F458902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 522 | 295 | 489 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0003416|Ga0501032_0003416_7196_8383 |
| Length | 379 |
| Sequence | MFAPSIGIKCHLAPNNPDSAPVIKERGSFKPLRSGTTGEHAIMIEITRLEAPTSLARTEPSTRTPLRVGVVQHRWHADEAVLRAELNEGIERAAKLGAAVVFLPELTLSRYPADTRPANNPAAGVRPSDIAEDLLTGPTFTFAAEAARKFGVSVHASLYQRAENPDGTDDGLGLNTAILVSPAGELVARTHKLHIPVTAGYYEDKFFRKGPDADDAYAVHAPAELGGARLGMPTCWDEWFPELARLYSLGGAEILVYPTAIGSEPDHPDFDTQPLWQQVIVGNGIANGLFMVAPNRHGSEGTLNFYGSSFISDPYGRILVQAPRDESAVLVADLDLDQRKDWLTLFPFLTTRRPETYGRLTEPVNHDAPLGAQPQAVPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 8 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 9 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 10 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 11 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 12 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 13 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 14 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 15 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 16 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 17 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 18 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 19 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 20 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 21 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 22 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 23 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 24 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 25 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 26 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 27 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 28 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 29 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 30 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 31 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 32 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 33 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 34 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 168 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 169 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 170 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 173 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 174 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 175 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 247 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 292 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.68 |
| Metatranscriptomes | 0 |
| Isolates | 6.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.45 |
| Nodule | 0 |
| Rhizoplane | 13.41 |
| Rhizosphere | 76.05 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 6.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1010273 | 3300002737 | Bacteria | 1193 |
| 2 | JGI25164J39214_1001102 | 3300002772 | Bacteria | 7765 |
| 3 | JGI25165J46597_1000014 | 3300003214 | Bacteria | 390383 |
| 4 | rootH2_10085513 | 3300003320 | Bacteria | 2394 |
| 5 | Ga0070683_100155886 | 3300005329 | Bacteria | 2165 |
| 6 | Ga0070670_100138735 | 3300005331 | Bacteria | 2102 |
| 7 | Ga0070666_10038337 | 3300005335 | Bacteria | 3188 |
| 8 | Ga0070666_10180959 | 3300005335 | Bacteria | 1478 |
| 9 | Ga0070689_100231213 | 3300005340 | Bacteria | 1520 |
| 10 | Ga0070668_100244320 | 3300005347 | Bacteria | 1488 |
| 11 | Ga0070669_100008474 | 3300005353 | Bacteria | 7341 |
| 12 | Ga0070669_100010580 | 3300005353 | Bacteria | 6550 |
| 13 | Ga0070675_100004238 | 3300005354 | Bacteria | 10909 |
| 14 | Ga0070671_100017642 | 3300005355 | Bacteria | 5784 |
| 15 | Ga0070674_100127830 | 3300005356 | Bacteria | 1890 |
| 16 | Ga0070673_100279268 | 3300005364 | Bacteria | 1464 |
| 17 | Ga0070688_100005702 | 3300005365 | Bacteria | 6582 |
| 18 | Ga0070688_100005975 | 3300005365 | Bacteria | 6452 |
| 19 | Ga0070667_100128201 | 3300005367 | Bacteria | 2213 |
| 20 | Ga0070667_100139945 | 3300005367 | Bacteria | 2118 |
| 21 | Ga0070714_100037632 | 3300005435 | Bacteria | 4066 |
| 22 | Ga0070714_100078053 | 3300005435 | Bacteria | 2877 |
| 23 | Ga0070714_100118612 | 3300005435 | Bacteria | 2351 |
| 24 | Ga0070713_100001904 | 3300005436 | Bacteria | 13443 |
| 25 | Ga0070713_100050180 | 3300005436 | Bacteria | 3445 |
| 26 | Ga0070713_100140360 | 3300005436 | Bacteria | 2140 |
| 27 | Ga0070708_100283441 | 3300005445 | Bacteria | 1559 |
| 28 | Ga0070663_100000859 | 3300005455 | Bacteria | 16482 |
| 29 | Ga0070678_100012734 | 3300005456 | Bacteria | 5243 |
| 30 | Ga0070685_10000018 | 3300005466 | Bacteria | 110132 |
| 31 | Ga0070685_10001560 | 3300005466 | Bacteria | 12073 |
| 32 | Ga0070706_100099689 | 3300005467 | Bacteria | 2699 |
| 33 | Ga0070707_100158946 | 3300005468 | Bacteria | 2201 |
| 34 | Ga0070698_100014435 | 3300005471 | Bacteria | 8342 |
| 35 | Ga0070698_100128061 | 3300005471 | Bacteria | 2495 |
| 36 | Ga0070699_100031996 | 3300005518 | Bacteria | 4542 |
| 37 | Ga0070679_100037721 | 3300005530 | Bacteria | 4802 |
| 38 | Ga0070684_100049369 | 3300005535 | Bacteria | 3652 |
| 39 | Ga0070672_100000004 | 3300005543 | Bacteria | 129970 |
| 40 | Ga0070672_100108289 | 3300005543 | Bacteria | 2262 |
| 41 | Ga0070665_100051052 | 3300005548 | Bacteria | 4149 |
| 42 | Ga0070665_100090558 | 3300005548 | Bacteria | 3064 |
| 43 | Ga0068855_100009285 | 3300005563 | Bacteria | 11879 |
| 44 | Ga0068857_100089264 | 3300005577 | Bacteria | 2758 |
| 45 | Ga0068856_100149750 | 3300005614 | Bacteria | 2342 |
| 46 | Ga0068852_100039173 | 3300005616 | Bacteria | 3989 |
| 47 | Ga0068863_100063307 | 3300005841 | Bacteria | 3498 |
| 48 | Ga0068863_100468378 | 3300005841 | Bacteria | 1238 |
| 49 | Ga0081540_1000129 | 3300005983 | Bacteria | 80446 |
| 50 | Ga0070717_10038018 | 3300006028 | Bacteria | 3910 |
| 51 | Ga0070717_10083773 | 3300006028 | Bacteria | 2682 |
| 52 | Ga0075365_10050547 | 3300006038 | Bacteria | 2742 |
| 53 | Ga0075365_10242647 | 3300006038 | Bacteria | 1265 |
| 54 | Ga0075363_100055329 | 3300006048 | Bacteria | 2125 |
| 55 | Ga0075364_10093978 | 3300006051 | Bacteria | 1992 |
| 56 | Ga0075432_10000095 | 3300006058 | Bacteria | 18569 |
| 57 | Ga0075428_100302719 | 3300006844 | Bacteria | 1719 |
| 58 | Ga0075433_10010907 | 3300006852 | Bacteria | 7311 |
| 59 | Ga0075434_100021060 | 3300006871 | Bacteria | 6334 |
| 60 | Ga0075429_100006435 | 3300006880 | Bacteria | 10172 |
| 61 | Ga0075436_100059614 | 3300006914 | Bacteria | 2636 |
| 62 | Ga0105251_10014085 | 3300009011 | Bacteria | 4441 |
| 63 | Ga0105244_10004517 | 3300009036 | Bacteria | 9549 |
| 64 | Ga0105244_10086106 | 3300009036 | Bacteria | 1550 |
| 65 | Ga0105240_10494751 | 3300009093 | Bacteria | 1361 |
| 66 | Ga0111539_10047017 | 3300009094 | Bacteria | 5159 |
| 67 | Ga0105245_10000283 | 3300009098 | Bacteria | 48302 |
| 68 | Ga0105245_10011020 | 3300009098 | Bacteria | 7868 |
| 69 | Ga0105245_10127864 | 3300009098 | Bacteria | 2380 |
| 70 | Ga0105245_10331354 | 3300009098 | Bacteria | 1502 |
| 71 | Ga0105247_10000649 | 3300009101 | Bacteria | 27562 |
| 72 | Ga0114129_10429267 | 3300009147 | Bacteria | 1736 |
| 73 | Ga0105243_10026965 | 3300009148 | Bacteria | 4400 |
| 74 | Ga0105243_10064123 | 3300009148 | Bacteria | 2947 |
| 75 | Ga0105241_10028290 | 3300009174 | Bacteria | 4177 |
| 76 | Ga0105248_10002486 | 3300009177 | Bacteria | 20480 |
| 77 | Ga0105248_10051753 | 3300009177 | Bacteria | 4608 |
| 78 | Ga0105237_10087995 | 3300009545 | Bacteria | 3095 |
| 79 | Ga0105238_10242197 | 3300009551 | Bacteria | 1781 |
| 80 | Ga0105246_10013664 | 3300011119 | Bacteria | 5095 |
| 81 | Ga0157369_10011880 | 3300013105 | Bacteria | 9891 |
| 82 | Ga0157369_10128563 | 3300013105 | Bacteria | 2685 |
| 83 | Ga0163162_10087353 | 3300013306 | Bacteria | 3197 |
| 84 | Ga0163162_10166688 | 3300013306 | Bacteria | 2327 |
| 85 | Ga0163162_10196397 | 3300013306 | Bacteria | 2147 |
| 86 | Ga0157375_10051386 | 3300013308 | Bacteria | 4047 |
| 87 | Ga0157375_10225014 | 3300013308 | Bacteria | 2035 |
| 88 | Ga0163163_10029162 | 3300014325 | Bacteria | 5307 |
