacteria | 6508 |
| 165 | Ga0105239_10029882 | 3300010375 | Bacteria | 5993 |
| 166 | Ga0105239_10064386 | 3300010375 | Bacteria | 4025 |
| 167 | Ga0105239_10140480 | 3300010375 | Bacteria | 2691 |
| 168 | Ga0105239_10240102 | 3300010375 | Bacteria | 2034 |
| 169 | Ga0105246_10273214 | 3300011119 | Unclassified | 1352 |
| 170 | Ga0157373_10009465 | 3300013100 | Bacteria | 7198 |
| 171 | Ga0157371_10064962 | 3300013102 | Bacteria | 2584 |
| 172 | Ga0157370_10004711 | 3300013104 | Bacteria | 15544 |
| 173 | Ga0157370_10313872 | 3300013104 | Bacteria | 1446 |
| 174 | Ga0157369_10181421 | 3300013105 | Unclassified | 2215 |
| 175 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 176 | Ga0157374_10233291 | 3300013296 | Bacteria | 1808 |
| 177 | Ga0157374_10404255 | 3300013296 | Bacteria | 1363 |
| 178 | Ga0157378_10156202 | 3300013297 | Bacteria | 2130 |
| 179 | Ga0157378_10643935 | 3300013297 | Bacteria | 1075 |
| 180 | Ga0163162_10000840 | 3300013306 | Bacteria | 28540 |
| 181 | Ga0163162_10001520 | 3300013306 | Bacteria | 21611 |
| 182 | Ga0163162_10011675 | 3300013306 | Bacteria | 8565 |
| 183 | Ga0163162_10044223 | 3300013306 | Bacteria | 4460 |
| 184 | Ga0163162_10050354 | 3300013306 | Bacteria | 4177 |
| 185 | Ga0163162_10061988 | 3300013306 | Bacteria | 3779 |
| 186 | Ga0163162_10094447 | 3300013306 | Unclassified | 3077 |
| 187 | Ga0163162_10266099 | 3300013306 | Bacteria | 1846 |
| 188 | Ga0157372_10005928 | 3300013307 | Bacteria | 12995 |
| 189 | Ga0157372_10041159 | 3300013307 | Bacteria | 5108 |
| 190 | Ga0157372_10179349 | 3300013307 | Bacteria | 2452 |
| 191 | Ga0157372_10220543 | 3300013307 | Bacteria | 2198 |
| 192 | Ga0157372_10438249 | 3300013307 | Unclassified | 1523 |
| 193 | Ga0157372_10661081 | 3300013307 | Bacteria | 1217 |
| 194 | Ga0157375_10008330 | 3300013308 | Bacteria | 9080 |
| 195 | Ga0157375_10119087 | 3300013308 | Bacteria | 2748 |
| 196 | Ga0157375_10123181 | 3300013308 | Unclassified | 2705 |
| 197 | Ga0157375_10182989 | 3300013308 | Bacteria | 2248 |
| 198 | Ga0157375_10237058 | 3300013308 | Bacteria | 1984 |
| 199 | Ga0163163_10000407 | 3300014325 | Bacteria | 40536 |
| 200 | Ga0163163_10002778 | 3300014325 | Bacteria | 14786 |
| 201 | Ga0163163_10011385 | 3300014325 | Bacteria | 8063 |
| 202 | Ga0163163_10126994 | 3300014325 | Bacteria | 2588 |
| 203 | Ga0163163_10161155 | 3300014325 | Unclassified | 2289 |
| 204 | Ga0157380_10012636 | 3300014326 | Bacteria | 6128 |
| 205 | Ga0157380_10034929 | 3300014326 | Bacteria | 3880 |
| 206 | Ga0157380_10046441 | 3300014326 | Bacteria | 3411 |
| 207 | Ga0157379_10010697 | 3300014968 | Bacteria | 7995 |
| 208 | Ga0157379_10031263 | 3300014968 | Bacteria | 4742 |
| 209 | Ga0157379_10036208 | 3300014968 | Unclassified | 4400 |
| 210 | Ga0157379_10088730 | 3300014968 | Bacteria | 2774 |
| 211 | Ga0157379_10467567 | 3300014968 | Bacteria | 1166 |
| 212 | Ga0157376_10001529 | 3300014969 | Bacteria | 15246 |
| 213 | Ga0157376_10030372 | 3300014969 | Bacteria | 4315 |
| 214 | Ga0157376_10053042 | 3300014969 | Bacteria | 3374 |
| 215 | Ga0157376_10435801 | 3300014969 | Bacteria | 1275 |
| 216 | Ga0163161_10023951 | 3300017792 | Unclassified | 4309 |
| 217 | Ga0213876_10006282 | 3300021384 | Bacteria | 6472 |
| 218 | Ga0213876_10007563 | 3300021384 | Bacteria | 5900 |
| 219 | Ga0209436_101685 | 3300025208 | Bacteria | 7299 |
| 220 | Ga0209436_104301 | 3300025208 | Bacteria | 3544 |
| 221 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 222 | Ga0209148_1000343 | 3300025254 | Bacteria | 61260 |
| 223 | Ga0209673_1000403 | 3300025273 | Bacteria | 76872 |
| 224 | Ga0209130_1011833 | 3300025284 | Bacteria | 2315 |
| 225 | Ga0209564_1009069 | 3300025295 | Bacteria | 4790 |
| 226 | Ga0209758_1023582 | 3300025297 | Bacteria | 2778 |
| 227 | Ga0209758_1065226 | 3300025297 | Bacteria | 1176 |
| 228 | Ga0209050_1000136 | 3300025298 | Bacteria | 179113 |
| 229 | Ga0207426_1000164 | 3300025302 | Bacteria | 171465 |
| 230 | Ga0207426_1000543 | 3300025302 | Bacteria | 53486 |
| 231 | Ga0209051_1067936 | 3300025303 | Bacteria | 1087 |
| 232 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 233 | Ga0209257_1002647 | 3300025304 | Bacteria | 17224 |
| 234 | Ga0207656_10001567 | 3300025321 | Bacteria | 7598 |
| 235 | Ga0207656_10012177 | 3300025321 | Bacteria | 3266 |
| 236 | Ga0207682_10021864 | 3300025893 | Bacteria | 2517 |
| 237 | Ga0207642_10254192 | 3300025899 | Bacteria | 999 |
| 238 | Ga0207680_10000108 | 3300025903 | Bacteria | 38066 |
| 239 | Ga0207680_10002539 | 3300025903 | Bacteria | 8509 |
| 240 | Ga0207647_10000831 | 3300025904 | Bacteria | 23995 |
| 241 | Ga0207647_10044871 | 3300025904 | Bacteria | 2760 |
| 242 | Ga0207645_10002853 | 3300025907 | Bacteria | 13402 |
| 243 | Ga0207645_10219288 | 3300025907 | Unclassified | 1254 |
| 244 | Ga0207643_10266874 | 3300025908 | Bacteria | 1058 |
| 245 | Ga0207705_10003710 | 3300025909 | Bacteria | 11625 |
| 246 | Ga0207654_10000775 | 3300025911 | Bacteria | 17563 |
| 247 | Ga0207654_10002900 | 3300025911 | Bacteria | 8696 |
