F458737

General Info

Members Datasets Scaffolds Average Seq Length
521 268 1042 274

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0098620|Ga0453684_0098620_2299_3141
Length 280
Sequence MKALRPMIAEAVAHLRTHTAASPRVGIILGTGLGGLVDEIVASAIIDYGDIPHFPVSTVESHRGRLIFGTLSGVNVVVMQGRFHYYEGYTLKQVTFPVRVMKELGVDTLLISNAAGGMNPLFRRGDIMVIYDHINLIGDNPLIGPNDDSLGPRFPDMSEPYSLDLIRLAEQVALDRRIALQKGVFVAVAGPNLETRAEYRFLRGIGADAVGMSTVPEDIVAVHAGMRVLGFSIITDECFPDALEPVDVPAIIRTANDTEPRLRAIMRGVVEALAPAPGKA

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
215 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
218 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
219 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
220 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
221 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
222 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
223 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
224 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
229 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
230 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
231 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
237 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
240 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
241 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
245 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
268 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 0
Rhizoplane 0.77
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0098620 3300044712 Bacteria 3581
2 MRS1b_contig_4179915 2162886011 Unclassified 1483
3 JGI25153J46596_10022911 3300003215 Bacteria 2291
4 rootH2_10009544 3300003320 Bacteria 42409
5 rootH2_10040616 3300003320 Bacteria 2374
6 rootH2_10079703 3300003320 Bacteria 7820
7 rootH2_10144318 3300003320 Bacteria 5257
8 rootL2_10039568 3300003322 Bacteria 3705
9 rootL2_10055887 3300003322 Bacteria 4232
10 rootL2_10086867 3300003322 Bacteria 1685
11 rootL2_10088141 3300003322 Bacteria 3165
12 rootL2_10225346 3300003322 Unclassified 1734
13 rootH1_10043705 3300003323 Bacteria 7618
14 JGI25160J50197_1005348 3300003354 Bacteria 5361
15 Ga0055535_1001325 3300003761 Bacteria 13183
16 Ga0055526_1029785 3300003771 Bacteria 1610
17 Ga0055528_1001409 3300003790 Bacteria 14726
18 Ga0055528_1003892 3300003790 Bacteria 7340
19 Ga0055530_10000629 3300003791 Bacteria 30409
20 Ga0055530_10014473 3300003791 Bacteria 2625
21 Ga0055531_10000237 3300003794 Bacteria 60479
22 Ga0055531_10042374 3300003794 Bacteria 1304
23 Ga0055543_1018264 3300004625 Bacteria 1310
24 Ga0065165_1000190 3300005262 Bacteria 107377
25 Ga0065714_10074356 3300005288 Bacteria 3049
26 Ga0065712_10141767 3300005290 Bacteria 1444
27 Ga0070658_10000857 3300005327 Bacteria 25975
28 Ga0070676_10000507 3300005328 Bacteria 18654
29 Ga0070670_100022675 3300005331 Bacteria 5402
30 Ga0070670_100107969 3300005331 Unclassified 2398
31 Ga0070677_10004868 3300005333 Bacteria 4407
32 Ga0068869_100019836 3300005334 Unclassified 4602
33 Ga0068869_100096186 3300005334 Bacteria 2235
34 Ga0070666_10000043 3300005335 Bacteria 111402
35 Ga0070680_100002208 3300005336 Bacteria 14351
36 Ga0070682_100000054 3300005337 Bacteria 112635
37 Ga0070682_100002478 3300005337 Bacteria 10193
38 Ga0070682_100049741 3300005337 Bacteria 2614
39 Ga0068868_100000346 3300005338 Bacteria 31447
40 Ga0068868_100238434 3300005338 Unclassified 1527
41 Ga0068868_100416739 3300005338 Bacteria 1162
42 Ga0070660_100045014 3300005339 Unclassified 3377
43 Ga0070691_10009814 3300005341 Bacteria 4366
44 Ga0070661_100094196 3300005344 Bacteria 2219
45 Ga0070668_100005211 3300005347 Bacteria 9642
46 Ga0070668_100149663 3300005347 Unclassified 1887
47 Ga0070669_100073610 3300005353 Bacteria 2531
48 Ga0070675_100095157 3300005354 Bacteria 2500
49 Ga0070671_100039412 3300005355 Bacteria 3922
50 Ga0070671_100048885 3300005355 Bacteria 3519
51 Ga0070671_100052230 3300005355 Unclassified 3399
52 Ga0070671_100131695 3300005355 Bacteria 2106
53 Ga0070671_100193903 3300005355 Bacteria 1722
54 Ga0070674_100084086 3300005356 Bacteria 2281
55 Ga0070673_100001042 3300005364 Bacteria 15733
56 Ga0070673_100215763 3300005364 Bacteria 1659
57 Ga0070673_100286627 3300005364 Unclassified 1446
58 Ga0070667_100003119 3300005367 Bacteria 14241
59 Ga0070667_100011774 3300005367 Bacteria 7228
60 Ga0070667_100039591 3300005367 Bacteria 3951
61 Ga0070667_100040189 3300005367 Unclassified 3922
62 Ga0070678_100258875 3300005456 Bacteria 1462
63 Ga0070662_100020993 3300005457 Bacteria 4455
64 Ga0070681_10025897 3300005458 Bacteria 5896
65 Ga0068867_100007630 3300005459 Bacteria 7653
66 Ga0068867_100016825 3300005459 Bacteria 5196
67 Ga0070706_100334039 3300005467 Bacteria 1413
68 Ga0070698_100095714 3300005471 Bacteria 2947
69 Ga0070698_100381166 3300005471 Bacteria 1343
70 Ga0070679_100017428 3300005530 Bacteria 6951
71 Ga0070684_100003150 3300005535 Bacteria 12313
72 Ga0068853_100039537 3300005539 Bacteria 4024
73 Ga0068853_100063568 3300005539 Bacteria 3197