| 89 | Ga0157380_10001287 | 3300014326 | Bacteria | 16323 |
| 90 | Ga0182008_10081392 | 3300014497 | Bacteria | 1594 |
| 91 | Ga0157377_10105179 | 3300014745 | Bacteria | 1689 |
| 92 | Ga0157379_10063437 | 3300014968 | Bacteria | 3303 |
| 93 | Ga0157379_10084390 | 3300014968 | Bacteria | 2846 |
| 94 | Ga0157376_10072535 | 3300014969 | Bacteria | 2929 |
| 95 | Ga0163161_10098728 | 3300017792 | Bacteria | 2171 |
| 96 | Ga0207427_100121 | 3300025231 | Bacteria | 99954 |
| 97 | Ga0209437_100398 | 3300025233 | Bacteria | 40556 |
| 98 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 99 | Ga0209051_1014337 | 3300025303 | Bacteria | 3705 |
| 100 | Ga0207697_10000412 | 3300025315 | Bacteria | 24182 |
| 101 | Ga0207697_10000805 | 3300025315 | Bacteria | 17773 |
| 102 | Ga0207655_1001561 | 3300025728 | Bacteria | 20650 |
| 103 | Ga0207655_1015236 | 3300025728 | Bacteria | 4286 |
| 104 | Ga0207655_1072177 | 3300025728 | Bacteria | 1278 |
| 105 | Ga0207713_1035501 | 3300025735 | Bacteria | 2151 |
| 106 | Ga0207682_10009340 | 3300025893 | Bacteria | 3875 |
| 107 | Ga0207692_10019244 | 3300025898 | Bacteria | 3082 |
| 108 | Ga0207692_10046702 | 3300025898 | Bacteria | 2172 |
| 109 | Ga0207710_10000426 | 3300025900 | Bacteria | 27570 |
| 110 | Ga0207680_10005659 | 3300025903 | Bacteria | 5980 |
| 111 | Ga0207680_10015104 | 3300025903 | Bacteria | 4021 |
| 112 | Ga0207645_10011034 | 3300025907 | Bacteria | 6182 |
| 113 | Ga0207684_10053071 | 3300025910 | Bacteria | 3441 |
| 114 | Ga0207671_10015734 | 3300025914 | Bacteria | 5909 |
| 115 | Ga0207652_10000307 | 3300025921 | Bacteria | 50351 |
| 116 | Ga0207681_10006222 | 3300025923 | Bacteria | 7321 |
| 117 | Ga0207650_10017213 | 3300025925 | Bacteria | 5059 |
| 118 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 119 | Ga0207687_10006313 | 3300025927 | Bacteria | 7836 |
| 120 | Ga0207687_10096326 | 3300025927 | Bacteria | 2168 |
| 121 | Ga0207687_10183817 | 3300025927 | Bacteria | 1621 |
| 122 | Ga0207700_10068410 | 3300025928 | Bacteria | 2722 |
| 123 | Ga0207700_10078482 | 3300025928 | Bacteria | 2569 |
| 124 | Ga0207700_10086654 | 3300025928 | Bacteria | 2461 |
| 125 | Ga0207664_10070326 | 3300025929 | Bacteria | 2816 |
| 126 | Ga0207664_10071978 | 3300025929 | Bacteria | 2786 |
| 127 | Ga0207664_10099587 | 3300025929 | Bacteria | 2399 |
| 128 | Ga0207690_10140296 | 3300025932 | Bacteria | 1780 |
| 129 | Ga0207709_10012655 | 3300025935 | Bacteria | 4650 |
| 130 | Ga0207709_10091230 | 3300025935 | Bacteria | 1992 |
| 131 | Ga0207709_10204160 | 3300025935 | Bacteria | 1414 |
| 132 | Ga0207670_10366002 | 3300025936 | Bacteria | 1145 |
| 133 | Ga0207691_10000020 | 3300025940 | Bacteria | 133465 |
| 134 | Ga0207691_10004975 | 3300025940 | Bacteria | 12820 |
| 135 | Ga0207711_10003747 | 3300025941 | Bacteria | 13102 |
| 136 | Ga0207711_10033740 | 3300025941 | Bacteria | 4333 |
| 137 | Ga0207661_10028785 | 3300025944 | Bacteria | 4259 |
| 138 | Ga0207661_10059884 | 3300025944 | Bacteria | 3070 |
| 139 | Ga0207667_10017456 | 3300025949 | Bacteria | 8075 |
| 140 | Ga0207658_10033339 | 3300025986 | Bacteria | 3673 |
| 141 | Ga0207677_10002503 | 3300026023 | Bacteria | 9629 |
| 142 | Ga0207678_10008282 | 3300026067 | Bacteria | 9160 |
| 143 | Ga0207641_10452932 | 3300026088 | Bacteria | 1240 |
| 144 | Ga0207674_10089520 | 3300026116 | Bacteria | 3070 |
| 145 | Ga0207675_100120076 | 3300026118 | Bacteria | 2486 |
| 146 | Ga0207683_10010818 | 3300026121 | Bacteria | 7780 |
| 147 | Ga0207698_10004988 | 3300026142 | Bacteria | 8138 |
| 148 | Ga0268266_10000247 | 3300028379 | Bacteria | 91489 |
| 149 | Ga0268266_10055236 | 3300028379 | Bacteria | 3414 |
| 150 | Ga0268266_10216492 | 3300028379 | Bacteria | 1759 |
| 151 | Ga0265327_10000185 | 3300031251 | Bacteria | 131884 |
| 152 | Ga0307408_100013782 | 3300031548 | Bacteria | 5367 |
| 153 | Ga0307408_100023549 | 3300031548 | Bacteria | 4196 |
| 154 | Ga0307408_100040648 | 3300031548 | Bacteria | 3293 |
| 155 | Ga0307408_100055570 | 3300031548 | Bacteria | 2867 |
| 156 | Ga0307408_100111811 | 3300031548 | Bacteria | 2099 |
| 157 | Ga0307408_100291219 | 3300031548 | Bacteria | 1363 |
| 158 | Ga0316575_10057679 | 3300031665 | Bacteria | 1548 |
| 159 | Ga0265314_10196952 | 3300031711 | Bacteria | 1194 |
| 160 | Ga0316576_10054072 | 3300031727 | Bacteria | 2927 |
| 161 | Ga0316576_10198281 | 3300031727 | Bacteria | 1512 |
| 162 | Ga0316578_10104212 | 3300031728 | Bacteria | 1701 |
| 163 | Ga0307405_10011780 | 3300031731 | Bacteria | 4602 |
| 164 | Ga0307405_10036506 | 3300031731 | Bacteria | 2945 |
| 165 | Ga0307405_10053912 | 3300031731 | Bacteria | 2507 |
| 166 | Ga0307405_10119569 | 3300031731 | Bacteria | 1800 |
| 167 | Ga0307405_10154368 | 3300031731 | Bacteria | 1618 |
| 168 | Ga0307405_10270291 | 3300031731 | Bacteria | 1274 |
| 169 | Ga0316577_10064343 | 3300031733 | Bacteria | 2047 |
| 170 | Ga0307413_10034494 | 3300031824 | Bacteria | 2893 |
| 171 | Ga0307413_10174299 | 3300031824 | Bacteria | 1526 |
| 172 | Ga0307410_10010463 | 3300031852 | Bacteria | 5255 |
| 173 | Ga0307410_10013862 | 3300031852 | Bacteria | 4720 |
| 174 | Ga0307410_10020455 | 3300031852 | Bacteria | 4048 |
| 175 | Ga0307410_10053308 | 3300031852 | Bacteria | 2736 |
| 176 | Ga0307410_10070214 | 3300031852 | Bacteria | 2425 |
| 177 | Ga0307410_10084101 | 3300031852 | Bacteria | 2242 |
| 178 | Ga0307410_10218937 | 3300031852 | Bacteria | 1463 |
| 179 | Ga0307406_10017791 | 3300031901 | Bacteria | 4144 |
| 180 | Ga0307406_10358366 | 3300031901 | Bacteria | 1142 |
| 181 | Ga0307407_10080587 | 3300031903 | Bacteria | 1967 |
| 182 | Ga0307407_10152675 | 3300031903 | Bacteria | 1502 |
| 183 | Ga0307407_10197490 | 3300031903 | Bacteria | 1345 |
| 184 | Ga0307407_10260019 | 3300031903 | Bacteria | 1193 |
| 185 | Ga0307412_10013690 | 3300031911 | Bacteria | 4764 |
| 186 | Ga0307412_10037005 | 3300031911 | Bacteria | 3132 |
| 187 | Ga0307412_10064761 | 3300031911 | Bacteria | 2470 |
| 188 | Ga0307412_10080167 | 3300031911 | Bacteria | 2254 |
| 189 | Ga0307412_10091620 | 3300031911 | Bacteria | 2128 |
| 190 | Ga0307409_100012546 | 3300031995 | Bacteria | 5406 |
| 191 | Ga0307409_100071534 | 3300031995 | Bacteria | 2758 |
| 192 | Ga0307409_100481273 | 3300031995 | Bacteria | 1204 |
| 193 | Ga0307416_100010248 | 3300032002 | Bacteria | 6181 |
| 194 | Ga0307416_100029141 | 3300032002 | Bacteria | 4119 |
| 195 | Ga0307416_100137154 | 3300032002 | Bacteria | 2216 |
| 196 | Ga0307416_100196760 | 3300032002 | Bacteria | 1907 |
| 197 | Ga0307414_10073426 | 3300032004 | Bacteria | 2475 |
| 198 | Ga0307411_10074238 | 3300032005 | Bacteria | 2317 |
| 199 | Ga0307411_10089306 | 3300032005 | Bacteria | 2146 |
| 200 | Ga0307415_100141554 | 3300032126 | Bacteria | 1838 |
| 201 | Ga0307415_100184087 | 3300032126 | Bacteria | 1642 |
| 202 | Ga0373955_0035028 | 3300035172 | Bacteria | 2656 |
| 203 | Ga0316574_0005931 | 3300035398 | Bacteria | 6554 |
| 204 | Ga0316574_0006035 | 3300035398 | Bacteria | 6509 |
| 205 | Ga0373933_0048202 | 3300035724 | Bacteria | 2536 |
| 206 | Ga0373937_0132777 | 3300036401 | Bacteria | 2326 |
| 207 | Ga0373937_0179742 | 3300036401 | Bacteria | 1986 |
| 208 | Ga0316584_0007562 | 3300036712 | Bacteria | 7444 |
| 209 | Ga0395899_0026430 | 3300037312 | Bacteria | 4380 |
| 210 | Ga0395899_0054998 | 3300037312 | Bacteria | 2944 |
| 211 | Ga0395900_0033677 | 3300037418 | Bacteria | 5272 |
| 212 | Ga0395900_0037495 | 3300037418 | Bacteria | 4997 |
| 213 | Ga0395900_0045178 | 3300037418 | Bacteria | 4537 |
| 214 | Ga0395900_0118224 | 3300037418 | Bacteria | 2720 |
| 215 | Ga0395898_0004605 | 3300037466 | Bacteria | 15056 |
| 216 | Ga0395898_0017201 | 3300037466 | Bacteria | 7385 |
| 217 | Ga0395898_0078315 | 3300037466 | Bacteria | 3189 |
| 218 | Ga0395898_0170274 | 3300037466 | Bacteria | 2082 |
| 219 | Ga0395898_0267589 | 3300037466 | Bacteria | 1630 |
| 220 | Ga0395905_0027277 | 3300037471 | Bacteria | 5386 |
| 221 | Ga0395905_0210047 | 3300037471 | Bacteria | 1824 |
| 222 | Ga0395905_0264361 | 3300037471 | Bacteria | 1606 |
| 223 | Ga0395905_0324355 | 3300037471 | Bacteria | 1430 |