| 248 | Ga0207654_10004284 | 3300025911 | Bacteria | 7197 |
| 249 | Ga0207707_10000889 | 3300025912 | Bacteria | 29199 |
| 250 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 251 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 252 | Ga0207695_10002344 | 3300025913 | Bacteria | 28132 |
| 253 | Ga0207695_10016439 | 3300025913 | Bacteria | 8656 |
| 254 | Ga0207695_10135384 | 3300025913 | Bacteria | 2417 |
| 255 | Ga0207671_10001536 | 3300025914 | Bacteria | 26452 |
| 256 | Ga0207671_10002088 | 3300025914 | Bacteria | 21861 |
| 257 | Ga0207671_10010686 | 3300025914 | Bacteria | 7550 |
| 258 | Ga0207671_10100678 | 3300025914 | Bacteria | 2188 |
| 259 | Ga0207660_10002515 | 3300025917 | Bacteria | 12055 |
| 260 | Ga0207662_10130832 | 3300025918 | Bacteria | 1582 |
| 261 | Ga0207649_10192630 | 3300025920 | Bacteria | 1435 |
| 262 | Ga0207649_10414839 | 3300025920 | Unclassified | 1010 |
| 263 | Ga0207652_10002423 | 3300025921 | Bacteria | 15744 |
| 264 | Ga0207652_10071047 | 3300025921 | Bacteria | 3024 |
| 265 | Ga0207681_10063874 | 3300025923 | Bacteria | 2540 |
| 266 | Ga0207694_10004436 | 3300025924 | Bacteria | 10971 |
| 267 | Ga0207650_10012509 | 3300025925 | Bacteria | 5858 |
| 268 | Ga0207650_10446005 | 3300025925 | Bacteria | 1076 |
| 269 | Ga0207659_10038822 | 3300025926 | Bacteria | 3314 |
| 270 | Ga0207659_10147924 | 3300025926 | Bacteria | 1831 |
| 271 | Ga0207644_10017050 | 3300025931 | Bacteria | 4898 |
| 272 | Ga0207644_10021140 | 3300025931 | Unclassified | 4430 |
| 273 | Ga0207644_10027333 | 3300025931 | Bacteria | 3941 |
| 274 | Ga0207706_10025929 | 3300025933 | Bacteria | 5249 |
| 275 | Ga0207686_10015195 | 3300025934 | Bacteria | 4301 |
| 276 | Ga0207669_10128503 | 3300025937 | Bacteria | 1736 |
| 277 | Ga0207704_10002218 | 3300025938 | Bacteria | 8711 |
| 278 | Ga0207704_10297944 | 3300025938 | Bacteria | 1234 |
| 279 | Ga0207691_10000228 | 3300025940 | Bacteria | 54500 |
| 280 | Ga0207691_10062119 | 3300025940 | Bacteria | 3391 |
| 281 | Ga0207691_10151174 | 3300025940 | Bacteria | 2041 |
| 282 | Ga0207689_10001398 | 3300025942 | Bacteria | 23013 |
| 283 | Ga0207689_10003446 | 3300025942 | Bacteria | 14441 |
| 284 | Ga0207689_10110637 | 3300025942 | Bacteria | 2257 |
| 285 | Ga0207661_10028363 | 3300025944 | Unclassified | 4286 |
| 286 | Ga0207679_10003970 | 3300025945 | Bacteria | 9193 |
| 287 | Ga0207679_10208273 | 3300025945 | Bacteria | 1638 |
| 288 | Ga0207667_10005340 | 3300025949 | Bacteria | 15665 |
| 289 | Ga0207667_10052787 | 3300025949 | Bacteria | 4279 |
| 290 | Ga0207651_10023614 | 3300025960 | Bacteria | 3787 |
| 291 | Ga0207651_10072754 | 3300025960 | Unclassified | 2442 |
| 292 | Ga0207712_10034964 | 3300025961 | Unclassified | 3409 |
| 293 | Ga0207712_10073408 | 3300025961 | Bacteria | 2467 |
| 294 | Ga0207668_10002045 | 3300025972 | Bacteria | 11766 |
| 295 | Ga0207668_10142047 | 3300025972 | Unclassified | 1848 |
| 296 | Ga0207658_10001335 | 3300025986 | Bacteria | 19330 |
| 297 | Ga0207658_10024620 | 3300025986 | Unclassified | 4212 |
| 298 | Ga0207658_10139471 | 3300025986 | Bacteria | 1960 |
| 299 | Ga0207658_10402571 | 3300025986 | Bacteria | 1203 |
| 300 | Ga0207677_10000978 | 3300026023 | Bacteria | 15812 |
| 301 | Ga0207677_10061035 | 3300026023 | Unclassified | 2609 |
| 302 | Ga0207703_10004989 | 3300026035 | Bacteria | 10772 |
| 303 | Ga0207703_10008484 | 3300026035 | Bacteria | 8120 |
| 304 | Ga0207639_10042406 | 3300026041 | Bacteria | 3410 |
| 305 | Ga0207702_10047249 | 3300026078 | Bacteria | 3627 |
| 306 | Ga0207702_10069480 | 3300026078 | Bacteria | 3029 |
| 307 | Ga0207641_10000048 | 3300026088 | Bacteria | 178206 |
| 308 | Ga0207641_10039850 | 3300026088 | Unclassified | 3930 |
| 309 | Ga0207641_10220787 | 3300026088 | Unclassified | 1757 |
| 310 | Ga0207648_10007506 | 3300026089 | Bacteria | 10709 |
| 311 | Ga0207648_10013131 | 3300026089 | Bacteria | 7720 |
| 312 | Ga0207648_10022540 | 3300026089 | Bacteria | 5653 |
| 313 | Ga0207648_10047172 | 3300026089 | Bacteria | 3777 |
| 314 | Ga0207648_10263090 | 3300026089 | Bacteria | 1539 |
| 315 | Ga0207676_10001611 | 3300026095 | Bacteria | 16622 |
| 316 | Ga0207676_10014711 | 3300026095 | Bacteria | 5636 |
| 317 | Ga0207674_10080681 | 3300026116 | Bacteria | 3256 |
| 318 | Ga0207674_10231552 | 3300026116 | Bacteria | 1795 |
| 319 | Ga0207674_10301503 | 3300026116 | Unclassified | 1551 |
| 320 | Ga0207674_10387768 | 3300026116 | Bacteria | 1350 |
| 321 | Ga0207674_10507289 | 3300026116 | Bacteria | 1165 |
| 322 | Ga0207675_100057429 | 3300026118 | Bacteria | 3631 |
| 323 | Ga0207675_100081635 | 3300026118 | Bacteria | 3032 |
| 324 | Ga0207683_10095638 | 3300026121 | Bacteria | 2648 |
| 325 | Ga0207683_10209837 | 3300026121 | Unclassified | 1772 |
| 326 | Ga0207698_10002537 | 3300026142 | Bacteria | 10842 |
| 327 | Ga0207698_10109863 | 3300026142 | Bacteria | 2308 |
| 328 | Ga0207698_10147360 | 3300026142 | Unclassified | 2038 |
| 329 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 330 | Ga0268266_10008792 | 3300028379 | Bacteria | 8951 |