74 Ga0068853_100102767 3300005539 Bacteria 2529
75 Ga0070672_100001246 3300005543 Bacteria 15660
76 Ga0070672_100050208 3300005543 Bacteria 3248
77 Ga0070672_100419978 3300005543 Bacteria 1149
78 Ga0070665_100000041 3300005548 Bacteria 297849
79 Ga0070665_100055304 3300005548 Bacteria 3980
80 Ga0068855_100015722 3300005563 Bacteria 9103
81 Ga0068855_100042337 3300005563 Bacteria 5396
82 Ga0068855_100813493 3300005563 Unclassified 992
83 Ga0070664_100010422 3300005564 Bacteria 7537
84 Ga0068857_100047951 3300005577 Bacteria 3794
85 Ga0068857_100224689 3300005577 Unclassified 1716
86 Ga0068856_100049922 3300005614 Bacteria 4124
87 Ga0068856_100092965 3300005614 Bacteria 3001
88 Ga0068852_100011311 3300005616 Bacteria 6714
89 Ga0068852_100109435 3300005616 Unclassified 2509
90 Ga0068859_100000012 3300005617 Bacteria 300376
91 Ga0068859_100016532 3300005617 Bacteria 7407
92 Ga0068859_100080764 3300005617 Bacteria 3293
93 Ga0068859_100294773 3300005617 Bacteria 1715
94 Ga0068864_100003733 3300005618 Bacteria 12569
95 Ga0068864_100018754 3300005618 Bacteria 5782
96 Ga0068864_100602624 3300005618 Bacteria 1066
97 Ga0068866_10089124 3300005718 Bacteria 1676
98 Ga0068861_100021142 3300005719 Bacteria 4676
99 Ga0068861_100117197 3300005719 Bacteria 2143
100 Ga0068851_10004819 3300005834 Bacteria 6107
101 Ga0068851_10150961 3300005834 Bacteria 1270
102 Ga0068851_10152277 3300005834 Bacteria 1265
103 Ga0068863_100004641 3300005841 Bacteria 13546
104 Ga0068863_100007625 3300005841 Bacteria 10584
105 Ga0068863_100045334 3300005841 Viruses 4173
106 Ga0068863_100518628 3300005841 Bacteria 1175
107 Ga0068858_100000505 3300005842 Bacteria 40920
108 Ga0068858_100004161 3300005842 Bacteria 14235
109 Ga0068860_100000383 3300005843 Bacteria 57999
110 Ga0068860_100000700 3300005843 Bacteria 38538
111 Ga0068860_100000764 3300005843 Bacteria 36178
112 Ga0068860_100007672 3300005843 Bacteria 10783
113 Ga0068860_100011318 3300005843 Bacteria 8793
114 Ga0068860_100016430 3300005843 Bacteria 7217
115 Ga0068860_100238690 3300005843 Bacteria 1768
116 Ga0075366_10000063 3300006195 Bacteria 39802
117 Ga0075366_10181946 3300006195 Bacteria 1277
118 Ga0075366_10204265 3300006195 Unclassified 1202
119 Ga0075366_10266675 3300006195 Bacteria 1045
120 Ga0097621_100001591 3300006237 Bacteria 15526
121 Ga0097621_100042363 3300006237 Bacteria 3667
122 Ga0068871_100000737 3300006358 Bacteria 22233
123 Ga0068871_100132346 3300006358 Bacteria 2115
124 Ga0068865_100006644 3300006881 Bacteria 7076
125 Ga0068865_100112213 3300006881 Unclassified 2013
126 Ga0068865_100405096 3300006881 Bacteria 1118
127 Ga0097620_100000012 3300006931 Bacteria 300376
128 Ga0097620_100016532 3300006931 Bacteria 7407
129 Ga0097620_100080762 3300006931 Bacteria 3293
130 Ga0097620_100294778 3300006931 Bacteria 1715
131 Ga0075435_100475427 3300007076 Bacteria 1079
132 Ga0105240_10000224 3300009093 Bacteria 113175
133 Ga0105240_10003457 3300009093 Bacteria 24509
134 Ga0105240_10005749 3300009093 Bacteria 18399
135 Ga0105240_10078578 3300009093 Bacteria 4063
136 Ga0105240_10192364 3300009093 Bacteria 2398
137 Ga0105245_10218401 3300009098 Bacteria 1838
138 Ga0105245_10277984 3300009098 Unclassified 1635
139 Ga0105247_10009650 3300009101 Bacteria 5854
140 Ga0114129_10001869 3300009147 Bacteria 28696
141 Ga0105241_10000493 3300009174 Bacteria 29814
142 Ga0105241_10000621 3300009174 Bacteria 26706
143 Ga0105241_10001522 3300009174 Bacteria 17775
144 Ga0105241_10077133 3300009174 Bacteria 2600
145 Ga0105241_10078344 3300009174 Bacteria 2582
146 Ga0105241_10561278 3300009174 Unclassified 1026
147 Ga0105242_10031987 3300009176 Bacteria 4206
148 Ga0105242_10124521 3300009176 Unclassified 2217
149 Ga0105248_10283289 3300009177 Bacteria 1866
150 Ga0105237_10000719 3300009545 Bacteria 45812
151 Ga0105237_10000725 3300009545 Bacteria 45577
152 Ga0105237_10002801 3300009545 Bacteria 21180
153 Ga0105237_10003801 3300009545 Bacteria 17746
154 Ga0105237_10004541 3300009545 Bacteria 16041
155 Ga0105237_10151168 3300009545 Bacteria 2318
156 Ga0105238_10000247 3300009551 Bacteria 60300
157 Ga0105238_10144195 3300009551 Bacteria 2358
158 Ga0105238_10337814 3300009551 Bacteria 1494
159 Ga0105249_10002694 3300009553 Bacteria 15357
160 Ga0105249_10060790 3300009553 Bacteria 3466
161 Ga0105249_10329490 3300009553 Bacteria 1540
162 Ga0105239_10000685 3300010375 Bacteria 48269
163 Ga0105239_10000785 3300010375 Bacteria 45044
164 Ga0105239_10025508 3300010375 Bacteria 6508
165 Ga0105239_10029882 3300010375 Bacteria 5993
166 Ga0105239_10064386 3300010375 Bacteria 4025
167 Ga0105239_10140480 3300010375 Bacteria 2691
168 Ga0105239_10240102 3300010375 Bacteria 2034
169 Ga0105246_10273214 3300011119 Unclassified 1352
170 Ga0157373_10009465 3300013100 Bacteria 7198
171 Ga0157371_10064962 3300013102 Bacteria 2584
172 Ga0157370_10004711 3300013104 Bacteria 15544
173 Ga0157370_10313872 3300013104 Bacteria 1446
174 Ga0157369_10181421 3300013105 Unclassified 2215
175 Ga0157374_10000001 3300013296 Bacteria 1077351
176 Ga0157374_10233291 3300013296 Bacteria 1808