| 224 | Ga0395901_0003181 | 3300038443 | Bacteria | 16522 |
| 225 | Ga0395901_0011883 | 3300038443 | Bacteria | 8830 |
| 226 | Ga0395901_0035723 | 3300038443 | Bacteria | 5135 |
| 227 | Ga0395901_0080928 | 3300038443 | Bacteria | 3392 |
| 228 | Ga0395901_0256804 | 3300038443 | Bacteria | 1820 |
| 229 | Ga0395901_0371763 | 3300038443 | Bacteria | 1472 |
| 230 | Ga0395901_0524316 | 3300038443 | Bacteria | 1203 |
| 231 | Ga0436365_0724850 | 3300039437 | Bacteria | 1564 |
| 232 | Ga0439436_0007508 | 3300041404 | Bacteria | 3355 |
| 233 | Ga0439438_038191 | 3300041405 | Bacteria | 1254 |
| 234 | Ga0439433_0000691 | 3300041999 | Bacteria | 6540 |
| 235 | Ga0439442_000626 | 3300042002 | Bacteria | 7588 |
| 236 | Ga0439442_001124 | 3300042002 | Bacteria | 5337 |
| 237 | Ga0439442_007323 | 3300042002 | Bacteria | 2218 |
| 238 | Ga0439449_0002127 | 3300042007 | Bacteria | 7772 |
| 239 | Ga0450920_005486 | 3300042122 | Bacteria | 2255 |
| 240 | Ga0450907_021614 | 3300042146 | Bacteria | 1083 |
| 241 | Ga0439434_0051787 | 3300042435 | Bacteria | 1273 |
| 242 | Ga0450918_000907 | 3300042531 | Bacteria | 6221 |
| 243 | Ga0466972_0030217 | 3300044658 | Bacteria | 2667 |
| 244 | Ga0466965_0033576 | 3300044683 | Bacteria | 2508 |
| 245 | Ga0466966_0020935 | 3300044684 | Bacteria | 4299 |
| 246 | Ga0466966_0041355 | 3300044684 | Bacteria | 2962 |
| 247 | Ga0466966_0043899 | 3300044684 | Bacteria | 2864 |
| 248 | Ga0466966_0103634 | 3300044684 | Bacteria | 1758 |
| 249 | Ga0466961_0009077 | 3300044693 | Bacteria | 6341 |
| 250 | Ga0466961_0025242 | 3300044693 | Bacteria | 3822 |
| 251 | Ga0466961_0072357 | 3300044693 | Bacteria | 2187 |
| 252 | Ga0466963_0039236 | 3300044694 | Bacteria | 3100 |
| 253 | Ga0466963_0073702 | 3300044694 | Bacteria | 2302 |
| 254 | Ga0466964_0008906 | 3300044706 | Bacteria | 3774 |
| 255 | Ga0466964_0017579 | 3300044706 | Bacteria | 2736 |
| 256 | Ga0466971_0019650 | 3300044719 | Bacteria | 3001 |
| 257 | Ga0466957_0009318 | 3300044842 | Bacteria | 5601 |
| 258 | Ga0466957_0038853 | 3300044842 | Bacteria | 2870 |
| 259 | Ga0466957_0066346 | 3300044842 | Bacteria | 2224 |
| 260 | Ga0466957_0203217 | 3300044842 | Bacteria | 1302 |
| 261 | Ga0466957_0236820 | 3300044842 | Bacteria | 1210 |
| 262 | Ga0466957_0317545 | 3300044842 | Bacteria | 1050 |
| 263 | Ga0466960_0032948 | 3300044901 | Bacteria | 2404 |
| 264 | Ga0466960_0103361 | 3300044901 | Bacteria | 1471 |
| 265 | Ga0466959_0054389 | 3300045049 | Bacteria | 2925 |
| 266 | Ga0466959_0094148 | 3300045049 | Bacteria | 2149 |
| 267 | Ga0466959_0130226 | 3300045049 | Bacteria | 1783 |
| 268 | Ga0466958_0033163 | 3300045836 | Bacteria | 3075 |
| 269 | Ga0466958_0178183 | 3300045836 | Bacteria | 1348 |
| 270 | Ga0466967_0000046 | 3300045976 | Bacteria | 43911 |
| 271 | Ga0466967_0000612 | 3300045976 | Bacteria | 17825 |
| 272 | Ga0466967_0005868 | 3300045976 | Bacteria | 8595 |
| 273 | Ga0466967_0009345 | 3300045976 | Bacteria | 7268 |
| 274 | Ga0466967_0044098 | 3300045976 | Bacteria | 3866 |
| 275 | Ga0466967_0061255 | 3300045976 | Bacteria | 3338 |
| 276 | Ga0466967_0153368 | 3300045976 | Bacteria | 2155 |
| 277 | Ga0466967_0572783 | 3300045976 | Bacteria | 1112 |
| 278 | Ga0495603_0024979 | 3300046455 | Bacteria | 3614 |
| 279 | Ga0495629_0004724 | 3300046459 | Bacteria | 10209 |
| 280 | Ga0495641_0020863 | 3300046461 | Bacteria | 3310 |
| 281 | Ga0495651_0128347 | 3300046462 | Bacteria | 1854 |
| 282 | Ga0495653_0009152 | 3300046463 | Bacteria | 8097 |
| 283 | Ga0495653_0022005 | 3300046463 | Bacteria | 5159 |
| 284 | Ga0495662_0009886 | 3300046476 | Bacteria | 4685 |
| 285 | Ga0495664_0006098 | 3300046477 | Bacteria | 6652 |
| 286 | Ga0495608_0013436 | 3300046511 | Bacteria | 5678 |
| 287 | Ga0495608_0019322 | 3300046511 | Bacteria | 4691 |
| 288 | Ga0495628_0032870 | 3300046516 | Bacteria | 4184 |
| 289 | Ga0495628_0085569 | 3300046516 | Bacteria | 2446 |
| 290 | Ga0495630_0053754 | 3300046517 | Bacteria | 3016 |
| 291 | Ga0495643_0059295 | 3300046522 | Bacteria | 2035 |
| 292 | Ga0495644_0051253 | 3300046523 | Bacteria | 1550 |
| 293 | Ga0495652_0000963 | 3300046529 | Bacteria | 32966 |
| 294 | Ga0495652_0139583 | 3300046529 | Bacteria | 1907 |
| 295 | Ga0495665_0004768 | 3300046531 | Bacteria | 7323 |
| 296 | Ga0495665_0009914 | 3300046531 | Bacteria | 5158 |
| 297 | Ga0495640_0036993 | 3300046533 | Bacteria | 3446 |
| 298 | Ga0495586_0001117 | 3300046535 | Bacteria | 15104 |
| 299 | Ga0495586_0005810 | 3300046535 | Bacteria | 6597 |
| 300 | Ga0495586_0074036 | 3300046535 | Bacteria | 1863 |
| 301 | Ga0495587_0001817 | 3300046536 | Bacteria | 14247 |
| 302 | Ga0495587_0017319 | 3300046536 | Bacteria | 4477 |
| 303 | Ga0495587_0028986 | 3300046536 | Bacteria | 3363 |
| 304 | Ga0495587_0038827 | 3300046536 | Bacteria | 2852 |
| 305 | Ga0495645_0010369 | 3300046543 | Bacteria | 6530 |
| 306 | Ga0495667_0004558 | 3300046559 | Bacteria | 9357 |
| 307 | Ga0495667_0114280 | 3300046559 | Bacteria | 1744 |
| 308 | Ga0495656_0119711 | 3300046615 | Bacteria | 1241 |
| 309 | Ga0495668_0001186 | 3300046616 | Bacteria | 26476 |
| 310 | Ga0495625_0000405 | 3300046660 | Bacteria | 65434 |
| 311 | Ga0495635_0013408 | 3300046663 | Bacteria | 5738 |
| 312 | Ga0495635_0056709 | 3300046663 | Bacteria | 2696 |
| 313 | Ga0495588_0050607 | 3300046674 | Bacteria | 2138 |
| 314 | Ga0495588_0084628 | 3300046674 | Bacteria | 1657 |
| 315 | Ga0495657_0001607 | 3300046675 | Bacteria | 19422 |
| 316 | Ga0495657_0088487 | 3300046675 | Bacteria | 1991 |
| 317 | Ga0495657_0227745 | 3300046675 | Bacteria | 1128 |
| 318 | Ga0495599_0064303 | 3300046678 | Bacteria | 2292 |
| 319 | Ga0495623_0075488 | 3300046679 | Bacteria | 2093 |
| 320 | Ga0495646_0168007 | 3300046680 | Bacteria | 1210 |
| 321 | Ga0495613_0317023 | 3300046689 | Bacteria | 1077 |
| 322 | Ga0495600_0037813 | 3300046809 | Bacteria | 3139 |
| 323 | Ga0495581_0002683 | 3300047315 | Bacteria | 10124 |
| 324 | Ga0495581_0020363 | 3300047315 | Bacteria | 3850 |
| 325 | Ga0495581_0086250 | 3300047315 | Bacteria | 1820 |
| 326 | Ga0495604_0059748 | 3300047317 | Bacteria | 2921 |
| 327 | Ga0495604_0074833 | 3300047317 | Bacteria | 2551 |
| 328 | Ga0495636_0027125 | 3300047318 | Bacteria | 2333 |
| 329 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 330 | Ga0495674_0061276 | 3300047319 | Bacteria | 3280 |
| 331 | Ga0495680_0031417 | 3300047322 | Bacteria | 4323 |
| 332 | Ga0495675_0058871 | 3300047444 | Bacteria | 2436 |
| 333 | Ga0495685_050541 | 3300047447 | Bacteria | 1411 |
| 334 | Ga0495681_0092848 | 3300047470 | Bacteria | 1330 |
| 335 | Ga0495602_0032497 | 3300048088 | Bacteria | 4911 |
| 336 | Ga0495602_0034084 | 3300048088 | Bacteria | 4768 |
| 337 | Ga0496100_0002534 | 3300048903 | Bacteria | 9310 |
| 338 | Ga0496100_0082682 | 3300048903 | Bacteria | 2172 |
| 339 | Ga0496100_0264148 | 3300048903 | Bacteria | 1277 |
| 340 | Ga0496101_0067947 | 3300048904 | Bacteria | 2604 |
| 341 | Ga0496101_0106070 | 3300048904 | Bacteria | 2109 |
| 342 | Ga0496101_0234649 | 3300048904 | Bacteria | 1426 |
| 343 | Ga0496102_0016228 | 3300048905 | Bacteria | 6508 |
| 344 | Ga0496102_0078635 | 3300048905 | Bacteria | 3036 |
| 345 | Ga0496102_0103738 | 3300048905 | Bacteria | 2644 |
| 346 | Ga0496102_0622148 | 3300048905 | Bacteria | 1003 |
| 347 | Ga0496103_0006871 | 3300048906 | Bacteria | 6795 |
| 348 | Ga0496103_0074188 | 3300048906 | Bacteria | 2132 |
| 349 | Ga0496103_0095568 | 3300048906 | Bacteria | 1877 |
| 350 | Ga0496103_0162656 | 3300048906 | Bacteria | 1432 |
| 351 | Ga0496103_0193503 | 3300048906 | Bacteria | 1307 |
| 352 | Ga0496103_0212618 | 3300048906 | Bacteria | 1244 |
| 353 | Ga0496104_0011647 | 3300048907 | Bacteria | 7883 |
| 354 | Ga0496104_0081051 | 3300048907 | Bacteria | 3094 |
| 355 | Ga0496104_0082565 | 3300048907 | Bacteria | 3064 |
| 356 | Ga0496104_0100173 | 3300048907 | Bacteria | 2773 |
| 357 | Ga0496104_0126230 | 3300048907 | Bacteria | 2457 |
| 358 | Ga0496104_0352886 | 3300048907 | Bacteria | 1383 |
| 359 | Ga0496104_0473952 | 3300048907 | Bacteria | 1163 |
| 360 | Ga0496104_0616458 | 3300048907 | Bacteria | 995 |
| 361 | Ga0496105_0001910 | 3300048908 | Bacteria | 14963 |