| 331 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 332 | Ga0268264_10002959 | 3300028381 | Bacteria | 14756 |
| 333 | Ga0268264_10003558 | 3300028381 | Bacteria | 13412 |
| 334 | Ga0268264_10006197 | 3300028381 | Bacteria | 10100 |
| 335 | Ga0268264_10028309 | 3300028381 | Bacteria | 4583 |
| 336 | Ga0268264_10059517 | 3300028381 | Bacteria | 3200 |
| 337 | Ga0268264_10250252 | 3300028381 | Bacteria | 1646 |
| 338 | Ga0268264_10490286 | 3300028381 | Bacteria | 1197 |
| 339 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 340 | Ga0307515_10000290 | 3300028794 | Bacteria | 123604 |
| 341 | Ga0307515_10008220 | 3300028794 | Bacteria | 20411 |
| 342 | Ga0265327_10000248 | 3300031251 | Bacteria | 107284 |
| 343 | Ga0265327_10000285 | 3300031251 | Bacteria | 99746 |
| 344 | Ga0265327_10001115 | 3300031251 | Bacteria | 37124 |
| 345 | Ga0265327_10007365 | 3300031251 | Bacteria | 8517 |
| 346 | Ga0265327_10042850 | 3300031251 | Bacteria | 2427 |
| 347 | Ga0307509_10019958 | 3300031507 | Bacteria | 7621 |
| 348 | Ga0307509_10025149 | 3300031507 | Bacteria | 6653 |
| 349 | Ga0307408_100000139 | 3300031548 | Bacteria | 80738 |
| 350 | Ga0307413_10315560 | 3300031824 | Bacteria | 1192 |
| 351 | Ga0307410_10193434 | 3300031852 | Unclassified | 1548 |
| 352 | Ga0307407_10011082 | 3300031903 | Bacteria | 4278 |
| 353 | Ga0307407_10054778 | 3300031903 | Bacteria | 2302 |
| 354 | Ga0307412_10104280 | 3300031911 | Bacteria | 2012 |
| 355 | Ga0307409_100053824 | 3300031995 | Bacteria | 3095 |
| 356 | Ga0307416_100021717 | 3300032002 | Unclassified | 4615 |
| 357 | Ga0307411_10011334 | 3300032005 | Bacteria | 4807 |
| 358 | Ga0307411_10041573 | 3300032005 | Bacteria | 2926 |
| 359 | Ga0307415_100080347 | 3300032126 | Unclassified | 2326 |
| 360 | Ga0395900_0051882 | 3300037418 | Unclassified | 4224 |
| 361 | Ga0395905_0060715 | 3300037471 | Unclassified | 3535 |
| 362 | Ga0395905_0168289 | 3300037471 | Bacteria | 2059 |
| 363 | Ga0395901_0055048 | 3300038443 | Bacteria | 4136 |
| 364 | Ga0436365_1287042 | 3300039437 | Bacteria | 20912 |
| 365 | Ga0436365_1339095 | 3300039437 | Bacteria | 1892 |
| 366 | Ga0439436_0025088 | 3300041404 | Bacteria | 1754 |
| 367 | Ga0439433_0048598 | 3300041999 | Bacteria | 997 |
| 368 | Ga0439449_0032338 | 3300042007 | Bacteria | 1950 |
| 369 | Ga0439449_0038848 | 3300042007 | Bacteria | 1769 |
| 370 | Ga0439449_0038939 | 3300042007 | Bacteria | 1767 |
| 371 | Ga0439449_0040922 | 3300042007 | Bacteria | 1723 |
| 372 | Ga0439449_0138343 | 3300042007 | Bacteria | 906 |
| 373 | Ga0439457_000696 | 3300042014 | Bacteria | 9932 |
| 374 | Ga0439457_017275 | 3300042014 | Bacteria | 1603 |
| 375 | Ga0439457_020912 | 3300042014 | Bacteria | 1451 |
| 376 | Ga0439462_0000918 | 3300042015 | Bacteria | 6239 |
| 377 | Ga0439434_0011095 | 3300042435 | Bacteria | 2662 |
| 378 | Ga0451577_0000557 | 3300042876 | Bacteria | 60863 |
| 379 | Ga0451577_0063175 | 3300042876 | Unclassified | 3302 |
| 380 | Ga0466969_0000238 | 3300044656 | Bacteria | 30098 |
| 381 | Ga0466972_0037517 | 3300044658 | Bacteria | 2369 |
| 382 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 383 | Ga0453684_0000024 | 3300044712 | Bacteria | 819351 |
| 384 | Ga0453684_0011220 | 3300044712 | Bacteria | 15084 |
| 385 | Ga0453684_0547159 | 3300044712 | Bacteria | 1276 |
| 386 | Ga0466968_0040342 | 3300044735 | Bacteria | 1968 |
| 387 | Ga0466970_0082120 | 3300044765 | Bacteria | 1743 |
| 388 | Ga0466957_0001467 | 3300044842 | Bacteria | 12361 |
| 389 | Ga0466957_0002368 | 3300044842 | Bacteria | 10116 |
| 390 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 391 | Ga0466959_0044378 | 3300045049 | Bacteria | 3276 |
| 392 | Ga0495638_0070096 | 3300046460 | Bacteria | 2147 |
| 393 | Ga0495650_0035182 | 3300046471 | Bacteria | 2207 |
| 394 | Ga0495650_0112720 | 3300046471 | Bacteria | 1008 |
| 395 | Ga0495585_0000588 | 3300046492 | Bacteria | 34090 |
| 396 | Ga0495648_0000729 | 3300046524 | Bacteria | 35114 |
| 397 | Ga0495648_0034384 | 3300046524 | Bacteria | 3298 |
| 398 | Ga0495654_0116154 | 3300046530 | Bacteria | 1215 |
| 399 | Ga0495609_0003030 | 3300046538 | Bacteria | 9894 |
| 400 | Ga0495622_0042549 | 3300046557 | Bacteria | 2112 |
| 401 | Ga0495633_0000027 | 3300046558 | Bacteria | 204613 |
| 402 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 403 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 404 | Ga0495611_0010178 | 3300046648 | Bacteria | 3979 |
| 405 | Ga0495625_0001499 | 3300046660 | Bacteria | 28047 |
| 406 | Ga0495625_0010588 | 3300046660 | Bacteria | 7613 |
| 407 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 408 | Ga0495686_0000111 | 3300047472 | Bacteria | 168708 |
| 409 | Ga0496101_0165095 | 3300048904 | Bacteria | 1700 |
| 410 | Ga0496104_0307228 | 3300048907 | Unclassified | 1499 |
| 411 | Ga0496109_0473109 | 3300048912 | Bacteria | 1183 |
| 412 | Ga0496114_0001077 | 3300048917 | Bacteria | 20545 |
| 413 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 414 | Ga0496126_0103252 | 3300048929 | Bacteria | 2491 |
| 415 | Ga0501291_002155 | 3300049514 | Bacteria | 2334 |