177 Ga0157374_10404255 3300013296 Bacteria 1363
178 Ga0157378_10156202 3300013297 Bacteria 2130
179 Ga0157378_10643935 3300013297 Bacteria 1075
180 Ga0163162_10000840 3300013306 Bacteria 28540
181 Ga0163162_10001520 3300013306 Bacteria 21611
182 Ga0163162_10011675 3300013306 Bacteria 8565
183 Ga0163162_10044223 3300013306 Bacteria 4460
184 Ga0163162_10050354 3300013306 Bacteria 4177
185 Ga0163162_10061988 3300013306 Bacteria 3779
186 Ga0163162_10094447 3300013306 Unclassified 3077
187 Ga0163162_10266099 3300013306 Bacteria 1846
188 Ga0157372_10005928 3300013307 Bacteria 12995
189 Ga0157372_10041159 3300013307 Bacteria 5108
190 Ga0157372_10179349 3300013307 Bacteria 2452
191 Ga0157372_10220543 3300013307 Bacteria 2198
192 Ga0157372_10438249 3300013307 Unclassified 1523
193 Ga0157372_10661081 3300013307 Bacteria 1217
194 Ga0157375_10008330 3300013308 Bacteria 9080
195 Ga0157375_10119087 3300013308 Bacteria 2748
196 Ga0157375_10123181 3300013308 Unclassified 2705
197 Ga0157375_10182989 3300013308 Bacteria 2248
198 Ga0157375_10237058 3300013308 Bacteria 1984
199 Ga0163163_10000407 3300014325 Bacteria 40536
200 Ga0163163_10002778 3300014325 Bacteria 14786
201 Ga0163163_10011385 3300014325 Bacteria 8063
202 Ga0163163_10126994 3300014325 Bacteria 2588
203 Ga0163163_10161155 3300014325 Unclassified 2289
204 Ga0157380_10012636 3300014326 Bacteria 6128
205 Ga0157380_10034929 3300014326 Bacteria 3880
206 Ga0157380_10046441 3300014326 Bacteria 3411
207 Ga0157379_10010697 3300014968 Bacteria 7995
208 Ga0157379_10031263 3300014968 Bacteria 4742
209 Ga0157379_10036208 3300014968 Unclassified 4400
210 Ga0157379_10088730 3300014968 Bacteria 2774
211 Ga0157379_10467567 3300014968 Bacteria 1166
212 Ga0157376_10001529 3300014969 Bacteria 15246
213 Ga0157376_10030372 3300014969 Bacteria 4315
214 Ga0157376_10053042 3300014969 Bacteria 3374
215 Ga0157376_10435801 3300014969 Bacteria 1275
216 Ga0163161_10023951 3300017792 Unclassified 4309
217 Ga0213876_10006282 3300021384 Bacteria 6472
218 Ga0213876_10007563 3300021384 Bacteria 5900
219 Ga0209436_101685 3300025208 Bacteria 7299
220 Ga0209436_104301 3300025208 Bacteria 3544
221 Ga0209258_100068 3300025242 Bacteria 286288
222 Ga0209148_1000343 3300025254 Bacteria 61260
223 Ga0209673_1000403 3300025273 Bacteria 76872
224 Ga0209130_1011833 3300025284 Bacteria 2315
225 Ga0209564_1009069 3300025295 Bacteria 4790
226 Ga0209758_1023582 3300025297 Bacteria 2778
227 Ga0209758_1065226 3300025297 Bacteria 1176
228 Ga0209050_1000136 3300025298 Bacteria 179113
229 Ga0207426_1000164 3300025302 Bacteria 171465
230 Ga0207426_1000543 3300025302 Bacteria 53486
231 Ga0209051_1067936 3300025303 Bacteria 1087
232 Ga0209257_1000025 3300025304 Bacteria 724838
233 Ga0209257_1002647 3300025304 Bacteria 17224
234 Ga0207656_10001567 3300025321 Bacteria 7598
235 Ga0207656_10012177 3300025321 Bacteria 3266
236 Ga0207682_10021864 3300025893 Bacteria 2517
237 Ga0207642_10254192 3300025899 Bacteria 999
238 Ga0207680_10000108 3300025903 Bacteria 38066
239 Ga0207680_10002539 3300025903 Bacteria 8509
240 Ga0207647_10000831 3300025904 Bacteria 23995
241 Ga0207647_10044871 3300025904 Bacteria 2760
242 Ga0207645_10002853 3300025907 Bacteria 13402
243 Ga0207645_10219288 3300025907 Unclassified 1254
244 Ga0207643_10266874 3300025908 Bacteria 1058
245 Ga0207705_10003710 3300025909 Bacteria 11625
246 Ga0207654_10000775 3300025911 Bacteria 17563
247 Ga0207654_10002900 3300025911 Bacteria 8696
248 Ga0207654_10004284 3300025911 Bacteria 7197
249 Ga0207707_10000889 3300025912 Bacteria 29199
250 Ga0207695_10000023 3300025913 Bacteria 657903
251 Ga0207695_10000031 3300025913 Bacteria 526801
252 Ga0207695_10002344 3300025913 Bacteria 28132
253 Ga0207695_10016439 3300025913 Bacteria 8656
254 Ga0207695_10135384 3300025913 Bacteria 2417
255 Ga0207671_10001536 3300025914 Bacteria 26452
256 Ga0207671_10002088 3300025914 Bacteria 21861
257 Ga0207671_10010686 3300025914 Bacteria 7550
258 Ga0207671_10100678 3300025914 Bacteria 2188
259 Ga0207660_10002515 3300025917 Bacteria 12055
260 Ga0207662_10130832 3300025918 Bacteria 1582
261 Ga0207649_10192630 3300025920 Bacteria 1435
262 Ga0207649_10414839 3300025920 Unclassified 1010
263 Ga0207652_10002423 3300025921 Bacteria 15744
264 Ga0207652_10071047 3300025921 Bacteria 3024
265 Ga0207681_10063874 3300025923 Bacteria 2540
266 Ga0207694_10004436 3300025924 Bacteria 10971
267 Ga0207650_10012509 3300025925 Bacteria 5858
268 Ga0207650_10446005 3300025925 Bacteria 1076
269 Ga0207659_10038822 3300025926 Bacteria 3314
270 Ga0207659_10147924 3300025926 Bacteria 1831
271 Ga0207644_10017050 3300025931 Bacteria 4898
272 Ga0207644_10021140 3300025931 Unclassified 4430
273 Ga0207644_10027333 3300025931 Bacteria 3941
274 Ga0207706_10025929 3300025933 Bacteria 5249
275 Ga0207686_10015195 3300025934 Bacteria 4301
276 Ga0207669_10128503 3300025937 Bacteria 1736
277 Ga0207704_10002218 3300025938 Bacteria 8711
278 Ga0207704_10297944 3300025938 Bacteria 1234
279 Ga0207691_10000228 3300025940 Bacteria 54500
280 Ga0207691_10062119 3300025940 Bacteria 3391