| 362 | Ga0496105_0010789 | 3300048908 | Bacteria | 7195 |
| 363 | Ga0496105_0011313 | 3300048908 | Bacteria | 7046 |
| 364 | Ga0496105_0012678 | 3300048908 | Bacteria | 6676 |
| 365 | Ga0496106_0066818 | 3300048909 | Bacteria | 2739 |
| 366 | Ga0496107_0066381 | 3300048910 | Bacteria | 2616 |
| 367 | Ga0496107_0089133 | 3300048910 | Bacteria | 2252 |
| 368 | Ga0496107_0099363 | 3300048910 | Bacteria | 2132 |
| 369 | Ga0496107_0101513 | 3300048910 | Bacteria | 2109 |
| 370 | Ga0496108_0060794 | 3300048911 | Bacteria | 3179 |
| 371 | Ga0496108_0284587 | 3300048911 | Bacteria | 1439 |
| 372 | Ga0496109_0065082 | 3300048912 | Bacteria | 3337 |
| 373 | Ga0496109_0090027 | 3300048912 | Bacteria | 2837 |
| 374 | Ga0496109_0142977 | 3300048912 | Bacteria | 2237 |
| 375 | Ga0496109_0143866 | 3300048912 | Bacteria | 2230 |
| 376 | Ga0496109_0172745 | 3300048912 | Bacteria | 2028 |
| 377 | Ga0496109_0446707 | 3300048912 | Bacteria | 1221 |
| 378 | Ga0496110_0000033 | 3300048913 | Bacteria | 65539 |
| 379 | Ga0496110_0019534 | 3300048913 | Bacteria | 5704 |
| 380 | Ga0496110_0034154 | 3300048913 | Bacteria | 4404 |
| 381 | Ga0496110_0065488 | 3300048913 | Bacteria | 3212 |
| 382 | Ga0496110_0094192 | 3300048913 | Bacteria | 2681 |
| 383 | Ga0496110_0106804 | 3300048913 | Bacteria | 2512 |
| 384 | Ga0496110_0150154 | 3300048913 | Bacteria | 2109 |
| 385 | Ga0496110_0220100 | 3300048913 | Bacteria | 1726 |
| 386 | Ga0496111_0000125 | 3300048914 | Bacteria | 33642 |
| 387 | Ga0496111_0010066 | 3300048914 | Bacteria | 6327 |
| 388 | Ga0496111_0037221 | 3300048914 | Bacteria | 3482 |
| 389 | Ga0496111_0049676 | 3300048914 | Bacteria | 3025 |
| 390 | Ga0496111_0052692 | 3300048914 | Bacteria | 2938 |
| 391 | Ga0496111_0082037 | 3300048914 | Bacteria | 2354 |
| 392 | Ga0496111_0109015 | 3300048914 | Bacteria | 2038 |
| 393 | Ga0496111_0125473 | 3300048914 | Bacteria | 1897 |
| 394 | Ga0496112_0008431 | 3300048915 | Bacteria | 9230 |
| 395 | Ga0496112_0010109 | 3300048915 | Bacteria | 8544 |
| 396 | Ga0496112_0028414 | 3300048915 | Bacteria | 5398 |
| 397 | Ga0496112_0045827 | 3300048915 | Bacteria | 4286 |
| 398 | Ga0496113_0037714 | 3300048916 | Bacteria | 3549 |
| 399 | Ga0496113_0194175 | 3300048916 | Bacteria | 1612 |
| 400 | Ga0496113_0415677 | 3300048916 | Bacteria | 1080 |
| 401 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 402 | Ga0496114_0015629 | 3300048917 | Bacteria | 6104 |
| 403 | Ga0496114_0043091 | 3300048917 | Bacteria | 3742 |
| 404 | Ga0496114_0095133 | 3300048917 | Bacteria | 2534 |
| 405 | Ga0496114_0516034 | 3300048917 | Bacteria | 1057 |
| 406 | Ga0496115_0000255 | 3300048918 | Bacteria | 47200 |
| 407 | Ga0496116_0004412 | 3300048919 | Bacteria | 13448 |
| 408 | Ga0496117_0013864 | 3300048920 | Bacteria | 6990 |
| 409 | Ga0496118_0004985 | 3300048921 | Bacteria | 15350 |
| 410 | Ga0496118_0033975 | 3300048921 | Bacteria | 4172 |
| 411 | Ga0496118_0055942 | 3300048921 | Bacteria | 2971 |
| 412 | Ga0496119_0001069 | 3300048922 | Bacteria | 34780 |
| 413 | Ga0496119_0004707 | 3300048922 | Bacteria | 13419 |
| 414 | Ga0496119_0027032 | 3300048922 | Bacteria | 3959 |
| 415 | Ga0496120_0000954 | 3300048923 | Bacteria | 39412 |
| 416 | Ga0496120_0012901 | 3300048923 | Bacteria | 5656 |
| 417 | Ga0496121_0001544 | 3300048924 | Bacteria | 38548 |
| 418 | Ga0496121_0011110 | 3300048924 | Bacteria | 10049 |
| 419 | Ga0496124_0022784 | 3300048927 | Bacteria | 5734 |
| 420 | Ga0496124_0318505 | 3300048927 | Bacteria | 1115 |
| 421 | Ga0496125_0050035 | 3300048928 | Bacteria | 3465 |
| 422 | Ga0496126_0004638 | 3300048929 | Bacteria | 16263 |
| 423 | Ga0496126_0042775 | 3300048929 | Bacteria | 4182 |
| 424 | Ga0501031_0010455 | 3300049568 | Bacteria | 6044 |
| 425 | Ga0501032_0003416 | 3300049569 | Bacteria | 12159 |
| 426 | Ga0501032_0013510 | 3300049569 | Bacteria | 5805 |
| 427 | Ga0501033_0001230 | 3300049570 | Bacteria | 22966 |
| 428 | Ga0501034_0000488 | 3300049571 | Bacteria | 64385 |
| 429 | Ga0501034_0007155 | 3300049571 | Bacteria | 11908 |
| 430 | Ga0501036_0015200 | 3300049572 | Bacteria | 6426 |
| 431 | Ga0501036_0033895 | 3300049572 | Bacteria | 4319 |
| 432 | Ga0501037_0003173 | 3300049573 | Bacteria | 11932 |
| 433 | Ga0501037_0060828 | 3300049573 | Bacteria | 2755 |
| 434 | Ga0501038_0011896 | 3300049574 | Bacteria | 7942 |
| 435 | Ga0501038_0019496 | 3300049574 | Bacteria | 6112 |
| 436 | Ga0501038_0027134 | 3300049574 | Bacteria | 5097 |
| 437 | Ga0501038_0251056 | 3300049574 | Bacteria | 1401 |
| 438 | Ga0501039_0034021 | 3300049575 | Bacteria | 3932 |
| 439 | Ga0501040_0029679 | 3300049576 | Bacteria | 3693 |
| 440 | Ga0501042_0047764 | 3300049578 | Bacteria | 3052 |
| 441 | Ga0501043_0003943 | 3300049579 | Bacteria | 12172 |
| 442 | Ga0501043_0015464 | 3300049579 | Bacteria | 5977 |
| 443 | Ga0501043_0271003 | 3300049579 | Bacteria | 1303 |
| 444 | Ga0501046_0005091 | 3300049580 | Bacteria | 11789 |
| 445 | Ga0501047_0003010 | 3300049581 | Bacteria | 15995 |
| 446 | Ga0501047_0004573 | 3300049581 | Bacteria | 13013 |
| 447 | Ga0501047_0157361 | 3300049581 | Bacteria | 2145 |
| 448 | Ga0501047_0187966 | 3300049581 | Bacteria | 1930 |
| 449 | Ga0501048_0013723 | 3300049582 | Bacteria | 6011 |
| 450 | Ga0501067_0159944 | 3300049583 | Bacteria | 1254 |
| 451 | Ga0501068_0016389 | 3300049584 | Bacteria | 4272 |
| 452 | Ga0501069_0018808 | 3300049585 | Bacteria | 3730 |
| 453 | Ga0501070_0001442 | 3300049586 | Bacteria | 21250 |
| 454 | Ga0501070_0009904 | 3300049586 | Bacteria | 8056 |
| 455 | Ga0501073_0004815 | 3300049589 | Bacteria | 10129 |
| 456 | Ga0501074_0262451 | 3300049590 | Bacteria | 1228 |
| 457 | Ga0501079_0022506 | 3300049741 | Bacteria | 4833 |
| 458 | Ga0501080_0015178 | 3300049742 | Bacteria | 7097 |
| 459 | Ga0501080_0027273 | 3300049742 | Bacteria | 5312 |
| 460 | Ga0501083_0013347 | 3300049744 | Bacteria | 5744 |
| 461 | Ga0501083_0015680 | 3300049744 | Bacteria | 5304 |
| 462 | Ga0501035_0006942 | 3300049822 | Bacteria | 10578 |
| 463 | Ga0501035_0038818 | 3300049822 | Bacteria | 4310 |
| 464 | Ga0501044_0003363 | 3300049823 | Bacteria | 18035 |
| 465 | Ga0501044_0007886 | 3300049823 | Bacteria | 11703 |
| 466 | Ga0501044_0103282 | 3300049823 | Bacteria | 2865 |
| 467 | Ga0501044_0149191 | 3300049823 | Bacteria | 2321 |
| 468 | Ga0501044_0264730 | 3300049823 | Bacteria | 1657 |
| 469 | Ga0501045_0135018 | 3300049824 | Bacteria | 1834 |
| 470 | nmdc:mga00v17_111408_c1 | 3300050491 | Bacteria | 1736 |
| 471 | nmdc:mga07m45_56218_c1 | 3300050496 | Bacteria | 2224 |
| 472 | nmdc:mga09592_5164_c1 | 3300050508 | Bacteria | 10606 |
| 473 | nmdc:mga08y16_10921_c1 | 3300050511 | Bacteria | 9538 |
| 474 | nmdc:mga08x19_62034_c1 | 3300050514 | Bacteria | 2423 |
| 475 | nmdc:mga0a205_86829_c1 | 3300050515 | Bacteria | 3022 |
| 476 | Ga0495601_0089996 | 3300053077 | Bacteria | 1974 |
| 477 | Ga0495655_0032815 | 3300053083 | Bacteria | 1274 |
| 478 | Ga0495595_0001728 | 3300053084 | Bacteria | 8542 |
| 479 | Ga0495619_0000022 | 3300053085 | Bacteria | 184144 |
| 480 | Ga0495619_0008692 | 3300053085 | Bacteria | 6423 |
| 481 | Ga0495619_0025018 | 3300053085 | Bacteria | 3831 |
| 482 | Ga0500641_0014422 | 3300053096 | Bacteria | 2917 |
| 483 | Ga0500556_0000644 | 3300053104 | Bacteria | 21874 |
| 484 | Ga0500568_0000032 | 3300053139 | Bacteria | 147655 |
| 485 | Ga0500590_051967 | 3300053148 | Bacteria | 2081 |
| 486 | Ga0500599_002653 | 3300053736 | Bacteria | 2157 |
| 487 | Ga0501082_0074467 | 3300060353 | Bacteria | 2924 |
| 488 | Ga0466962_0005187 | 3300061719 | Bacteria | 6270 |
| 489 | Ga0466962_0146809 | 3300061719 | Bacteria | 1144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0317023 | Ga0495613_0317023_16_795 | 251 |
| 2 | 3300048917 | Ga0496114_0516034 | Ga0496114_0516034_14_805 | 255 |
| 3 | 3300048907 | Ga0496104_0473952 | Ga0496104_0473952_315_1145 | 270 |
| 4 | 3300048907 | Ga0496104_0100173 | Ga0496104_0100173_310_1167 | 277 |
| 5 | 3300049571 | Ga0501034_0007155 | Ga0501034_0007155_3433_4299 | 279 |
| 6 | 3300049572 | Ga0501036_0033895 | Ga0501036_0033895_2885_3751 | 279 |
| 7 | 3300049574 | Ga0501038_0011896 | Ga0501038_0011896_2465_3331 | 279 |