| 416 | Ga0501292_006776 | 3300049515 | Unclassified | 1638 |
| 417 | Ga0501298_002421 | 3300049521 | Bacteria | 2820 |
| 418 | Ga0501298_004007 | 3300049521 | Bacteria | 2302 |
| 419 | Ga0501032_0030082 | 3300049569 | Bacteria | 3725 |
| 420 | Ga0501032_0260073 | 3300049569 | Bacteria | 1125 |
| 421 | Ga0501034_0009006 | 3300049571 | Bacteria | 10483 |
| 422 | Ga0501034_0036396 | 3300049571 | Unclassified | 4986 |
| 423 | Ga0501034_0063319 | 3300049571 | Unclassified | 3712 |
| 424 | Ga0501034_0076765 | 3300049571 | Bacteria | 3347 |
| 425 | Ga0501034_0105005 | 3300049571 | Bacteria | 2818 |
| 426 | Ga0501036_0005849 | 3300049572 | Bacteria | 9960 |
| 427 | Ga0501036_0081308 | 3300049572 | Bacteria | 2738 |
| 428 | Ga0501037_0040682 | 3300049573 | Bacteria | 3420 |
| 429 | Ga0501039_0016507 | 3300049575 | Bacteria | 5655 |
| 430 | Ga0501039_0153598 | 3300049575 | Unclassified | 1808 |
| 431 | Ga0501043_0057413 | 3300049579 | Bacteria | 3056 |
| 432 | Ga0501043_0059596 | 3300049579 | Unclassified | 2996 |
| 433 | Ga0501043_0235181 | 3300049579 | Unclassified | 1414 |
| 434 | Ga0501046_0127449 | 3300049580 | Unclassified | 1932 |
| 435 | Ga0501046_0241354 | 3300049580 | Bacteria | 1332 |
| 436 | Ga0501047_0093248 | 3300049581 | Bacteria | 2890 |
| 437 | Ga0501047_0497042 | 3300049581 | Bacteria | 1046 |
| 438 | Ga0501070_0062682 | 3300049586 | Bacteria | 3080 |
| 439 | Ga0501073_0003496 | 3300049589 | Bacteria | 11804 |
| 440 | Ga0501074_0049654 | 3300049590 | Bacteria | 3029 |
| 441 | Ga0501198_008065 | 3300049649 | Unclassified | 1522 |
| 442 | Ga0501201_001251 | 3300049651 | Bacteria | 2383 |
| 443 | Ga0501202_012479 | 3300049652 | Bacteria | 1604 |
| 444 | Ga0501206_007265 | 3300049653 | Bacteria | 1451 |
| 445 | Ga0501216_018027 | 3300049660 | Unclassified | 1212 |
| 446 | Ga0501217_001378 | 3300049661 | Bacteria | 4531 |
| 447 | Ga0501222_002119 | 3300049662 | Bacteria | 2749 |
| 448 | Ga0501223_006096 | 3300049663 | Bacteria | 2508 |
| 449 | Ga0501223_007613 | 3300049663 | Bacteria | 2215 |
| 450 | Ga0501224_002454 | 3300049664 | Bacteria | 2527 |
| 451 | Ga0501224_004824 | 3300049664 | Bacteria | 1924 |
| 452 | Ga0501230_018742 | 3300049667 | Bacteria | 1185 |
| 453 | Ga0501233_016607 | 3300049668 | Bacteria | 1528 |
| 454 | Ga0501235_003473 | 3300049669 | Unclassified | 3410 |
| 455 | Ga0501242_001913 | 3300049674 | Bacteria | 2150 |
| 456 | Ga0501243_010000 | 3300049675 | Unclassified | 1477 |
| 457 | Ga0501247_002963 | 3300049677 | Unclassified | 1798 |
| 458 | Ga0501252_000718 | 3300049682 | Bacteria | 2723 |
| 459 | Ga0501252_000726 | 3300049682 | Bacteria | 2713 |
| 460 | Ga0501259_001461 | 3300049688 | Bacteria | 3934 |
| 461 | Ga0501259_002557 | 3300049688 | Bacteria | 2936 |
| 462 | Ga0501221_000433 | 3300049704 | Bacteria | 6494 |
| 463 | Ga0501225_0005432 | 3300049705 | Bacteria | 3744 |
| 464 | Ga0501225_0008252 | 3300049705 | Bacteria | 2995 |
| 465 | Ga0501225_0008255 | 3300049705 | Bacteria | 2994 |
| 466 | Ga0501234_001099 | 3300049707 | Bacteria | 4278 |
| 467 | Ga0501080_0495859 | 3300049742 | Unclassified | 1092 |
| 468 | Ga0501083_0234033 | 3300049744 | Bacteria | 1196 |
| 469 | Ga0501241_000078 | 3300049758 | Bacteria | 21770 |
| 470 | Ga0501241_025253 | 3300049758 | Unclassified | 1106 |
| 471 | Ga0501263_001626 | 3300049760 | Bacteria | 2157 |
| 472 | Ga0501266_015673 | 3300049763 | Bacteria | 1003 |
| 473 | Ga0501268_000050 | 3300049765 | Bacteria | 9158 |
| 474 | Ga0501268_009165 | 3300049765 | Bacteria | 1516 |
| 475 | Ga0501270_000136 | 3300049767 | Bacteria | 5726 |
| 476 | Ga0501271_002044 | 3300049768 | Bacteria | 1773 |
| 477 | Ga0501035_0037822 | 3300049822 | Bacteria | 4368 |
| 478 | Ga0501035_0074981 | 3300049822 | Bacteria | 2992 |
| 479 | Ga0501035_0092700 | 3300049822 | Bacteria | 2658 |
| 480 | Ga0501035_0212957 | 3300049822 | Bacteria | 1653 |
| 481 | Ga0501044_0008372 | 3300049823 | Bacteria | 11340 |
| 482 | Ga0501044_0021836 | 3300049823 | Bacteria | 6826 |
| 483 | Ga0501044_0027431 | 3300049823 | Bacteria | 6019 |
| 484 | Ga0501044_0122340 | 3300049823 | Unclassified | 2602 |
| 485 | Ga0501044_0158521 | 3300049823 | Bacteria | 2241 |
| 486 | Ga0501044_0160659 | 3300049823 | Unclassified | 2224 |
| 487 | Ga0501044_0185090 | 3300049823 | Unclassified | 2048 |
| 488 | Ga0501044_0211161 | 3300049823 | Bacteria | 1895 |
| 489 | Ga0501212_006392 | 3300049851 | Unclassified | 1588 |
| 490 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 491 | nmdc:mga0k408_76_c2 | 3300050493 | Bacteria | 45945 |
| 492 | nmdc:mga05p37_1503_c1 | 3300050507 | Bacteria | 27101 |
| 493 | nmdc:mga08y16_773228_c1 | 3300050511 | Bacteria | 955 |
| 494 | Ga0500578_0000034 | 3300053086 | Bacteria | 136582 |
| 495 | Ga0500644_0000475 | 3300053088 | Bacteria | 17705 |
| 496 | Ga0500646_0033879 | 3300053090 | Bacteria | 1414 |
| 497 | Ga0500583_0000075 | 3300053092 | Bacteria | 59561 |
| 498 | Ga0500583_0035936 | 3300053092 | Bacteria | 2215 |
| 499 | Ga0500569_000194 | 3300053109 | Bacteria | 9667 |
| 500 | Ga0500607_111129 | 3300053121 | Bacteria | 1343 |