281 Ga0207691_10151174 3300025940 Bacteria 2041
282 Ga0207689_10001398 3300025942 Bacteria 23013
283 Ga0207689_10003446 3300025942 Bacteria 14441
284 Ga0207689_10110637 3300025942 Bacteria 2257
285 Ga0207661_10028363 3300025944 Unclassified 4286
286 Ga0207679_10003970 3300025945 Bacteria 9193
287 Ga0207679_10208273 3300025945 Bacteria 1638
288 Ga0207667_10005340 3300025949 Bacteria 15665
289 Ga0207667_10052787 3300025949 Bacteria 4279
290 Ga0207651_10023614 3300025960 Bacteria 3787
291 Ga0207651_10072754 3300025960 Unclassified 2442
292 Ga0207712_10034964 3300025961 Unclassified 3409
293 Ga0207712_10073408 3300025961 Bacteria 2467
294 Ga0207668_10002045 3300025972 Bacteria 11766
295 Ga0207668_10142047 3300025972 Unclassified 1848
296 Ga0207658_10001335 3300025986 Bacteria 19330
297 Ga0207658_10024620 3300025986 Unclassified 4212
298 Ga0207658_10139471 3300025986 Bacteria 1960
299 Ga0207658_10402571 3300025986 Bacteria 1203
300 Ga0207677_10000978 3300026023 Bacteria 15812
301 Ga0207677_10061035 3300026023 Unclassified 2609
302 Ga0207703_10004989 3300026035 Bacteria 10772
303 Ga0207703_10008484 3300026035 Bacteria 8120
304 Ga0207639_10042406 3300026041 Bacteria 3410
305 Ga0207702_10047249 3300026078 Bacteria 3627
306 Ga0207702_10069480 3300026078 Bacteria 3029
307 Ga0207641_10000048 3300026088 Bacteria 178206
308 Ga0207641_10039850 3300026088 Unclassified 3930
309 Ga0207641_10220787 3300026088 Unclassified 1757
310 Ga0207648_10007506 3300026089 Bacteria 10709
311 Ga0207648_10013131 3300026089 Bacteria 7720
312 Ga0207648_10022540 3300026089 Bacteria 5653
313 Ga0207648_10047172 3300026089 Bacteria 3777
314 Ga0207648_10263090 3300026089 Bacteria 1539
315 Ga0207676_10001611 3300026095 Bacteria 16622
316 Ga0207676_10014711 3300026095 Bacteria 5636
317 Ga0207674_10080681 3300026116 Bacteria 3256
318 Ga0207674_10231552 3300026116 Bacteria 1795
319 Ga0207674_10301503 3300026116 Unclassified 1551
320 Ga0207674_10387768 3300026116 Bacteria 1350
321 Ga0207674_10507289 3300026116 Bacteria 1165
322 Ga0207675_100057429 3300026118 Bacteria 3631
323 Ga0207675_100081635 3300026118 Bacteria 3032
324 Ga0207683_10095638 3300026121 Bacteria 2648
325 Ga0207683_10209837 3300026121 Unclassified 1772
326 Ga0207698_10002537 3300026142 Bacteria 10842
327 Ga0207698_10109863 3300026142 Bacteria 2308
328 Ga0207698_10147360 3300026142 Unclassified 2038
329 Ga0268266_10000049 3300028379 Bacteria 307763
330 Ga0268266_10008792 3300028379 Bacteria 8951
331 Ga0268264_10000041 3300028381 Bacteria 372501
332 Ga0268264_10002959 3300028381 Bacteria 14756
333 Ga0268264_10003558 3300028381 Bacteria 13412
334 Ga0268264_10006197 3300028381 Bacteria 10100
335 Ga0268264_10028309 3300028381 Bacteria 4583
336 Ga0268264_10059517 3300028381 Bacteria 3200
337 Ga0268264_10250252 3300028381 Bacteria 1646
338 Ga0268264_10490286 3300028381 Bacteria 1197
339 Ga0307515_10000001 3300028794 Bacteria 4259510
340 Ga0307515_10000290 3300028794 Bacteria 123604
341 Ga0307515_10008220 3300028794 Bacteria 20411
342 Ga0265327_10000248 3300031251 Bacteria 107284
343 Ga0265327_10000285 3300031251 Bacteria 99746
344 Ga0265327_10001115 3300031251 Bacteria 37124
345 Ga0265327_10007365 3300031251 Bacteria 8517
346 Ga0265327_10042850 3300031251 Bacteria 2427
347 Ga0307509_10019958 3300031507 Bacteria 7621
348 Ga0307509_10025149 3300031507 Bacteria 6653
349 Ga0307408_100000139 3300031548 Bacteria 80738
350 Ga0307413_10315560 3300031824 Bacteria 1192
351 Ga0307410_10193434 3300031852 Unclassified 1548
352 Ga0307407_10011082 3300031903 Bacteria 4278
353 Ga0307407_10054778 3300031903 Bacteria 2302
354 Ga0307412_10104280 3300031911 Bacteria 2012
355 Ga0307409_100053824 3300031995 Bacteria 3095
356 Ga0307416_100021717 3300032002 Unclassified 4615
357 Ga0307411_10011334 3300032005 Bacteria 4807
358 Ga0307411_10041573 3300032005 Bacteria 2926
359 Ga0307415_100080347 3300032126 Unclassified 2326
360 Ga0395900_0051882 3300037418 Unclassified 4224
361 Ga0395905_0060715 3300037471 Unclassified 3535
362 Ga0395905_0168289 3300037471 Bacteria 2059
363 Ga0395901_0055048 3300038443 Bacteria 4136
364 Ga0436365_1287042 3300039437 Bacteria 20912
365 Ga0436365_1339095 3300039437 Bacteria 1892
366 Ga0439436_0025088 3300041404 Bacteria 1754
367 Ga0439433_0048598 3300041999 Bacteria 997
368 Ga0439449_0032338 3300042007 Bacteria 1950
369 Ga0439449_0038848 3300042007 Bacteria 1769
370 Ga0439449_0038939 3300042007 Bacteria 1767
371 Ga0439449_0040922 3300042007 Bacteria 1723
372 Ga0439449_0138343 3300042007 Bacteria 906
373 Ga0439457_000696 3300042014 Bacteria 9932
374 Ga0439457_017275 3300042014 Bacteria 1603
375 Ga0439457_020912 3300042014 Bacteria 1451
376 Ga0439462_0000918 3300042015 Bacteria 6239
377 Ga0439434_0011095 3300042435 Bacteria 2662
378 Ga0451577_0000557 3300042876 Bacteria 60863
379 Ga0451577_0063175 3300042876 Unclassified 3302
380 Ga0466969_0000238 3300044656 Bacteria 30098
381 Ga0466972_0037517 3300044658 Bacteria 2369
382 Ga0466966_0000136 3300044684 Bacteria 47038
383 Ga0453684_0000024 3300044712 Bacteria 819351