| 8 | 3300049581 | Ga0501047_0004573 | Ga0501047_0004573_6974_7840 | 279 |
| 9 | 3300049822 | Ga0501035_0006942 | Ga0501035_0006942_2739_3605 | 279 |
| 10 | 3300049823 | Ga0501044_0007886 | Ga0501044_0007886_727_1593 | 279 |
| 11 | 3300031665 | Ga0316575_10057679 | Ga0316575_100576792 | 284 |
| 12 | 3300031727 | Ga0316576_10054072 | Ga0316576_100540722 | 284 |
| 13 | 3300031728 | Ga0316578_10104212 | Ga0316578_101042122 | 284 |
| 14 | 3300031733 | Ga0316577_10064343 | Ga0316577_100643431 | 284 |
| 15 | 3300035398 | Ga0316574_0005931 | Ga0316574_0005931_366_1334 | 284 |
| 16 | 3300036712 | Ga0316584_0007562 | Ga0316584_0007562_632_1600 | 284 |
| 17 | 3300009147 | Ga0114129_10429267 | Ga0114129_104292672 | 286 |
| 18 | 3300038443 | Ga0395901_0256804 | Ga0395901_0256804_33_911 | 286 |
| 19 | 3300044684 | Ga0466966_0103634 | Ga0466966_0103634_425_1309 | 286 |
| 20 | 3300048903 | Ga0496100_0264148 | Ga0496100_0264148_249_1142 | 287 |
| 21 | 3300025893 | Ga0207682_10009340 | Ga0207682_100093402 | 288 |
| 22 | 3300042146 | Ga0450907_021614 | Ga0450907_021614_15_968 | 289 |
| 23 | 3300049579 | Ga0501043_0271003 | Ga0501043_0271003_331_1269 | 291 |
| 24 | 3300005435 | Ga0070714_100078053 | Ga0070714_1000780532 | 292 |
| 25 | 3300006028 | Ga0070717_10038018 | Ga0070717_100380184 | 292 |
| 26 | 3300025928 | Ga0207700_10078482 | Ga0207700_100784822 | 292 |
| 27 | 3300049574 | Ga0501038_0027134 | Ga0501038_0027134_686_1657 | 294 |
| 28 | 3300049579 | Ga0501043_0003943 | Ga0501043_0003943_2293_3264 | 294 |
| 29 | 3300044693 | Ga0466961_0025242 | Ga0466961_0025242_362_1360 | 295 |
| 30 | 3300026023 | Ga0207677_10002503 | Ga0207677_100025033 | 296 |
| 31 | 3300049568 | Ga0501031_0010455 | Ga0501031_0010455_1599_2552 | 296 |
| 32 | 3300049569 | Ga0501032_0013510 | Ga0501032_0013510_1379_2332 | 296 |
| 33 | 3300049570 | Ga0501033_0001230 | Ga0501033_0001230_17942_18895 | 296 |
| 34 | 3300049572 | Ga0501036_0015200 | Ga0501036_0015200_1404_2357 | 296 |
| 35 | 3300049573 | Ga0501037_0003173 | Ga0501037_0003173_9379_10332 | 296 |
| 36 | 3300049574 | Ga0501038_0019496 | Ga0501038_0019496_3466_4419 | 296 |
| 37 | 3300049575 | Ga0501039_0034021 | Ga0501039_0034021_796_1749 | 296 |
| 38 | 3300049576 | Ga0501040_0029679 | Ga0501040_0029679_1524_2477 | 296 |
| 39 | 3300049578 | Ga0501042_0047764 | Ga0501042_0047764_1396_2349 | 296 |
| 40 | 3300049579 | Ga0501043_0015464 | Ga0501043_0015464_1523_2476 | 296 |
| 41 | 3300049580 | Ga0501046_0005091 | Ga0501046_0005091_1434_2387 | 296 |
| 42 | 3300049581 | Ga0501047_0003010 | Ga0501047_0003010_13458_14411 | 296 |
| 43 | 3300049582 | Ga0501048_0013723 | Ga0501048_0013723_3496_4449 | 296 |
| 44 | 3300049583 | Ga0501067_0159944 | Ga0501067_0159944_109_1062 | 296 |
| 45 | 3300049584 | Ga0501068_0016389 | Ga0501068_0016389_756_1709 | 296 |
| 46 | 3300049585 | Ga0501069_0018808 | Ga0501069_0018808_1119_2072 | 296 |
| 47 | 3300049586 | Ga0501070_0001442 | Ga0501070_0001442_9202_10155 | 296 |
| 48 | 3300049589 | Ga0501073_0004815 | Ga0501073_0004815_1345_2298 | 296 |
| 49 | 3300049741 | Ga0501079_0022506 | Ga0501079_0022506_1270_2223 | 296 |
| 50 | 3300049742 | Ga0501080_0027273 | Ga0501080_0027273_3384_4337 | 296 |
| 51 | 3300049744 | Ga0501083_0013347 | Ga0501083_0013347_1287_2240 | 296 |
| 52 | 3300049822 | Ga0501035_0038818 | Ga0501035_0038818_776_1729 | 296 |
| 53 | 3300049823 | Ga0501044_0003363 | Ga0501044_0003363_1592_2545 | 296 |
| 54 | 3300049824 | Ga0501045_0135018 | Ga0501045_0135018_676_1629 | 296 |
| 55 | 3300053104 | Ga0500556_0000644 | Ga0500556_0000644_11748_12665 | 296 |
| 56 | 3300053736 | Ga0500599_002653 | Ga0500599_002653_959_1876 | 296 |
| 57 | 3300060353 | Ga0501082_0074467 | Ga0501082_0074467_699_1652 | 296 |
| 58 | 3300006038 | Ga0075365_10242647 | Ga0075365_102426472 | 298 |
| 59 | 3300028379 | Ga0268266_10055236 | Ga0268266_100552362 | 298 |
| 60 | 3300031711 | Ga0265314_10196952 | Ga0265314_101969522 | 298 |
| 61 | 3300046559 | Ga0495667_0114280 | Ga0495667_0114280_800_1726 | 298 |
| 62 | 3300048915 | Ga0496112_0045827 | Ga0496112_0045827_325_1245 | 298 |
| 63 | 3300049742 | Ga0501080_0015178 | Ga0501080_0015178_3660_4583 | 298 |
| 64 | 3300005335 | Ga0070666_10038337 | Ga0070666_100383373 | 299 |
| 65 | 3300005367 | Ga0070667_100128201 | Ga0070667_1001282014 | 299 |
| 66 | 3300005548 | Ga0070665_100051052 | Ga0070665_1000510524 | 299 |
| 67 | 3300006038 | Ga0075365_10050547 | Ga0075365_100505472 | 299 |
| 68 | 3300006844 | Ga0075428_100302719 | Ga0075428_1003027192 | 299 |
| 69 | 3300006852 | Ga0075433_10010907 | Ga0075433_100109076 | 299 |
| 70 | 3300006871 | Ga0075434_100021060 | Ga0075434_1000210606 | 299 |
| 71 | 3300006914 | Ga0075436_100059614 | Ga0075436_1000596143 | 299 |
| 72 | 3300009094 | Ga0111539_10047017 | Ga0111539_100470174 | 299 |
| 73 | 3300013306 | Ga0163162_10196397 | Ga0163162_101963972 | 299 |
| 74 | 3300025903 | Ga0207680_10005659 | Ga0207680_100056594 | 299 |
| 75 | 3300025986 | Ga0207658_10033339 | Ga0207658_100333394 | 299 |
| 76 | 3300028379 | Ga0268266_10000247 | Ga0268266_1000024772 | 299 |
| 77 | 3300037466 | Ga0395898_0004605 | Ga0395898_0004605_3117_4043 | 299 |
| 78 | 3300037466 | Ga0395898_0267589 | Ga0395898_0267589_579_1505 | 299 |
| 79 | 3300037471 | Ga0395905_0210047 | Ga0395905_0210047_473_1399 | 299 |
| 80 | 3300038443 | Ga0395901_0003181 | Ga0395901_0003181_5500_6426 | 299 |
| 81 | 3300048904 | Ga0496101_0067947 | Ga0496101_0067947_1380_2306 | 299 |
| 82 | 3300048907 | Ga0496104_0011647 | Ga0496104_0011647_2923_3849 | 299 |
| 83 | 3300048907 | Ga0496104_0616458 | Ga0496104_0616458_54_980 | 299 |
| 84 | 3300048908 | Ga0496105_0001910 | Ga0496105_0001910_3494_4420 | 299 |
| 85 | 3300048912 | Ga0496109_0090027 | Ga0496109_0090027_113_1039 | 299 |
| 86 | 3300048912 | Ga0496109_0446707 | Ga0496109_0446707_165_1091 | 299 |
| 87 | 3300048915 | Ga0496112_0010109 | Ga0496112_0010109_3484_4410 | 299 |
| 88 | 3300048915 | Ga0496112_0028414 | Ga0496112_0028414_2961_3887 | 299 |
| 89 | 3300049581 | Ga0501047_0157361 | Ga0501047_0157361_556_1509 | 299 |
| 90 | 3300049823 | Ga0501044_0103282 | Ga0501044_0103282_890_1843 | 299 |
| 91 | 3300050511 | nmdc:mga08y16_10921_c1 | nmdc:mga08y16_10921_c1_5288_6214 | 299 |
| 92 | 3300050514 | nmdc:mga08x19_62034_c1 | nmdc:mga08x19_62034_c1_780_1706 | 299 |
| 93 | 3300050515 | nmdc:mga0a205_86829_c1 | nmdc:mga0a205_86829_c1_911_1837 | 299 |
| 94 | 3300005329 | Ga0070683_100155886 | Ga0070683_1001558861 | 300 |
| 95 | 3300005455 | Ga0070663_100000859 | Ga0070663_1000008594 | 300 |
| 96 | 3300005530 | Ga0070679_100037721 | Ga0070679_1000377213 | 300 |
| 97 | 3300006051 | Ga0075364_10093978 | Ga0075364_100939782 | 300 |
| 98 | 3300025921 | Ga0207652_10000307 | Ga0207652_1000030734 | 300 |
| 99 | 3300025944 | Ga0207661_10028785 | Ga0207661_100287852 | 300 |
| 100 | 3300026067 | Ga0207678_10008282 | Ga0207678_100082823 | 300 |
| 101 | 3300050491 | nmdc:mga00v17_111408_c1 | nmdc:mga00v17_111408_c1_311_1243 | 300 |
| 102 | 3300044901 | Ga0466960_0103361 | Ga0466960_0103361_517_1440 | 301 |
| 103 | 3300046523 | Ga0495644_0051253 | Ga0495644_0051253_428_1360 | 301 |
| 104 | 3300053083 | Ga0495655_0032815 | Ga0495655_0032815_76_1011 | 301 |
| 105 | 3300005616 | Ga0068852_100039173 | Ga0068852_1000391733 | 302 |
| 106 | 3300026142 | Ga0207698_10004988 | Ga0207698_100049885 | 302 |
| 107 | 3300048907 | Ga0496104_0126230 | Ga0496104_0126230_203_1129 | 302 |
| 108 | 3300048911 | Ga0496108_0284587 | Ga0496108_0284587_275_1201 | 302 |
| 109 | 3300048914 | Ga0496111_0049676 | Ga0496111_0049676_568_1494 | 302 |
| 110 | 3300048914 | Ga0496111_0109015 | Ga0496111_0109015_703_1647 | 302 |
| 111 | 3300048916 | Ga0496113_0415677 | Ga0496113_0415677_43_969 | 302 |
| 112 | 3300048924 | Ga0496121_0001544 | Ga0496121_0001544_18708_19655 | 302 |
| 113 | 3300048927 | Ga0496124_0318505 | Ga0496124_0318505_157_1101 | 302 |
| 114 | 3300053148 | Ga0500590_051967 | Ga0500590_051967_837_1772 | 302 |
| 115 | iso_pu_bacteria | 2643221617 | 2644102111 | 302 |
| 116 | iso_pu_bacteria | 2643221620 | 2644115334 | 302 |
| 117 | iso_pu_bacteria | 2738541305 | 2738870294 | 302 |