| 501 | Ga0500608_063916 | 3300053122 | Bacteria | 1756 |
| 502 | Ga0500618_000079 | 3300053125 | Bacteria | 79415 |
| 503 | Ga0500652_040201 | 3300053131 | Bacteria | 1878 |
| 504 | Ga0500658_0005885 | 3300053134 | Bacteria | 4564 |
| 505 | Ga0500559_0040623 | 3300053136 | Bacteria | 2026 |
| 506 | Ga0500559_0092546 | 3300053136 | Bacteria | 1386 |
| 507 | Ga0500577_0000746 | 3300053142 | Bacteria | 8360 |
| 508 | Ga0500616_0002819 | 3300053153 | Bacteria | 13977 |
| 509 | Ga0500616_0158747 | 3300053153 | Bacteria | 1039 |
| 510 | Ga0500622_0000725 | 3300053156 | Bacteria | 28810 |
| 511 | Ga0500622_0001514 | 3300053156 | Bacteria | 18450 |
| 512 | Ga0500622_0001543 | 3300053156 | Bacteria | 18252 |
| 513 | Ga0500622_0147950 | 3300053156 | Bacteria | 1113 |
| 514 | Ga0500633_0000363 | 3300053160 | Bacteria | 6929 |
| 515 | Ga0500634_0031992 | 3300053161 | Bacteria | 2870 |
| 516 | Ga0500636_0020568 | 3300053177 | Bacteria | 3908 |
| 517 | Ga0500636_0026467 | 3300053177 | Bacteria | 3427 |
| 518 | Ga0500636_0249093 | 3300053177 | Unclassified | 907 |
| 519 | Ga0500637_0150033 | 3300053178 | Bacteria | 1347 |
| 520 | Ga0500611_000031 | 3300053727 | Bacteria | 85821 |
| 521 | Ga0500661_000526 | 3300055283 | Bacteria | 7108 |
| 522 | Ga0453684_0098620 | |||
| 523 | MRS1b_contig_4179915 | |||
| 524 | JGI25153J46596_10022911 | |||
| 525 | rootH2_10009544 | |||
| 526 | rootH2_10040616 | |||
| 527 | rootH2_10079703 | |||
| 528 | rootH2_10144318 | |||
| 529 | rootL2_10039568 | |||
| 530 | rootL2_10055887 | |||
| 531 | rootL2_10086867 | |||
| 532 | rootL2_10088141 | |||
| 533 | rootL2_10225346 | |||
| 534 | rootH1_10043705 | |||
| 535 | JGI25160J50197_1005348 | |||
| 536 | Ga0055535_1001325 | |||
| 537 | Ga0055526_1029785 | |||
| 538 | Ga0055528_1001409 | |||
| 539 | Ga0055528_1003892 | |||
| 540 | Ga0055530_10000629 | |||
| 541 | Ga0055530_10014473 | |||
| 542 | Ga0055531_10000237 | |||
| 543 | Ga0055531_10042374 | |||
| 544 | Ga0055543_1018264 | |||
| 545 | Ga0065165_1000190 | |||
| 546 | Ga0065714_10074356 | |||
| 547 | Ga0065712_10141767 | |||
| 548 | Ga0070658_10000857 | |||
| 549 | Ga0070676_10000507 | |||
| 550 | Ga0070670_100022675 | |||
| 551 | Ga0070670_100107969 | |||
| 552 | Ga0070677_10004868 | |||
| 553 | Ga0068869_100019836 | |||
| 554 | Ga0068869_100096186 | |||
| 555 | Ga0070666_10000043 | |||
| 556 | Ga0070680_100002208 | |||
| 557 | Ga0070682_100000054 | |||
| 558 | Ga0070682_100002478 | |||
| 559 | Ga0070682_100049741 | |||
| 560 | Ga0068868_100000346 | |||
| 561 | Ga0068868_100238434 | |||
| 562 | Ga0068868_100416739 | |||
| 563 | Ga0070660_100045014 | |||
| 564 | Ga0070691_10009814 | |||
| 565 | Ga0070661_100094196 | |||
| 566 | Ga0070668_100005211 | |||
| 567 | Ga0070668_100149663 | |||
| 568 | Ga0070669_100073610 | |||
| 569 | Ga0070675_100095157 | |||
| 570 | Ga0070671_100039412 | |||
| 571 | Ga0070671_100048885 | |||
| 572 | Ga0070671_100052230 | |||
| 573 | Ga0070671_100131695 | |||
| 574 | Ga0070671_100193903 | |||
| 575 | Ga0070674_100084086 | |||
| 576 | Ga0070673_100001042 | |||
| 577 | Ga0070673_100215763 | |||
| 578 | Ga0070673_100286627 | |||
| 579 | Ga0070667_100003119 | |||
| 580 | Ga0070667_100011774 | |||
| 581 | Ga0070667_100039591 | |||
| 582 | Ga0070667_100040189 | |||
| 583 | Ga0070678_100258875 | |||
| 584 | Ga0070662_100020993 | |||
| 585 | Ga0070681_10025897 | |||
| 586 | Ga0068867_100007630 | |||
| 587 | Ga0068867_100016825 | |||
| 588 | Ga0070706_100334039 | |||
| 589 | Ga0070698_100095714 | |||
| 590 | Ga0070698_100381166 | |||
| 591 | Ga0070679_100017428 | |||
| 592 | Ga0070684_100003150 | |||
| 593 | Ga0068853_100039537 | |||
| 594 | Ga0068853_100063568 | |||
| 595 | Ga0068853_100102767 | |||
| 596 | Ga0070672_100001246 | |||
| 597 | Ga0070672_100050208 | |||
| 598 | Ga0070672_100419978 | |||
| 599 | Ga0070665_100000041 | |||
| 600 | Ga0070665_100055304 | |||
| 601 | Ga0068855_100015722 | |||
| 602 | Ga0068855_100042337 | |||
| 603 | Ga0068855_100813493 | |||
| 604 | Ga0070664_100010422 | |||
| 605 | Ga0068857_100047951 | |||
| 606 | Ga0068857_100224689 | |||
| 607 | Ga0068856_100049922 | |||
| 608 | Ga0068856_100092965 | |||
| 609 | Ga0068852_100011311 | |||
| 610 | Ga0068852_100109435 | |||
| 611 | Ga0068859_100000012 | |||
| 612 | Ga0068859_100016532 | |||
| 613 | Ga0068859_100080764 | |||
| 614 | Ga0068859_100294773 | |||
| 615 | Ga0068864_100003733 | |||
| 616 | Ga0068864_100018754 | |||
| 617 | Ga0068864_100602624 | |||
| 618 | Ga0068866_10089124 | |||
| 619 | Ga0068861_100021142 | |||
| 620 | Ga0068861_100117197 | |||
| 621 | Ga0068851_10004819 | |||
| 622 | Ga0068851_10150961 | |||
| 623 | Ga0068851_10152277 | |||
| 624 | Ga0068863_100004641 | |||
| 625 | Ga0068863_100007625 | |||
| 626 | Ga0068863_100045334 | |||
| 627 | Ga0068863_100518628 | |||
| 628 | Ga0068858_100000505 | |||
| 629 | Ga0068858_100004161 | |||
| 630 | Ga0068860_100000383 | |||
| 631 | Ga0068860_100000700 | |||
| 632 | Ga0068860_100000764 | |||
| 633 | Ga0068860_100007672 | |||
| 634 | Ga0068860_100011318 | |||
| 635 | Ga0068860_100016430 | |||