384 Ga0453684_0011220 3300044712 Bacteria 15084
385 Ga0453684_0547159 3300044712 Bacteria 1276
386 Ga0466968_0040342 3300044735 Bacteria 1968
387 Ga0466970_0082120 3300044765 Bacteria 1743
388 Ga0466957_0001467 3300044842 Bacteria 12361
389 Ga0466957_0002368 3300044842 Bacteria 10116
390 Ga0466959_0000002 3300045049 Bacteria 362671
391 Ga0466959_0044378 3300045049 Bacteria 3276
392 Ga0495638_0070096 3300046460 Bacteria 2147
393 Ga0495650_0035182 3300046471 Bacteria 2207
394 Ga0495650_0112720 3300046471 Bacteria 1008
395 Ga0495585_0000588 3300046492 Bacteria 34090
396 Ga0495648_0000729 3300046524 Bacteria 35114
397 Ga0495648_0034384 3300046524 Bacteria 3298
398 Ga0495654_0116154 3300046530 Bacteria 1215
399 Ga0495609_0003030 3300046538 Bacteria 9894
400 Ga0495622_0042549 3300046557 Bacteria 2112
401 Ga0495633_0000027 3300046558 Bacteria 204613
402 Ga0495668_0000021 3300046616 Bacteria 381308
403 Ga0495668_0000751 3300046616 Bacteria 38311
404 Ga0495611_0010178 3300046648 Bacteria 3979
405 Ga0495625_0001499 3300046660 Bacteria 28047
406 Ga0495625_0010588 3300046660 Bacteria 7613
407 Ga0495687_000001 3300047443 Bacteria 1215582
408 Ga0495686_0000111 3300047472 Bacteria 168708
409 Ga0496101_0165095 3300048904 Bacteria 1700
410 Ga0496104_0307228 3300048907 Unclassified 1499
411 Ga0496109_0473109 3300048912 Bacteria 1183
412 Ga0496114_0001077 3300048917 Bacteria 20545
413 Ga0496121_0000010 3300048924 Bacteria 793488
414 Ga0496126_0103252 3300048929 Bacteria 2491
415 Ga0501291_002155 3300049514 Bacteria 2334
416 Ga0501292_006776 3300049515 Unclassified 1638
417 Ga0501298_002421 3300049521 Bacteria 2820
418 Ga0501298_004007 3300049521 Bacteria 2302
419 Ga0501032_0030082 3300049569 Bacteria 3725
420 Ga0501032_0260073 3300049569 Bacteria 1125
421 Ga0501034_0009006 3300049571 Bacteria 10483
422 Ga0501034_0036396 3300049571 Unclassified 4986
423 Ga0501034_0063319 3300049571 Unclassified 3712
424 Ga0501034_0076765 3300049571 Bacteria 3347
425 Ga0501034_0105005 3300049571 Bacteria 2818
426 Ga0501036_0005849 3300049572 Bacteria 9960
427 Ga0501036_0081308 3300049572 Bacteria 2738
428 Ga0501037_0040682 3300049573 Bacteria 3420
429 Ga0501039_0016507 3300049575 Bacteria 5655
430 Ga0501039_0153598 3300049575 Unclassified 1808
431 Ga0501043_0057413 3300049579 Bacteria 3056
432 Ga0501043_0059596 3300049579 Unclassified 2996
433 Ga0501043_0235181 3300049579 Unclassified 1414
434 Ga0501046_0127449 3300049580 Unclassified 1932
435 Ga0501046_0241354 3300049580 Bacteria 1332
436 Ga0501047_0093248 3300049581 Bacteria 2890
437 Ga0501047_0497042 3300049581 Bacteria 1046
438 Ga0501070_0062682 3300049586 Bacteria 3080
439 Ga0501073_0003496 3300049589 Bacteria 11804
440 Ga0501074_0049654 3300049590 Bacteria 3029
441 Ga0501198_008065 3300049649 Unclassified 1522
442 Ga0501201_001251 3300049651 Bacteria 2383
443 Ga0501202_012479 3300049652 Bacteria 1604
444 Ga0501206_007265 3300049653 Bacteria 1451
445 Ga0501216_018027 3300049660 Unclassified 1212
446 Ga0501217_001378 3300049661 Bacteria 4531
447 Ga0501222_002119 3300049662 Bacteria 2749
448 Ga0501223_006096 3300049663 Bacteria 2508
449 Ga0501223_007613 3300049663 Bacteria 2215
450 Ga0501224_002454 3300049664 Bacteria 2527
451 Ga0501224_004824 3300049664 Bacteria 1924
452 Ga0501230_018742 3300049667 Bacteria 1185
453 Ga0501233_016607 3300049668 Bacteria 1528
454 Ga0501235_003473 3300049669 Unclassified 3410
455 Ga0501242_001913 3300049674 Bacteria 2150
456 Ga0501243_010000 3300049675 Unclassified 1477
457 Ga0501247_002963 3300049677 Unclassified 1798
458 Ga0501252_000718 3300049682 Bacteria 2723
459 Ga0501252_000726 3300049682 Bacteria 2713
460 Ga0501259_001461 3300049688 Bacteria 3934
461 Ga0501259_002557 3300049688 Bacteria 2936
462 Ga0501221_000433 3300049704 Bacteria 6494
463 Ga0501225_0005432 3300049705 Bacteria 3744
464 Ga0501225_0008252 3300049705 Bacteria 2995
465 Ga0501225_0008255 3300049705 Bacteria 2994
466 Ga0501234_001099 3300049707 Bacteria 4278
467 Ga0501080_0495859 3300049742 Unclassified 1092
468 Ga0501083_0234033 3300049744 Bacteria 1196
469 Ga0501241_000078 3300049758 Bacteria 21770
470 Ga0501241_025253 3300049758 Unclassified 1106
471 Ga0501263_001626 3300049760 Bacteria 2157
472 Ga0501266_015673 3300049763 Bacteria 1003
473 Ga0501268_000050 3300049765 Bacteria 9158
474 Ga0501268_009165 3300049765 Bacteria 1516
475 Ga0501270_000136 3300049767 Bacteria 5726
476 Ga0501271_002044 3300049768 Bacteria 1773
477 Ga0501035_0037822 3300049822 Bacteria 4368
478 Ga0501035_0074981 3300049822 Bacteria 2992
479 Ga0501035_0092700 3300049822 Bacteria 2658
480 Ga0501035_0212957 3300049822 Bacteria 1653
481 Ga0501044_0008372 3300049823 Bacteria 11340
482 Ga0501044_0021836 3300049823 Bacteria 6826
483 Ga0501044_0027431 3300049823 Bacteria 6019
484 Ga0501044_0122340 3300049823 Unclassified 2602
485 Ga0501044_0158521 3300049823 Bacteria 2241
486 Ga0501044_0160659 3300049823 Unclassified 2224
487 Ga0501044_0185090 3300049823 Unclassified 2048
488 Ga0501044_0211161 3300049823 Bacteria 1895
489 Ga0501212_006392 3300049851 Unclassified 1588