| 118 | iso_pu_bacteria | 2974315732 | 2974316489 | 302 |
| 119 | 3300005347 | Ga0070668_100244320 | Ga0070668_1002443202 | 303 |
| 120 | 3300005435 | Ga0070714_100037632 | Ga0070714_1000376323 | 303 |
| 121 | 3300005436 | Ga0070713_100050180 | Ga0070713_1000501802 | 303 |
| 122 | 3300005436 | Ga0070713_100140360 | Ga0070713_1001403602 | 303 |
| 123 | 3300005614 | Ga0068856_100149750 | Ga0068856_1001497502 | 303 |
| 124 | 3300009098 | Ga0105245_10127864 | Ga0105245_101278642 | 303 |
| 125 | 3300025898 | Ga0207692_10019244 | Ga0207692_100192444 | 303 |
| 126 | 3300025927 | Ga0207687_10096326 | Ga0207687_100963262 | 303 |
| 127 | 3300025928 | Ga0207700_10068410 | Ga0207700_100684102 | 303 |
| 128 | 3300025928 | Ga0207700_10086654 | Ga0207700_100866542 | 303 |
| 129 | 3300025929 | Ga0207664_10070326 | Ga0207664_100703262 | 303 |
| 130 | 3300025929 | Ga0207664_10071978 | Ga0207664_100719784 | 303 |
| 131 | 3300026118 | Ga0207675_100120076 | Ga0207675_1001200761 | 303 |
| 132 | 3300035172 | Ga0373955_0035028 | Ga0373955_0035028_1657_2607 | 303 |
| 133 | 3300035724 | Ga0373933_0048202 | Ga0373933_0048202_1147_2097 | 303 |
| 134 | 3300036401 | Ga0373937_0179742 | Ga0373937_0179742_773_1723 | 303 |
| 135 | 3300046455 | Ga0495603_0024979 | Ga0495603_0024979_515_1456 | 303 |
| 136 | 3300046459 | Ga0495629_0004724 | Ga0495629_0004724_5281_6219 | 303 |
| 137 | 3300046461 | Ga0495641_0020863 | Ga0495641_0020863_1392_2333 | 303 |
| 138 | 3300046463 | Ga0495653_0022005 | Ga0495653_0022005_4070_5020 | 303 |
| 139 | 3300046511 | Ga0495608_0013436 | Ga0495608_0013436_1306_2256 | 303 |
| 140 | 3300046516 | Ga0495628_0032870 | Ga0495628_0032870_378_1328 | 303 |
| 141 | 3300046529 | Ga0495652_0139583 | Ga0495652_0139583_493_1443 | 303 |
| 142 | 3300046536 | Ga0495587_0038827 | Ga0495587_0038827_1407_2357 | 303 |
| 143 | 3300046615 | Ga0495656_0119711 | Ga0495656_0119711_194_1135 | 303 |
| 144 | 3300046660 | Ga0495625_0000405 | Ga0495625_0000405_4672_5616 | 303 |
| 145 | 3300046663 | Ga0495635_0056709 | Ga0495635_0056709_1249_2199 | 303 |
| 146 | 3300046675 | Ga0495657_0227745 | Ga0495657_0227745_91_1041 | 303 |
| 147 | 3300046678 | Ga0495599_0064303 | Ga0495599_0064303_309_1259 | 303 |
| 148 | 3300046680 | Ga0495646_0168007 | Ga0495646_0168007_103_1053 | 303 |
| 149 | 3300047317 | Ga0495604_0059748 | Ga0495604_0059748_1767_2717 | 303 |
| 150 | 3300047319 | Ga0495674_0061276 | Ga0495674_0061276_307_1257 | 303 |
| 151 | 3300048088 | Ga0495602_0032497 | Ga0495602_0032497_2069_3019 | 303 |
| 152 | 3300048907 | Ga0496104_0082565 | Ga0496104_0082565_1681_2631 | 303 |
| 153 | 3300048908 | Ga0496105_0011313 | Ga0496105_0011313_2509_3459 | 303 |
| 154 | 3300048912 | Ga0496109_0143866 | Ga0496109_0143866_749_1699 | 303 |
| 155 | 3300048913 | Ga0496110_0094192 | Ga0496110_0094192_1523_2464 | 303 |
| 156 | 3300048914 | Ga0496111_0082037 | Ga0496111_0082037_1173_2114 | 303 |
| 157 | 3300048915 | Ga0496112_0008431 | Ga0496112_0008431_3902_4852 | 303 |
| 158 | 3300053077 | Ga0495601_0089996 | Ga0495601_0089996_325_1275 | 303 |
| 159 | 3300053084 | Ga0495595_0001728 | Ga0495595_0001728_83_1033 | 303 |
| 160 | 3300053085 | Ga0495619_0008692 | Ga0495619_0008692_2730_3680 | 303 |
| 161 | 3300005841 | Ga0068863_100063307 | Ga0068863_1000633075 | 304 |
| 162 | 3300005983 | Ga0081540_1000129 | Ga0081540_10001296 | 304 |
| 163 | 3300014745 | Ga0157377_10105179 | Ga0157377_101051792 | 304 |
| 164 | 3300025932 | Ga0207690_10140296 | Ga0207690_101402963 | 304 |
| 165 | 3300025935 | Ga0207709_10091230 | Ga0207709_100912303 | 304 |
| 166 | 3300026088 | Ga0207641_10452932 | Ga0207641_104529321 | 304 |
| 167 | 3300044684 | Ga0466966_0041355 | Ga0466966_0041355_1484_2437 | 304 |
| 168 | 3300044706 | Ga0466964_0008906 | Ga0466964_0008906_668_1603 | 304 |
| 169 | 3300045976 | Ga0466967_0153368 | Ga0466967_0153368_816_1751 | 304 |
| 170 | 3300046529 | Ga0495652_0000963 | Ga0495652_0000963_30229_31170 | 304 |
| 171 | 3300046533 | Ga0495640_0036993 | Ga0495640_0036993_1008_1949 | 304 |
| 172 | 3300046536 | Ga0495587_0017319 | Ga0495587_0017319_438_1427 | 304 |
| 173 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_239587_240528 | 304 |
| 174 | 3300048916 | Ga0496113_0037714 | Ga0496113_0037714_2061_3029 | 304 |
| 175 | 3300053096 | Ga0500641_0014422 | Ga0500641_0014422_1675_2616 | 304 |
| 176 | 3300053139 | Ga0500568_0000032 | Ga0500568_0000032_2491_3462 | 304 |
| 177 | 3300061719 | Ga0466962_0005187 | Ga0466962_0005187_3557_4492 | 304 |
| 178 | 3300061719 | Ga0466962_0146809 | Ga0466962_0146809_171_1106 | 304 |
| 179 | iso_pu_bacteria | 2643221711 | 2644607547 | 304 |
| 180 | iso_pu_bacteria | 2811994882 | 2812373694 | 304 |
| 181 | iso_pu_bacteria | 2818991318 | 2819426307 | 304 |
| 182 | iso_pu_bacteria | 2818991462 | 2819691446 | 304 |
| 183 | iso_pu_bacteria | 2818991469 | 2819727517 | 304 |
| 184 | 3300005353 | Ga0070669_100008474 | Ga0070669_1000084748 | 305 |
| 185 | 3300005841 | Ga0068863_100468378 | Ga0068863_1004683781 | 305 |
| 186 | 3300014497 | Ga0182008_10081392 | Ga0182008_100813921 | 305 |
| 187 | 3300025923 | Ga0207681_10006222 | Ga0207681_100062222 | 305 |
| 188 | 3300044684 | Ga0466966_0043899 | Ga0466966_0043899_1130_2080 | 305 |
| 189 | 3300044901 | Ga0466960_0032948 | Ga0466960_0032948_494_1444 | 305 |
| 190 | 3300045976 | Ga0466967_0044098 | Ga0466967_0044098_2686_3636 | 305 |
| 191 | iso_pu_bacteria | 2565956761 | 2566992160 | 305 |
| 192 | iso_pu_bacteria | 2738541308 | 2738888348 | 305 |
| 193 | iso_pu_bacteria | 2904535858 | 2904538018 | 305 |
| 194 | iso_pu_bacteria | 2922554459 | 2922557201 | 305 |
| 195 | 3300005365 | Ga0070688_100005702 | Ga0070688_1000057026 | 306 |
| 196 | 3300005466 | Ga0070685_10000018 | Ga0070685_1000001889 | 306 |
| 197 | 3300005471 | Ga0070698_100014435 | Ga0070698_1000144353 | 306 |
| 198 | 3300014968 | Ga0157379_10084390 | Ga0157379_100843902 | 306 |
| 199 | 3300036401 | Ga0373937_0132777 | Ga0373937_0132777_1058_2020 | 306 |
| 200 | 3300045049 | Ga0466959_0130226 | Ga0466959_0130226_287_1246 | 306 |
| 201 | 3300046462 | Ga0495651_0128347 | Ga0495651_0128347_333_1295 | 306 |
| 202 | 3300046511 | Ga0495608_0019322 | Ga0495608_0019322_881_1843 | 306 |
| 203 | 3300046516 | Ga0495628_0085569 | Ga0495628_0085569_189_1151 | 306 |
| 204 | 3300046536 | Ga0495587_0028986 | Ga0495587_0028986_731_1693 | 306 |
| 205 | 3300046559 | Ga0495667_0004558 | Ga0495667_0004558_7749_8711 | 306 |
| 206 | 3300046675 | Ga0495657_0001607 | Ga0495657_0001607_2529_3491 | 306 |
| 207 | 3300046679 | Ga0495623_0075488 | Ga0495623_0075488_700_1662 | 306 |
| 208 | 3300046809 | Ga0495600_0037813 | Ga0495600_0037813_926_1888 | 306 |
| 209 | 3300047444 | Ga0495675_0058871 | Ga0495675_0058871_983_1945 | 306 |
| 210 | 3300048088 | Ga0495602_0034084 | Ga0495602_0034084_2010_2972 | 306 |
| 211 | 3300048922 | Ga0496119_0027032 | Ga0496119_0027032_656_1603 | 306 |
| 212 | 3300048923 | Ga0496120_0012901 | Ga0496120_0012901_2688_3641 | 306 |
| 213 | 3300048924 | Ga0496121_0011110 | Ga0496121_0011110_6428_7381 | 306 |
| 214 | 3300048929 | Ga0496126_0042775 | Ga0496126_0042775_1798_2748 | 306 |
| 215 | 3300049744 | Ga0501083_0015680 | Ga0501083_0015680_2455_3402 | 306 |
| 216 | 3300049823 | Ga0501044_0264730 | Ga0501044_0264730_498_1445 | 306 |
| 217 | 3300053085 | Ga0495619_0025018 | Ga0495619_0025018_1299_2261 | 306 |
| 218 | 3300009551 | Ga0105238_10242197 | Ga0105238_102421972 | 307 |
| 219 | 3300014326 | Ga0157380_10001287 | Ga0157380_100012871 | 307 |
| 220 | 3300044842 | Ga0466957_0317545 | Ga0466957_0317545_15_977 | 307 |
| 221 | 3300048921 | Ga0496118_0055942 | Ga0496118_0055942_1601_2551 | 307 |
| 222 | 3300049586 | Ga0501070_0009904 | Ga0501070_0009904_2746_3702 | 307 |
| 223 | 3300013308 | Ga0157375_10051386 | Ga0157375_100513864 | 308 |
| 224 | 3300014969 | Ga0157376_10072535 | Ga0157376_100725352 | 308 |
| 225 | 3300031727 | Ga0316576_10198281 | Ga0316576_101982812 | 308 |
| 226 | 3300035398 | Ga0316574_0006035 | Ga0316574_0006035_191_1165 | 308 |
| 227 | 3300037466 | Ga0395898_0170274 | Ga0395898_0170274_566_1540 | 308 |
| 228 | 3300037471 | Ga0395905_0324355 | Ga0395905_0324355_399_1373 | 308 |