| 636 | Ga0068860_100238690 | |||
| 637 | Ga0075366_10000063 | |||
| 638 | Ga0075366_10181946 | |||
| 639 | Ga0075366_10204265 | |||
| 640 | Ga0075366_10266675 | |||
| 641 | Ga0097621_100001591 | |||
| 642 | Ga0097621_100042363 | |||
| 643 | Ga0068871_100000737 | |||
| 644 | Ga0068871_100132346 | |||
| 645 | Ga0068865_100006644 | |||
| 646 | Ga0068865_100112213 | |||
| 647 | Ga0068865_100405096 | |||
| 648 | Ga0097620_100000012 | |||
| 649 | Ga0097620_100016532 | |||
| 650 | Ga0097620_100080762 | |||
| 651 | Ga0097620_100294778 | |||
| 652 | Ga0075435_100475427 | |||
| 653 | Ga0105240_10000224 | |||
| 654 | Ga0105240_10003457 | |||
| 655 | Ga0105240_10005749 | |||
| 656 | Ga0105240_10078578 | |||
| 657 | Ga0105240_10192364 | |||
| 658 | Ga0105245_10218401 | |||
| 659 | Ga0105245_10277984 | |||
| 660 | Ga0105247_10009650 | |||
| 661 | Ga0114129_10001869 | |||
| 662 | Ga0105241_10000493 | |||
| 663 | Ga0105241_10000621 | |||
| 664 | Ga0105241_10001522 | |||
| 665 | Ga0105241_10077133 | |||
| 666 | Ga0105241_10078344 | |||
| 667 | Ga0105241_10561278 | |||
| 668 | Ga0105242_10031987 | |||
| 669 | Ga0105242_10124521 | |||
| 670 | Ga0105248_10283289 | |||
| 671 | Ga0105237_10000719 | |||
| 672 | Ga0105237_10000725 | |||
| 673 | Ga0105237_10002801 | |||
| 674 | Ga0105237_10003801 | |||
| 675 | Ga0105237_10004541 | |||
| 676 | Ga0105237_10151168 | |||
| 677 | Ga0105238_10000247 | |||
| 678 | Ga0105238_10144195 | |||
| 679 | Ga0105238_10337814 | |||
| 680 | Ga0105249_10002694 | |||
| 681 | Ga0105249_10060790 | |||
| 682 | Ga0105249_10329490 | |||
| 683 | Ga0105239_10000685 | |||
| 684 | Ga0105239_10000785 | |||
| 685 | Ga0105239_10025508 | |||
| 686 | Ga0105239_10029882 | |||
| 687 | Ga0105239_10064386 | |||
| 688 | Ga0105239_10140480 | |||
| 689 | Ga0105239_10240102 | |||
| 690 | Ga0105246_10273214 | |||
| 691 | Ga0157373_10009465 | |||
| 692 | Ga0157371_10064962 | |||
| 693 | Ga0157370_10004711 | |||
| 694 | Ga0157370_10313872 | |||
| 695 | Ga0157369_10181421 | |||
| 696 | Ga0157374_10000001 | |||
| 697 | Ga0157374_10233291 | |||
| 698 | Ga0157374_10404255 | |||
| 699 | Ga0157378_10156202 | |||
| 700 | Ga0157378_10643935 | |||
| 701 | Ga0163162_10000840 | |||
| 702 | Ga0163162_10001520 | |||
| 703 | Ga0163162_10011675 | |||
| 704 | Ga0163162_10044223 | |||
| 705 | Ga0163162_10050354 | |||
| 706 | Ga0163162_10061988 | |||
| 707 | Ga0163162_10094447 | |||
| 708 | Ga0163162_10266099 | |||
| 709 | Ga0157372_10005928 | |||
| 710 | Ga0157372_10041159 | |||
| 711 | Ga0157372_10179349 | |||
| 712 | Ga0157372_10220543 | |||
| 713 | Ga0157372_10438249 | |||
| 714 | Ga0157372_10661081 | |||
| 715 | Ga0157375_10008330 | |||
| 716 | Ga0157375_10119087 | |||
| 717 | Ga0157375_10123181 | |||
| 718 | Ga0157375_10182989 | |||
| 719 | Ga0157375_10237058 | |||
| 720 | Ga0163163_10000407 | |||
| 721 | Ga0163163_10002778 | |||
| 722 | Ga0163163_10011385 | |||
| 723 | Ga0163163_10126994 | |||
| 724 | Ga0163163_10161155 | |||
| 725 | Ga0157380_10012636 | |||
| 726 | Ga0157380_10034929 | |||
| 727 | Ga0157380_10046441 | |||
| 728 | Ga0157379_10010697 | |||
| 729 | Ga0157379_10031263 | |||
| 730 | Ga0157379_10036208 | |||
| 731 | Ga0157379_10088730 | |||
| 732 | Ga0157379_10467567 | |||
| 733 | Ga0157376_10001529 | |||
| 734 | Ga0157376_10030372 | |||
| 735 | Ga0157376_10053042 | |||
| 736 | Ga0157376_10435801 | |||
| 737 | Ga0163161_10023951 | |||
| 738 | Ga0213876_10006282 | |||
| 739 | Ga0213876_10007563 | |||
| 740 | Ga0209436_101685 | |||
| 741 | Ga0209436_104301 | |||
| 742 | Ga0209258_100068 | |||
| 743 | Ga0209148_1000343 | |||
| 744 | Ga0209673_1000403 | |||
| 745 | Ga0209130_1011833 | |||
| 746 | Ga0209564_1009069 | |||
| 747 | Ga0209758_1023582 | |||
| 748 | Ga0209758_1065226 | |||
| 749 | Ga0209050_1000136 | |||
| 750 | Ga0207426_1000164 | |||
| 751 | Ga0207426_1000543 | |||
| 752 | Ga0209051_1067936 | |||
| 753 | Ga0209257_1000025 | |||
| 754 | Ga0209257_1002647 | |||
| 755 | Ga0207656_10001567 | |||
| 756 | Ga0207656_10012177 | |||
| 757 | Ga0207682_10021864 | |||
| 758 | Ga0207642_10254192 | |||
| 759 | Ga0207680_10000108 | |||
| 760 | Ga0207680_10002539 | |||
| 761 | Ga0207647_10000831 | |||
| 762 | Ga0207647_10044871 | |||
| 763 | Ga0207645_10002853 | |||
| 764 | Ga0207645_10219288 | |||
| 765 | Ga0207643_10266874 | |||
| 766 | Ga0207705_10003710 | |||
| 767 | Ga0207654_10000775 | |||
| 768 | Ga0207654_10002900 | |||
| 769 | Ga0207654_10004284 | |||
| 770 | Ga0207707_10000889 | |||
| 771 | Ga0207695_10000023 | |||
| 772 | Ga0207695_10000031 | |||
| 773 | Ga0207695_10002344 | |||
| 774 | Ga0207695_10016439 | |||
| 775 | Ga0207695_10135384 | |||
| 776 | Ga0207671_10001536 | |||
| 777 | Ga0207671_10002088 | |||
| 778 | Ga0207671_10010686 | |||
| 779 | Ga0207671_10100678 | |||
| 780 | Ga0207660_10002515 | |||
| 781 | Ga0207662_10130832 | |||
| 782 | Ga0207649_10192630 | |||
| 783 | Ga0207649_10414839 | |||
| 784 | Ga0207652_10002423 | |||
| 785 | Ga0207652_10071047 | |||
| 786 | Ga0207681_10063874 | |||
| 787 | Ga0207694_10004436 | |||
| 788 | Ga0207650_10012509 | |||