490 Ga0501284_00011 3300050005 Bacteria 131008
491 nmdc:mga0k408_76_c2 3300050493 Bacteria 45945
492 nmdc:mga05p37_1503_c1 3300050507 Bacteria 27101
493 nmdc:mga08y16_773228_c1 3300050511 Bacteria 955
494 Ga0500578_0000034 3300053086 Bacteria 136582
495 Ga0500644_0000475 3300053088 Bacteria 17705
496 Ga0500646_0033879 3300053090 Bacteria 1414
497 Ga0500583_0000075 3300053092 Bacteria 59561
498 Ga0500583_0035936 3300053092 Bacteria 2215
499 Ga0500569_000194 3300053109 Bacteria 9667
500 Ga0500607_111129 3300053121 Bacteria 1343
501 Ga0500608_063916 3300053122 Bacteria 1756
502 Ga0500618_000079 3300053125 Bacteria 79415
503 Ga0500652_040201 3300053131 Bacteria 1878
504 Ga0500658_0005885 3300053134 Bacteria 4564
505 Ga0500559_0040623 3300053136 Bacteria 2026
506 Ga0500559_0092546 3300053136 Bacteria 1386
507 Ga0500577_0000746 3300053142 Bacteria 8360
508 Ga0500616_0002819 3300053153 Bacteria 13977
509 Ga0500616_0158747 3300053153 Bacteria 1039
510 Ga0500622_0000725 3300053156 Bacteria 28810
511 Ga0500622_0001514 3300053156 Bacteria 18450
512 Ga0500622_0001543 3300053156 Bacteria 18252
513 Ga0500622_0147950 3300053156 Bacteria 1113
514 Ga0500633_0000363 3300053160 Bacteria 6929
515 Ga0500634_0031992 3300053161 Bacteria 2870
516 Ga0500636_0020568 3300053177 Bacteria 3908
517 Ga0500636_0026467 3300053177 Bacteria 3427
518 Ga0500636_0249093 3300053177 Unclassified 907
519 Ga0500637_0150033 3300053178 Bacteria 1347
520 Ga0500611_000031 3300053727 Bacteria 85821
521 Ga0500661_000526 3300055283 Bacteria 7108
522 Ga0453684_0098620
523 MRS1b_contig_4179915
524 JGI25153J46596_10022911
525 rootH2_10009544
526 rootH2_10040616
527 rootH2_10079703
528 rootH2_10144318
529 rootL2_10039568
530 rootL2_10055887
531 rootL2_10086867
532 rootL2_10088141
533 rootL2_10225346
534 rootH1_10043705
535 JGI25160J50197_1005348
536 Ga0055535_1001325
537 Ga0055526_1029785
538 Ga0055528_1001409
539 Ga0055528_1003892
540 Ga0055530_10000629
541 Ga0055530_10014473
542 Ga0055531_10000237
543 Ga0055531_10042374
544 Ga0055543_1018264
545 Ga0065165_1000190
546 Ga0065714_10074356
547 Ga0065712_10141767
548 Ga0070658_10000857
549 Ga0070676_10000507
550 Ga0070670_100022675
551 Ga0070670_100107969
552 Ga0070677_10004868
553 Ga0068869_100019836
554 Ga0068869_100096186
555 Ga0070666_10000043
556 Ga0070680_100002208
557 Ga0070682_100000054
558 Ga0070682_100002478
559 Ga0070682_100049741
560 Ga0068868_100000346
561 Ga0068868_100238434
562 Ga0068868_100416739
563 Ga0070660_100045014
564 Ga0070691_10009814
565 Ga0070661_100094196
566 Ga0070668_100005211
567 Ga0070668_100149663
568 Ga0070669_100073610
569 Ga0070675_100095157
570 Ga0070671_100039412
571 Ga0070671_100048885
572 Ga0070671_100052230
573 Ga0070671_100131695
574 Ga0070671_100193903
575 Ga0070674_100084086
576 Ga0070673_100001042
577 Ga0070673_100215763
578 Ga0070673_100286627
579 Ga0070667_100003119
580 Ga0070667_100011774
581 Ga0070667_100039591
582 Ga0070667_100040189
583 Ga0070678_100258875
584 Ga0070662_100020993
585 Ga0070681_10025897
586 Ga0068867_100007630
587 Ga0068867_100016825
588 Ga0070706_100334039
589 Ga0070698_100095714
590 Ga0070698_100381166
591 Ga0070679_100017428
592 Ga0070684_100003150
593 Ga0068853_100039537
594 Ga0068853_100063568
595 Ga0068853_100102767
596 Ga0070672_100001246
597 Ga0070672_100050208
598 Ga0070672_100419978
599 Ga0070665_100000041
600 Ga0070665_100055304
601 Ga0068855_100015722
602 Ga0068855_100042337
603 Ga0068855_100813493
604 Ga0070664_100010422
605 Ga0068857_100047951
606 Ga0068857_100224689
607 Ga0068856_100049922
608 Ga0068856_100092965
609 Ga0068852_100011311
610 Ga0068852_100109435
611 Ga0068859_100000012
612 Ga0068859_100016532
613 Ga0068859_100080764
614 Ga0068859_100294773
615 Ga0068864_100003733
616 Ga0068864_100018754
617 Ga0068864_100602624
618 Ga0068866_10089124
619 Ga0068861_100021142
620 Ga0068861_100117197
621 Ga0068851_10004819
622 Ga0068851_10150961
623 Ga0068851_10152277
624 Ga0068863_100004641
625 Ga0068863_100007625
626 Ga0068863_100045334
627 Ga0068863_100518628
628 Ga0068858_100000505
629 Ga0068858_100004161
630 Ga0068860_100000383
631 Ga0068860_100000700
632 Ga0068860_100000764
633 Ga0068860_100007672
634 Ga0068860_100011318
635 Ga0068860_100016430
636 Ga0068860_100238690
637 Ga0075366_10000063
638 Ga0075366_10181946
639 Ga0075366_10204265
640 Ga0075366_10266675
641 Ga0097621_100001591
642 Ga0097621_100042363
643 Ga0068871_100000737
644 Ga0068871_100132346
645 Ga0068865_100006644
646 Ga0068865_100112213
647 Ga0068865_100405096
648 Ga0097620_100000012
649 Ga0097620_100016532
650 Ga0097620_100080762
651 Ga0097620_100294778
652 Ga0075435_100475427
653 Ga0105240_10000224
654 Ga0105240_10003457
655 Ga0105240_10005749
656 Ga0105240_10078578
657 Ga0105240_10192364
658 Ga0105245_10218401
659 Ga0105245_10277984
660 Ga0105247_10009650
661 Ga0114129_10001869
662 Ga0105241_10000493
663 Ga0105241_10000621
664 Ga0105241_10001522
665 Ga0105241_10077133
666 Ga0105241_10078344
667 Ga0105241_10561278
668 Ga0105242_10031987
669 Ga0105242_10124521
670 Ga0105248_10283289