| 229 | 3300038443 | Ga0395901_0080928 | Ga0395901_0080928_780_1754 | 308 |
| 230 | 3300044842 | Ga0466957_0236820 | Ga0466957_0236820_67_1032 | 308 |
| 231 | 3300045836 | Ga0466958_0178183 | Ga0466958_0178183_54_1019 | 308 |
| 232 | 3300048903 | Ga0496100_0082682 | Ga0496100_0082682_1019_1981 | 308 |
| 233 | 3300048905 | Ga0496102_0016228 | Ga0496102_0016228_3098_4051 | 308 |
| 234 | 3300048905 | Ga0496102_0078635 | Ga0496102_0078635_1491_2453 | 308 |
| 235 | 3300048906 | Ga0496103_0074188 | Ga0496103_0074188_584_1546 | 308 |
| 236 | 3300048906 | Ga0496103_0162656 | Ga0496103_0162656_264_1220 | 308 |
| 237 | 3300048907 | Ga0496104_0081051 | Ga0496104_0081051_1678_2640 | 308 |
| 238 | 3300048908 | Ga0496105_0012678 | Ga0496105_0012678_3956_4918 | 308 |
| 239 | 3300048910 | Ga0496107_0099363 | Ga0496107_0099363_59_1021 | 308 |
| 240 | 3300048911 | Ga0496108_0060794 | Ga0496108_0060794_691_1635 | 308 |
| 241 | 3300048912 | Ga0496109_0172745 | Ga0496109_0172745_321_1283 | 308 |
| 242 | 3300048913 | Ga0496110_0034154 | Ga0496110_0034154_3087_4061 | 308 |
| 243 | 3300048913 | Ga0496110_0220100 | Ga0496110_0220100_506_1468 | 308 |
| 244 | 3300048914 | Ga0496111_0125473 | Ga0496111_0125473_321_1283 | 308 |
| 245 | 3300048916 | Ga0496113_0194175 | Ga0496113_0194175_202_1176 | 308 |
| 246 | 3300048917 | Ga0496114_0095133 | Ga0496114_0095133_425_1387 | 308 |
| 247 | 3300048920 | Ga0496117_0013864 | Ga0496117_0013864_3487_4440 | 308 |
| 248 | 3300048921 | Ga0496118_0004985 | Ga0496118_0004985_11846_12799 | 308 |
| 249 | 3300049590 | Ga0501074_0262451 | Ga0501074_0262451_40_975 | 308 |
| 250 | iso_pu_bacteria | 2945941187 | 2945944506 | 308 |
| 251 | 3300005435 | Ga0070714_100118612 | Ga0070714_1001186122 | 309 |
| 252 | 3300006048 | Ga0075363_100055329 | Ga0075363_1000553292 | 309 |
| 253 | 3300009101 | Ga0105247_10000649 | Ga0105247_1000064910 | 309 |
| 254 | 3300009177 | Ga0105248_10002486 | Ga0105248_100024864 | 309 |
| 255 | 3300014325 | Ga0163163_10029162 | Ga0163163_100291623 | 309 |
| 256 | 3300014968 | Ga0157379_10063437 | Ga0157379_100634372 | 309 |
| 257 | 3300017792 | Ga0163161_10098728 | Ga0163161_100987282 | 309 |
| 258 | 3300025900 | Ga0207710_10000426 | Ga0207710_1000042615 | 309 |
| 259 | 3300025929 | Ga0207664_10099587 | Ga0207664_100995873 | 309 |
| 260 | 3300025941 | Ga0207711_10003747 | Ga0207711_1000374712 | 309 |
| 261 | 3300039437 | Ga0436365_0724850 | Ga0436365_0724850_183_1163 | 309 |
| 262 | 3300046616 | Ga0495668_0001186 | Ga0495668_0001186_24305_25252 | 309 |
| 263 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_53405_54361 | 309 |
| 264 | 3300048918 | Ga0496115_0000255 | Ga0496115_0000255_25466_26422 | 309 |
| 265 | 3300048919 | Ga0496116_0004412 | Ga0496116_0004412_11212_12168 | 309 |
| 266 | 3300048921 | Ga0496118_0033975 | Ga0496118_0033975_2105_3061 | 309 |
| 267 | 3300048922 | Ga0496119_0001069 | Ga0496119_0001069_14227_15291 | 309 |
| 268 | 3300048922 | Ga0496119_0004707 | Ga0496119_0004707_1275_2231 | 309 |
| 269 | 3300048923 | Ga0496120_0000954 | Ga0496120_0000954_24113_25177 | 309 |
| 270 | 3300050496 | nmdc:mga07m45_56218_c1 | nmdc:mga07m45_56218_c1_771_1718 | 309 |
| 271 | 3300005340 | Ga0070689_100231213 | Ga0070689_1002312131 | 310 |
| 272 | 3300005365 | Ga0070688_100005975 | Ga0070688_1000059751 | 310 |
| 273 | 3300005466 | Ga0070685_10001560 | Ga0070685_100015603 | 310 |
| 274 | 3300005577 | Ga0068857_100089264 | Ga0068857_1000892642 | 310 |
| 275 | 3300009098 | Ga0105245_10011020 | Ga0105245_100110201 | 310 |
| 276 | 3300009148 | Ga0105243_10026965 | Ga0105243_100269652 | 310 |
| 277 | 3300009174 | Ga0105241_10028290 | Ga0105241_100282903 | 310 |
| 278 | 3300025927 | Ga0207687_10006313 | Ga0207687_100063138 | 310 |
| 279 | 3300025935 | Ga0207709_10012655 | Ga0207709_100126554 | 310 |
| 280 | 3300025936 | Ga0207670_10366002 | Ga0207670_103660021 | 310 |
| 281 | 3300026116 | Ga0207674_10089520 | Ga0207674_100895204 | 310 |
| 282 | 3300044842 | Ga0466957_0066346 | Ga0466957_0066346_619_1578 | 310 |
| 283 | 3300048913 | Ga0496110_0000033 | Ga0496110_0000033_37567_38526 | 310 |
| 284 | 3300048914 | Ga0496111_0000125 | Ga0496111_0000125_23901_24860 | 310 |
| 285 | 3300053085 | Ga0495619_0000022 | Ga0495619_0000022_151981_152940 | 310 |
| 286 | iso_pu_bacteria | 2808606370 | 2808894272 | 310 |
| 287 | iso_pu_bacteria | 2904776348 | 2904778125 | 310 |
| 288 | iso_pu_bacteria | 2910809715 | 2910814818 | 310 |
| 289 | iso_pu_bacteria | 2919059106 | 2919060178 | 310 |
| 290 | iso_pu_bacteria | 2939647034 | 2939650308 | 310 |
| 291 | iso_pu_bacteria | 2945920336 | 2945923835 | 310 |
| 292 | iso_pu_bacteria | 2946037020 | 2946040421 | 310 |
| 293 | iso_pu_bacteria | 2953998280 | 2954001686 | 310 |
| 294 | iso_pu_bacteria | 8054107350 | 8054109746 | 310 |
| 295 | 3300005535 | Ga0070684_100049369 | Ga0070684_1000493693 | 311 |
| 296 | 3300005543 | Ga0070672_100000004 | Ga0070672_100000004107 | 311 |
| 297 | 3300013105 | Ga0157369_10011880 | Ga0157369_1001188010 | 311 |
| 298 | 3300025940 | Ga0207691_10000020 | Ga0207691_1000002019 | 311 |
| 299 | 3300025944 | Ga0207661_10059884 | Ga0207661_100598842 | 311 |
| 300 | 3300046522 | Ga0495643_0059295 | Ga0495643_0059295_120_1205 | 311 |
| 301 | 3300048904 | Ga0496101_0234649 | Ga0496101_0234649_50_1105 | 311 |
| 302 | 3300048906 | Ga0496103_0095568 | Ga0496103_0095568_131_1216 | 311 |
| 303 | 3300048908 | Ga0496105_0010789 | Ga0496105_0010789_4813_5838 | 311 |
| 304 | 3300048912 | Ga0496109_0065082 | Ga0496109_0065082_318_1343 | 311 |
| 305 | 3300048913 | Ga0496110_0019534 | Ga0496110_0019534_151_1266 | 311 |
| 306 | 3300048913 | Ga0496110_0065488 | Ga0496110_0065488_131_1201 | 311 |
| 307 | 3300048913 | Ga0496110_0106804 | Ga0496110_0106804_265_1290 | 311 |
| 308 | 3300048914 | Ga0496111_0010066 | Ga0496111_0010066_4444_5544 | 311 |
| 309 | 3300048914 | Ga0496111_0037221 | Ga0496111_0037221_2312_3427 | 311 |
| 310 | 3300048917 | Ga0496114_0015629 | Ga0496114_0015629_5032_6057 | 311 |
| 311 | iso_pu_bacteria | 2818991458 | 2819665342 | 311 |
| 312 | 3300025898 | Ga0207692_10046702 | Ga0207692_100467022 | 312 |
| 313 | 3300048907 | Ga0496104_0352886 | Ga0496104_0352886_131_1216 | 312 |
| 314 | iso_pu_bacteria | 2554235227 | 2555230342 | 312 |
| 315 | iso_pu_bacteria | 2751185725 | 2753035989 | 312 |
| 316 | iso_pu_bacteria | 2751185792 | 2753325986 | 312 |
| 317 | 3300009098 | Ga0105245_10000283 | Ga0105245_1000028328 | 313 |
| 318 | 3300013306 | Ga0163162_10087353 | Ga0163162_100873532 | 313 |
| 319 | 3300013308 | Ga0157375_10225014 | Ga0157375_102250142 | 313 |
| 320 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007156 | 313 |
| 321 | 3300037312 | Ga0395899_0054998 | Ga0395899_0054998_195_1196 | 313 |
| 322 | 3300037418 | Ga0395900_0045178 | Ga0395900_0045178_2861_3862 | 313 |
| 323 | 3300037418 | Ga0395900_0118224 | Ga0395900_0118224_870_1871 | 313 |
| 324 | 3300037471 | Ga0395905_0027277 | Ga0395905_0027277_354_1355 | 313 |
| 325 | 3300037471 | Ga0395905_0264361 | Ga0395905_0264361_354_1355 | 313 |
| 326 | 3300038443 | Ga0395901_0011883 | Ga0395901_0011883_3265_4266 | 313 |
| 327 | 3300038443 | Ga0395901_0035723 | Ga0395901_0035723_896_1897 | 313 |
| 328 | 3300045976 | Ga0466967_0000046 | Ga0466967_0000046_34789_35808 | 313 |
| 329 | 3300047318 | Ga0495636_0027125 | Ga0495636_0027125_453_1553 | 313 |
| 330 | 3300048903 | Ga0496100_0002534 | Ga0496100_0002534_254_1354 | 313 |
| 331 | 3300048905 | Ga0496102_0103738 | Ga0496102_0103738_110_1210 | 313 |
| 332 | 3300048905 | Ga0496102_0622148 | Ga0496102_0622148_16_987 | 313 |
| 333 | 3300048906 | Ga0496103_0006871 | Ga0496103_0006871_228_1328 | 313 |
| 334 | 3300048909 | Ga0496106_0066818 | Ga0496106_0066818_959_2059 | 313 |
| 335 | 3300048910 | Ga0496107_0089133 | Ga0496107_0089133_297_1397 | 313 |
| 336 | 3300048912 | Ga0496109_0142977 | Ga0496109_0142977_251_1351 | 313 |
| 337 | iso_pu_bacteria | 2537561592 | 2537900890 | 313 |
| 338 | iso_pu_bacteria | 2654587600 | 2655033937 | 313 |
| 339 | iso_pu_bacteria | 2919391150 | 2919395304 | 313 |
| 340 | iso_pu_bacteria | 2945956166 | 2945957304 | 313 |