| 789 | Ga0207650_10446005 | |||
| 790 | Ga0207659_10038822 | |||
| 791 | Ga0207659_10147924 | |||
| 792 | Ga0207644_10017050 | |||
| 793 | Ga0207644_10021140 | |||
| 794 | Ga0207644_10027333 | |||
| 795 | Ga0207706_10025929 | |||
| 796 | Ga0207686_10015195 | |||
| 797 | Ga0207669_10128503 | |||
| 798 | Ga0207704_10002218 | |||
| 799 | Ga0207704_10297944 | |||
| 800 | Ga0207691_10000228 | |||
| 801 | Ga0207691_10062119 | |||
| 802 | Ga0207691_10151174 | |||
| 803 | Ga0207689_10001398 | |||
| 804 | Ga0207689_10003446 | |||
| 805 | Ga0207689_10110637 | |||
| 806 | Ga0207661_10028363 | |||
| 807 | Ga0207679_10003970 | |||
| 808 | Ga0207679_10208273 | |||
| 809 | Ga0207667_10005340 | |||
| 810 | Ga0207667_10052787 | |||
| 811 | Ga0207651_10023614 | |||
| 812 | Ga0207651_10072754 | |||
| 813 | Ga0207712_10034964 | |||
| 814 | Ga0207712_10073408 | |||
| 815 | Ga0207668_10002045 | |||
| 816 | Ga0207668_10142047 | |||
| 817 | Ga0207658_10001335 | |||
| 818 | Ga0207658_10024620 | |||
| 819 | Ga0207658_10139471 | |||
| 820 | Ga0207658_10402571 | |||
| 821 | Ga0207677_10000978 | |||
| 822 | Ga0207677_10061035 | |||
| 823 | Ga0207703_10004989 | |||
| 824 | Ga0207703_10008484 | |||
| 825 | Ga0207639_10042406 | |||
| 826 | Ga0207702_10047249 | |||
| 827 | Ga0207702_10069480 | |||
| 828 | Ga0207641_10000048 | |||
| 829 | Ga0207641_10039850 | |||
| 830 | Ga0207641_10220787 | |||
| 831 | Ga0207648_10007506 | |||
| 832 | Ga0207648_10013131 | |||
| 833 | Ga0207648_10022540 | |||
| 834 | Ga0207648_10047172 | |||
| 835 | Ga0207648_10263090 | |||
| 836 | Ga0207676_10001611 | |||
| 837 | Ga0207676_10014711 | |||
| 838 | Ga0207674_10080681 | |||
| 839 | Ga0207674_10231552 | |||
| 840 | Ga0207674_10301503 | |||
| 841 | Ga0207674_10387768 | |||
| 842 | Ga0207674_10507289 | |||
| 843 | Ga0207675_100057429 | |||
| 844 | Ga0207675_100081635 | |||
| 845 | Ga0207683_10095638 | |||
| 846 | Ga0207683_10209837 | |||
| 847 | Ga0207698_10002537 | |||
| 848 | Ga0207698_10109863 | |||
| 849 | Ga0207698_10147360 | |||
| 850 | Ga0268266_10000049 | |||
| 851 | Ga0268266_10008792 | |||
| 852 | Ga0268264_10000041 | |||
| 853 | Ga0268264_10002959 | |||
| 854 | Ga0268264_10003558 | |||
| 855 | Ga0268264_10006197 | |||
| 856 | Ga0268264_10028309 | |||
| 857 | Ga0268264_10059517 | |||
| 858 | Ga0268264_10250252 | |||
| 859 | Ga0268264_10490286 | |||
| 860 | Ga0307515_10000001 | |||
| 861 | Ga0307515_10000290 | |||
| 862 | Ga0307515_10008220 | |||
| 863 | Ga0265327_10000248 | |||
| 864 | Ga0265327_10000285 | |||
| 865 | Ga0265327_10001115 | |||
| 866 | Ga0265327_10007365 | |||
| 867 | Ga0265327_10042850 | |||
| 868 | Ga0307509_10019958 | |||
| 869 | Ga0307509_10025149 | |||
| 870 | Ga0307408_100000139 | |||
| 871 | Ga0307413_10315560 | |||
| 872 | Ga0307410_10193434 | |||
| 873 | Ga0307407_10011082 | |||
| 874 | Ga0307407_10054778 | |||
| 875 | Ga0307412_10104280 | |||
| 876 | Ga0307409_100053824 | |||
| 877 | Ga0307416_100021717 | |||
| 878 | Ga0307411_10011334 | |||
| 879 | Ga0307411_10041573 | |||
| 880 | Ga0307415_100080347 | |||
| 881 | Ga0395900_0051882 | |||
| 882 | Ga0395905_0060715 | |||
| 883 | Ga0395905_0168289 | |||
| 884 | Ga0395901_0055048 | |||
| 885 | Ga0436365_1287042 | |||
| 886 | Ga0436365_1339095 | |||
| 887 | Ga0439436_0025088 | |||
| 888 | Ga0439433_0048598 | |||
| 889 | Ga0439449_0032338 | |||
| 890 | Ga0439449_0038848 | |||
| 891 | Ga0439449_0038939 | |||
| 892 | Ga0439449_0040922 | |||
| 893 | Ga0439449_0138343 | |||
| 894 | Ga0439457_000696 | |||
| 895 | Ga0439457_017275 | |||
| 896 | Ga0439457_020912 | |||
| 897 | Ga0439462_0000918 | |||
| 898 | Ga0439434_0011095 | |||
| 899 | Ga0451577_0000557 | |||
| 900 | Ga0451577_0063175 | |||
| 901 | Ga0466969_0000238 | |||
| 902 | Ga0466972_0037517 | |||
| 903 | Ga0466966_0000136 | |||
| 904 | Ga0453684_0000024 | |||
| 905 | Ga0453684_0011220 | |||
| 906 | Ga0453684_0547159 | |||
| 907 | Ga0466968_0040342 | |||
| 908 | Ga0466970_0082120 | |||
| 909 | Ga0466957_0001467 | |||
| 910 | Ga0466957_0002368 | |||
| 911 | Ga0466959_0000002 | |||
| 912 | Ga0466959_0044378 | |||
| 913 | Ga0495638_0070096 | |||
| 914 | Ga0495650_0035182 | |||
| 915 | Ga0495650_0112720 | |||
| 916 | Ga0495585_0000588 | |||
| 917 | Ga0495648_0000729 | |||
| 918 | Ga0495648_0034384 | |||
| 919 | Ga0495654_0116154 | |||
| 920 | Ga0495609_0003030 | |||
| 921 | Ga0495622_0042549 | |||
| 922 | Ga0495633_0000027 | |||
| 923 | Ga0495668_0000021 | |||
| 924 | Ga0495668_0000751 | |||
| 925 | Ga0495611_0010178 | |||
| 926 | Ga0495625_0001499 | |||
| 927 | Ga0495625_0010588 | |||
| 928 | Ga0495687_000001 | |||
| 929 | Ga0495686_0000111 | |||
| 930 | Ga0496101_0165095 | |||
| 931 | Ga0496104_0307228 | |||
| 932 | Ga0496109_0473109 | |||
| 933 | Ga0496114_0001077 | |||
| 934 | Ga0496121_0000010 | |||
| 935 | Ga0496126_0103252 | |||
| 936 | Ga0501291_002155 | |||
| 937 | Ga0501292_006776 | |||
| 938 | Ga0501298_002421 | |||
| 939 | Ga0501298_004007 | |||
| 940 | Ga0501032_0030082 | |||
| 941 | Ga0501032_0260073 | |||
| 942 | Ga0501034_0009006 | |||
| 943 | Ga0501034_0036396 | |||