671 Ga0105237_10000719
672 Ga0105237_10000725
673 Ga0105237_10002801
674 Ga0105237_10003801
675 Ga0105237_10004541
676 Ga0105237_10151168
677 Ga0105238_10000247
678 Ga0105238_10144195
679 Ga0105238_10337814
680 Ga0105249_10002694
681 Ga0105249_10060790
682 Ga0105249_10329490
683 Ga0105239_10000685
684 Ga0105239_10000785
685 Ga0105239_10025508
686 Ga0105239_10029882
687 Ga0105239_10064386
688 Ga0105239_10140480
689 Ga0105239_10240102
690 Ga0105246_10273214
691 Ga0157373_10009465
692 Ga0157371_10064962
693 Ga0157370_10004711
694 Ga0157370_10313872
695 Ga0157369_10181421
696 Ga0157374_10000001
697 Ga0157374_10233291
698 Ga0157374_10404255
699 Ga0157378_10156202
700 Ga0157378_10643935
701 Ga0163162_10000840
702 Ga0163162_10001520
703 Ga0163162_10011675
704 Ga0163162_10044223
705 Ga0163162_10050354
706 Ga0163162_10061988
707 Ga0163162_10094447
708 Ga0163162_10266099
709 Ga0157372_10005928
710 Ga0157372_10041159
711 Ga0157372_10179349
712 Ga0157372_10220543
713 Ga0157372_10438249
714 Ga0157372_10661081
715 Ga0157375_10008330
716 Ga0157375_10119087
717 Ga0157375_10123181
718 Ga0157375_10182989
719 Ga0157375_10237058
720 Ga0163163_10000407
721 Ga0163163_10002778
722 Ga0163163_10011385
723 Ga0163163_10126994
724 Ga0163163_10161155
725 Ga0157380_10012636
726 Ga0157380_10034929
727 Ga0157380_10046441
728 Ga0157379_10010697
729 Ga0157379_10031263
730 Ga0157379_10036208
731 Ga0157379_10088730
732 Ga0157379_10467567
733 Ga0157376_10001529
734 Ga0157376_10030372
735 Ga0157376_10053042
736 Ga0157376_10435801
737 Ga0163161_10023951
738 Ga0213876_10006282
739 Ga0213876_10007563
740 Ga0209436_101685
741 Ga0209436_104301
742 Ga0209258_100068
743 Ga0209148_1000343
744 Ga0209673_1000403
745 Ga0209130_1011833
746 Ga0209564_1009069
747 Ga0209758_1023582
748 Ga0209758_1065226
749 Ga0209050_1000136
750 Ga0207426_1000164
751 Ga0207426_1000543
752 Ga0209051_1067936
753 Ga0209257_1000025
754 Ga0209257_1002647
755 Ga0207656_10001567
756 Ga0207656_10012177
757 Ga0207682_10021864
758 Ga0207642_10254192
759 Ga0207680_10000108
760 Ga0207680_10002539
761 Ga0207647_10000831
762 Ga0207647_10044871
763 Ga0207645_10002853
764 Ga0207645_10219288
765 Ga0207643_10266874
766 Ga0207705_10003710
767 Ga0207654_10000775
768 Ga0207654_10002900
769 Ga0207654_10004284
770 Ga0207707_10000889
771 Ga0207695_10000023
772 Ga0207695_10000031
773 Ga0207695_10002344
774 Ga0207695_10016439
775 Ga0207695_10135384
776 Ga0207671_10001536
777 Ga0207671_10002088
778 Ga0207671_10010686
779 Ga0207671_10100678
780 Ga0207660_10002515
781 Ga0207662_10130832
782 Ga0207649_10192630
783 Ga0207649_10414839
784 Ga0207652_10002423
785 Ga0207652_10071047
786 Ga0207681_10063874
787 Ga0207694_10004436
788 Ga0207650_10012509
789 Ga0207650_10446005
790 Ga0207659_10038822
791 Ga0207659_10147924
792 Ga0207644_10017050
793 Ga0207644_10021140
794 Ga0207644_10027333
795 Ga0207706_10025929
796 Ga0207686_10015195
797 Ga0207669_10128503
798 Ga0207704_10002218
799 Ga0207704_10297944
800 Ga0207691_10000228
801 Ga0207691_10062119
802 Ga0207691_10151174
803 Ga0207689_10001398
804 Ga0207689_10003446
805 Ga0207689_10110637
806 Ga0207661_10028363
807 Ga0207679_10003970
808 Ga0207679_10208273
809 Ga0207667_10005340
810 Ga0207667_10052787
811 Ga0207651_10023614
812 Ga0207651_10072754
813 Ga0207712_10034964
814 Ga0207712_10073408
815 Ga0207668_10002045
816 Ga0207668_10142047
817 Ga0207658_10001335
818 Ga0207658_10024620
819 Ga0207658_10139471
820 Ga0207658_10402571
821 Ga0207677_10000978
822 Ga0207677_10061035
823 Ga0207703_10004989
824 Ga0207703_10008484
825 Ga0207639_10042406
826 Ga0207702_10047249
827 Ga0207702_10069480
828 Ga0207641_10000048
829 Ga0207641_10039850
830 Ga0207641_10220787
831 Ga0207648_10007506
832 Ga0207648_10013131
833 Ga0207648_10022540
834 Ga0207648_10047172
835 Ga0207648_10263090
836 Ga0207676_10001611
837 Ga0207676_10014711
838 Ga0207674_10080681
839 Ga0207674_10231552
840 Ga0207674_10301503
841 Ga0207674_10387768
842 Ga0207674_10507289
843 Ga0207675_100057429
844 Ga0207675_100081635
845 Ga0207683_10095638
846 Ga0207683_10209837
847 Ga0207698_10002537
848 Ga0207698_10109863
849 Ga0207698_10147360
850 Ga0268266_10000049
851 Ga0268266_10008792
852 Ga0268264_10000041
853 Ga0268264_10002959
854 Ga0268264_10003558
855 Ga0268264_10006197
856 Ga0268264_10028309
857 Ga0268264_10059517
858 Ga0268264_10250252
859 Ga0268264_10490286
860 Ga0307515_10000001
861 Ga0307515_10000290
862 Ga0307515_10008220
863 Ga0265327_10000248
864 Ga0265327_10000285
865 Ga0265327_10001115
866 Ga0265327_10007365
867 Ga0265327_10042850
868 Ga0307509_10019958
869 Ga0307509_10025149
870 Ga0307408_100000139
871 Ga0307413_10315560
872 Ga0307410_10193434
873 Ga0307407_10011082
874 Ga0307407_10054778
875 Ga0307412_10104280
876 Ga0307409_100053824
877 Ga0307416_100021717
878 Ga0307411_10011334
879 Ga0307411_10041573
880 Ga0307415_100080347
881 Ga0395900_0051882
882 Ga0395905_0060715
883 Ga0395905_0168289
884 Ga0395901_0055048
885 Ga0436365_1287042
886 Ga0436365_1339095
887 Ga0439436_0025088
888 Ga0439433_0048598
889 Ga0439449_0032338
890 Ga0439449_0038848
891 Ga0439449_0038939
892 Ga0439449_0040922
893 Ga0439449_0138343
894 Ga0439457_000696
895 Ga0439457_017275
896 Ga0439457_020912
897 Ga0439462_0000918
898 Ga0439434_0011095
899 Ga0451577_0000557
900 Ga0451577_0063175
901 Ga0466969_0000238
902 Ga0466972_0037517
903 Ga0466966_0000136
904 Ga0453684_0000024
905 Ga0453684_0011220
906 Ga0453684_0547159
907 Ga0466968_0040342
908 Ga0466970_0082120
909 Ga0466957_0001467
910 Ga0466957_0002368
911 Ga0466959_0000002
912 Ga0466959_0044378
913 Ga0495638_0070096
914 Ga0495650_0035182
915 Ga0495650_0112720
916 Ga0495585_0000588
917 Ga0495648_0000729
918 Ga0495648_0034384
919 Ga0495654_0116154
920 Ga0495609_0003030
921 Ga0495622_0042549
922 Ga0495633_0000027
923 Ga0495668_0000021
924 Ga0495668_0000751
925 Ga0495611_0010178
926 Ga0495625_0001499
927 Ga0495625_0010588
928 Ga0495687_000001
929 Ga0495686_0000111
930 Ga0496101_0165095
931 Ga0496104_0307228
932 Ga0496109_0473109
933 Ga0496114_0001077
934 Ga0496121_0000010
935 Ga0496126_0103252
936 Ga0501291_002155
937 Ga0501292_006776
938 Ga0501298_002421
939 Ga0501298_004007
940 Ga0501032_0030082
941 Ga0501032_0260073
942 Ga0501034_0009006
943 Ga0501034_0036396
944 Ga0501034_0063319
945 Ga0501034_0076765
946 Ga0501034_0105005
947 Ga0501036_0005849
948 Ga0501036_0081308
949 Ga0501037_0040682
950 Ga0501039_0016507
951 Ga0501039_0153598
952 Ga0501043_0057413
953 Ga0501043_0059596
954 Ga0501043_0235181
955 Ga0501046_0127449
956 Ga0501046_0241354
957 Ga0501047_0093248
958 Ga0501047_0497042
959 Ga0501070_0062682
960 Ga0501073_0003496
961 Ga0501074_0049654
962 Ga0501198_008065
963 Ga0501201_001251
964 Ga0501202_012479
965 Ga0501206_007265
966 Ga0501216_018027
967 Ga0501217_001378
968 Ga0501222_002119
969 Ga0501223_006096
970 Ga0501223_007613
971 Ga0501224_002454
972 Ga0501224_004824
973 Ga0501230_018742
974 Ga0501233_016607
975 Ga0501235_003473
976 Ga0501242_001913
977 Ga0501243_010000
978 Ga0501247_002963
979 Ga0501252_000718
980 Ga0501252_000726
981 Ga0501259_001461
982 Ga0501259_002557
983 Ga0501221_000433
984 Ga0501225_0005432
985 Ga0501225_0008252
986 Ga0501225_0008255
987 Ga0501234_001099
988 Ga0501080_0495859
989 Ga0501083_0234033
990 Ga0501241_000078
991 Ga0501241_025253
992 Ga0501263_001626
993 Ga0501266_015673
994 Ga0501268_000050
995 Ga0501268_009165
996 Ga0501270_000136
997 Ga0501271_002044
998 Ga0501035_0037822
999 Ga0501035_0074981
1000 Ga0501035_0092700
1001 Ga0501035_0212957
1002 Ga0501044_0008372
1003 Ga0501044_0021836
1004 Ga0501044_0027431
1005 Ga0501044_0122340
1006 Ga0501044_0158521
1007 Ga0501044_0160659
1008 Ga0501044_0185090
1009 Ga0501044_0211161
1010 Ga0501212_006392
1011 Ga0501284_00011
1012 nmdc:mga0k408_76_c2
1013 nmdc:mga05p37_1503_c1
1014 nmdc:mga08y16_773228_c1
1015 Ga0500578_0000034
1016 Ga0500644_0000475
1017 Ga0500646_0033879
1018 Ga0500583_0000075
1019 Ga0500583_0035936
1020 Ga0500569_000194
1021 Ga0500607_111129
1022 Ga0500608_063916
1023 Ga0500618_000079
1024 Ga0500652_040201
1025 Ga0500658_0005885
1026 Ga0500559_0040623
1027 Ga0500559_0092546
1028 Ga0500577_0000746
1029 Ga0500616_0002819
1030 Ga0500616_0158747
1031 Ga0500622_0000725
1032 Ga0500622_0001514
1033 Ga0500622_0001543
1034 Ga0500622_0147950
1035 Ga0500633_0000363
1036 Ga0500634_0031992
1037 Ga0500636_0020568
1038 Ga0500636_0026467
1039 Ga0500636_0249093
1040 Ga0500637_0150033
1041 Ga0500611_000031
1042 Ga0500661_000526

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

24

271

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8swt-assembly1.cif.gz_A structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate 0.9725 18 287
4nsn-assembly1.cif.gz_C crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 030972, orthorhombic symmetry 0.9719 19 287
4lna-assembly1.cif.gz_A crystal structure of purine nucleoside phosphorylase i from spirosoma linguale dsm 74, nysgrc target 029362 0.9705 17 287
4ns1-assembly1.cif.gz_C crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 30972 0.9701 19 287
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.9693 16 283
ID Description Score Start End Superfamily
4lnaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9637 19 287 3.40.50.1580
4ns1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.962 19 287 3.40.50.1580
4lnaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9564 19 287 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9533 17 287 3.40.50.1580
1td1C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9527 20 287 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A4R4E9S8-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9874 19 287 GO:0004731
GO:0005737
GO:0009116
AF-A0A1V2BAR0-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9802 19 287 GO:0004731
GO:0005737
GO:0009116
AF-A0A4R4E9S8-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9802 19 287 GO:0004731
GO:0005737
GO:0009116
AF-A0A2W2B3E9-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9797 16 287 GO:0004731
GO:0005737
GO:0009116
AF-A0A0Q1FRJ8-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9778 95 287 GO:0004731
GO:0005737
GO:0009116

Map