| 944 | Ga0501034_0063319 | |||
| 945 | Ga0501034_0076765 | |||
| 946 | Ga0501034_0105005 | |||
| 947 | Ga0501036_0005849 | |||
| 948 | Ga0501036_0081308 | |||
| 949 | Ga0501037_0040682 | |||
| 950 | Ga0501039_0016507 | |||
| 951 | Ga0501039_0153598 | |||
| 952 | Ga0501043_0057413 | |||
| 953 | Ga0501043_0059596 | |||
| 954 | Ga0501043_0235181 | |||
| 955 | Ga0501046_0127449 | |||
| 956 | Ga0501046_0241354 | |||
| 957 | Ga0501047_0093248 | |||
| 958 | Ga0501047_0497042 | |||
| 959 | Ga0501070_0062682 | |||
| 960 | Ga0501073_0003496 | |||
| 961 | Ga0501074_0049654 | |||
| 962 | Ga0501198_008065 | |||
| 963 | Ga0501201_001251 | |||
| 964 | Ga0501202_012479 | |||
| 965 | Ga0501206_007265 | |||
| 966 | Ga0501216_018027 | |||
| 967 | Ga0501217_001378 | |||
| 968 | Ga0501222_002119 | |||
| 969 | Ga0501223_006096 | |||
| 970 | Ga0501223_007613 | |||
| 971 | Ga0501224_002454 | |||
| 972 | Ga0501224_004824 | |||
| 973 | Ga0501230_018742 | |||
| 974 | Ga0501233_016607 | |||
| 975 | Ga0501235_003473 | |||
| 976 | Ga0501242_001913 | |||
| 977 | Ga0501243_010000 | |||
| 978 | Ga0501247_002963 | |||
| 979 | Ga0501252_000718 | |||
| 980 | Ga0501252_000726 | |||
| 981 | Ga0501259_001461 | |||
| 982 | Ga0501259_002557 | |||
| 983 | Ga0501221_000433 | |||
| 984 | Ga0501225_0005432 | |||
| 985 | Ga0501225_0008252 | |||
| 986 | Ga0501225_0008255 | |||
| 987 | Ga0501234_001099 | |||
| 988 | Ga0501080_0495859 | |||
| 989 | Ga0501083_0234033 | |||
| 990 | Ga0501241_000078 | |||
| 991 | Ga0501241_025253 | |||
| 992 | Ga0501263_001626 | |||
| 993 | Ga0501266_015673 | |||
| 994 | Ga0501268_000050 | |||
| 995 | Ga0501268_009165 | |||
| 996 | Ga0501270_000136 | |||
| 997 | Ga0501271_002044 | |||
| 998 | Ga0501035_0037822 | |||
| 999 | Ga0501035_0074981 | |||
| 1000 | Ga0501035_0092700 | |||
| 1001 | Ga0501035_0212957 | |||
| 1002 | Ga0501044_0008372 | |||
| 1003 | Ga0501044_0021836 | |||
| 1004 | Ga0501044_0027431 | |||
| 1005 | Ga0501044_0122340 | |||
| 1006 | Ga0501044_0158521 | |||
| 1007 | Ga0501044_0160659 | |||
| 1008 | Ga0501044_0185090 | |||
| 1009 | Ga0501044_0211161 | |||
| 1010 | Ga0501212_006392 | |||
| 1011 | Ga0501284_00011 | |||
| 1012 | nmdc:mga0k408_76_c2 | |||
| 1013 | nmdc:mga05p37_1503_c1 | |||
| 1014 | nmdc:mga08y16_773228_c1 | |||
| 1015 | Ga0500578_0000034 | |||
| 1016 | Ga0500644_0000475 | |||
| 1017 | Ga0500646_0033879 | |||
| 1018 | Ga0500583_0000075 | |||
| 1019 | Ga0500583_0035936 | |||
| 1020 | Ga0500569_000194 | |||
| 1021 | Ga0500607_111129 | |||
| 1022 | Ga0500608_063916 | |||
| 1023 | Ga0500618_000079 | |||
| 1024 | Ga0500652_040201 | |||
| 1025 | Ga0500658_0005885 | |||
| 1026 | Ga0500559_0040623 | |||
| 1027 | Ga0500559_0092546 | |||
| 1028 | Ga0500577_0000746 | |||
| 1029 | Ga0500616_0002819 | |||
| 1030 | Ga0500616_0158747 | |||
| 1031 | Ga0500622_0000725 | |||
| 1032 | Ga0500622_0001514 | |||
| 1033 | Ga0500622_0001543 | |||
| 1034 | Ga0500622_0147950 | |||
| 1035 | Ga0500633_0000363 | |||
| 1036 | Ga0500634_0031992 | |||
| 1037 | Ga0500636_0020568 | |||
| 1038 | Ga0500636_0026467 | |||
| 1039 | Ga0500636_0249093 | |||
| 1040 | Ga0500637_0150033 | |||
| 1041 | Ga0500611_000031 | |||
| 1042 | Ga0500661_000526 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8swt-assembly1.cif.gz_A | structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate | 0.9725 | 18 | 287 |
| 4nsn-assembly1.cif.gz_C | crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 030972, orthorhombic symmetry | 0.9719 | 19 | 287 |
| 4lna-assembly1.cif.gz_A | crystal structure of purine nucleoside phosphorylase i from spirosoma linguale dsm 74, nysgrc target 029362 | 0.9705 | 17 | 287 |
| 4ns1-assembly1.cif.gz_C | crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 30972 | 0.9701 | 19 | 287 |
| 4m1e-assembly1.cif.gz_B | crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. | 0.9693 | 16 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lnaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9637 | 19 | 287 | 3.40.50.1580 |
| 4ns1C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.962 | 19 | 287 | 3.40.50.1580 |
| 4lnaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9564 | 19 | 287 | 3.40.50.1580 |
| af_U4PSA1_35_317_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9533 | 17 | 287 | 3.40.50.1580 |
| 1td1C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9527 | 20 | 287 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R4E9S8-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9874 | 19 | 287 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A1V2BAR0-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9802 | 19 | 287 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A4R4E9S8-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9802 | 19 | 287 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A2W2B3E9-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9797 | 16 | 287 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A0Q1FRJ8-F1-model_v4 | purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9778 | 95 | 287 |
GO:0004731
GO:0005737 GO:0009116 |