| 341 | 3300005331 | Ga0070670_100138735 | Ga0070670_1001387352 | 314 |
| 342 | 3300005335 | Ga0070666_10180959 | Ga0070666_101809592 | 314 |
| 343 | 3300005353 | Ga0070669_100010580 | Ga0070669_1000105804 | 314 |
| 344 | 3300005354 | Ga0070675_100004238 | Ga0070675_1000042389 | 314 |
| 345 | 3300005355 | Ga0070671_100017642 | Ga0070671_1000176424 | 314 |
| 346 | 3300005356 | Ga0070674_100127830 | Ga0070674_1001278302 | 314 |
| 347 | 3300005364 | Ga0070673_100279268 | Ga0070673_1002792681 | 314 |
| 348 | 3300005367 | Ga0070667_100139945 | Ga0070667_1001399452 | 314 |
| 349 | 3300005456 | Ga0070678_100012734 | Ga0070678_1000127343 | 314 |
| 350 | 3300005543 | Ga0070672_100108289 | Ga0070672_1001082892 | 314 |
| 351 | 3300005548 | Ga0070665_100090558 | Ga0070665_1000905582 | 314 |
| 352 | 3300006058 | Ga0075432_10000095 | Ga0075432_100000956 | 314 |
| 353 | 3300006880 | Ga0075429_100006435 | Ga0075429_10000643510 | 314 |
| 354 | 3300009011 | Ga0105251_10014085 | Ga0105251_100140856 | 314 |
| 355 | 3300009036 | Ga0105244_10004517 | Ga0105244_100045173 | 314 |
| 356 | 3300009036 | Ga0105244_10086106 | Ga0105244_100861062 | 314 |
| 357 | 3300009098 | Ga0105245_10331354 | Ga0105245_103313542 | 314 |
| 358 | 3300009148 | Ga0105243_10064123 | Ga0105243_100641233 | 314 |
| 359 | 3300009177 | Ga0105248_10051753 | Ga0105248_100517535 | 314 |
| 360 | 3300011119 | Ga0105246_10013664 | Ga0105246_100136646 | 314 |
| 361 | 3300013105 | Ga0157369_10128563 | Ga0157369_101285632 | 314 |
| 362 | 3300013306 | Ga0163162_10166688 | Ga0163162_101666882 | 314 |
| 363 | 3300025315 | Ga0207697_10000412 | Ga0207697_1000041225 | 314 |
| 364 | 3300025315 | Ga0207697_10000805 | Ga0207697_1000080512 | 314 |
| 365 | 3300025728 | Ga0207655_1001561 | Ga0207655_100156115 | 314 |
| 366 | 3300025728 | Ga0207655_1015236 | Ga0207655_10152362 | 314 |
| 367 | 3300025728 | Ga0207655_1072177 | Ga0207655_10721771 | 314 |
| 368 | 3300025735 | Ga0207713_1035501 | Ga0207713_10355011 | 314 |
| 369 | 3300025903 | Ga0207680_10015104 | Ga0207680_100151044 | 314 |
| 370 | 3300025907 | Ga0207645_10011034 | Ga0207645_100110344 | 314 |
| 371 | 3300025925 | Ga0207650_10017213 | Ga0207650_100172137 | 314 |
| 372 | 3300025927 | Ga0207687_10183817 | Ga0207687_101838171 | 314 |
| 373 | 3300025935 | Ga0207709_10204160 | Ga0207709_102041601 | 314 |
| 374 | 3300025940 | Ga0207691_10004975 | Ga0207691_100049753 | 314 |
| 375 | 3300025941 | Ga0207711_10033740 | Ga0207711_100337404 | 314 |
| 376 | 3300026121 | Ga0207683_10010818 | Ga0207683_100108189 | 314 |
| 377 | 3300028379 | Ga0268266_10216492 | Ga0268266_102164922 | 314 |
| 378 | 3300031548 | Ga0307408_100023549 | Ga0307408_1000235492 | 314 |
| 379 | 3300031548 | Ga0307408_100040648 | Ga0307408_1000406482 | 314 |
| 380 | 3300031548 | Ga0307408_100111811 | Ga0307408_1001118112 | 314 |
| 381 | 3300031548 | Ga0307408_100291219 | Ga0307408_1002912191 | 314 |
| 382 | 3300031731 | Ga0307405_10011780 | Ga0307405_100117805 | 314 |
| 383 | 3300031731 | Ga0307405_10036506 | Ga0307405_100365062 | 314 |
| 384 | 3300031731 | Ga0307405_10119569 | Ga0307405_101195692 | 314 |
| 385 | 3300031731 | Ga0307405_10270291 | Ga0307405_102702911 | 314 |
| 386 | 3300031824 | Ga0307413_10034494 | Ga0307413_100344942 | 314 |
| 387 | 3300031824 | Ga0307413_10174299 | Ga0307413_101742992 | 314 |
| 388 | 3300031852 | Ga0307410_10013862 | Ga0307410_100138622 | 314 |
| 389 | 3300031852 | Ga0307410_10020455 | Ga0307410_100204551 | 314 |
| 390 | 3300031852 | Ga0307410_10053308 | Ga0307410_100533083 | 314 |
| 391 | 3300031852 | Ga0307410_10070214 | Ga0307410_100702142 | 314 |
| 392 | 3300031852 | Ga0307410_10218937 | Ga0307410_102189372 | 314 |
| 393 | 3300031901 | Ga0307406_10358366 | Ga0307406_103583661 | 314 |
| 394 | 3300031903 | Ga0307407_10080587 | Ga0307407_100805872 | 314 |
| 395 | 3300031903 | Ga0307407_10260019 | Ga0307407_102600192 | 314 |
| 396 | 3300031911 | Ga0307412_10013690 | Ga0307412_100136904 | 314 |
| 397 | 3300031911 | Ga0307412_10037005 | Ga0307412_100370052 | 314 |
| 398 | 3300031911 | Ga0307412_10064761 | Ga0307412_100647612 | 314 |
| 399 | 3300031911 | Ga0307412_10091620 | Ga0307412_100916202 | 314 |
| 400 | 3300031995 | Ga0307409_100012546 | Ga0307409_1000125461 | 314 |
| 401 | 3300031995 | Ga0307409_100071534 | Ga0307409_1000715342 | 314 |
| 402 | 3300031995 | Ga0307409_100481273 | Ga0307409_1004812731 | 314 |
| 403 | 3300032002 | Ga0307416_100010248 | Ga0307416_1000102483 | 314 |
| 404 | 3300032002 | Ga0307416_100137154 | Ga0307416_1001371543 | 314 |
| 405 | 3300032002 | Ga0307416_100196760 | Ga0307416_1001967602 | 314 |
| 406 | 3300032004 | Ga0307414_10073426 | Ga0307414_100734261 | 314 |
| 407 | 3300032126 | Ga0307415_100141554 | Ga0307415_1001415542 | 314 |
| 408 | 3300032126 | Ga0307415_100184087 | Ga0307415_1001840871 | 314 |
| 409 | 3300041404 | Ga0439436_0007508 | Ga0439436_0007508_883_1917 | 314 |
| 410 | 3300041999 | Ga0439433_0000691 | Ga0439433_0000691_2016_3050 | 314 |
| 411 | 3300042002 | Ga0439442_001124 | Ga0439442_001124_2367_3401 | 314 |
| 412 | 3300042002 | Ga0439442_007323 | Ga0439442_007323_427_1461 | 314 |
| 413 | 3300042007 | Ga0439449_0002127 | Ga0439449_0002127_1429_2463 | 314 |
| 414 | 3300042122 | Ga0450920_005486 | Ga0450920_005486_599_1633 | 314 |
| 415 | 3300042435 | Ga0439434_0051787 | Ga0439434_0051787_106_1140 | 314 |
| 416 | 3300046463 | Ga0495653_0009152 | Ga0495653_0009152_251_1303 | 314 |
| 417 | 3300046476 | Ga0495662_0009886 | Ga0495662_0009886_708_1790 | 314 |
| 418 | 3300046477 | Ga0495664_0006098 | Ga0495664_0006098_2713_3795 | 314 |
| 419 | 3300046517 | Ga0495630_0053754 | Ga0495630_0053754_642_1694 | 314 |
| 420 | 3300046531 | Ga0495665_0004768 | Ga0495665_0004768_4855_5835 | 314 |
| 421 | 3300046531 | Ga0495665_0009914 | Ga0495665_0009914_3087_4169 | 314 |
| 422 | 3300046535 | Ga0495586_0001117 | Ga0495586_0001117_11875_12927 | 314 |
| 423 | 3300046535 | Ga0495586_0074036 | Ga0495586_0074036_595_1644 | 314 |
| 424 | 3300046536 | Ga0495587_0001817 | Ga0495587_0001817_12926_14008 | 314 |
| 425 | 3300046543 | Ga0495645_0010369 | Ga0495645_0010369_5326_6378 | 314 |
| 426 | 3300046663 | Ga0495635_0013408 | Ga0495635_0013408_3486_4538 | 314 |
| 427 | 3300046674 | Ga0495588_0050607 | Ga0495588_0050607_541_1521 | 314 |
| 428 | 3300046674 | Ga0495588_0084628 | Ga0495588_0084628_146_1186 | 314 |
| 429 | 3300046675 | Ga0495657_0088487 | Ga0495657_0088487_670_1752 | 314 |
| 430 | 3300047315 | Ga0495581_0002683 | Ga0495581_0002683_4414_5394 | 314 |
| 431 | 3300047315 | Ga0495581_0020363 | Ga0495581_0020363_781_1806 | 314 |
| 432 | 3300047315 | Ga0495581_0086250 | Ga0495581_0086250_155_1180 | 314 |
| 433 | 3300047317 | Ga0495604_0074833 | Ga0495604_0074833_1002_2084 | 314 |
| 434 | 3300047322 | Ga0495680_0031417 | Ga0495680_0031417_437_1489 | 314 |
| 435 | 3300047447 | Ga0495685_050541 | Ga0495685_050541_178_1218 | 314 |
| 436 | 3300047470 | Ga0495681_0092848 | Ga0495681_0092848_145_1215 | 314 |
| 437 | 3300048904 | Ga0496101_0106070 | Ga0496101_0106070_107_1132 | 314 |
| 438 | 3300048906 | Ga0496103_0193503 | Ga0496103_0193503_176_1201 | 314 |
| 439 | 3300048910 | Ga0496107_0101513 | Ga0496107_0101513_107_1132 | 314 |
| 440 | 3300048913 | Ga0496110_0150154 | Ga0496110_0150154_107_1132 | 314 |
| 441 | 3300048914 | Ga0496111_0052692 | Ga0496111_0052692_978_2003 | 314 |
| 442 | 3300048917 | Ga0496114_0043091 | Ga0496114_0043091_130_1155 | 314 |
| 443 | 3300048927 | Ga0496124_0022784 | Ga0496124_0022784_3436_4461 | 314 |
| 444 | 3300048928 | Ga0496125_0050035 | Ga0496125_0050035_1722_2747 | 314 |
| 445 | 3300049571 | Ga0501034_0000488 | Ga0501034_0000488_47074_48087 | 314 |
| 446 | 3300049573 | Ga0501037_0060828 | Ga0501037_0060828_735_1748 | 314 |
| 447 | 3300050508 | nmdc:mga09592_5164_c1 | nmdc:mga09592_5164_c1_8459_9439 | 314 |
| 448 | 3300005436 | Ga0070713_100001904 | Ga0070713_1000019041 | 315 |
| 449 | 3300042531 | Ga0450918_000907 | Ga0450918_000907_1848_2894 | 315 |
| 450 | 3300025303 | Ga0209051_1014337 | Ga0209051_10143373 | 316 |
| 451 | 3300031911 | Ga0307412_10080167 | Ga0307412_100801672 | 316 |
| 452 | 3300038443 | Ga0395901_0524316 | Ga0395901_0524316_129_1118 | 316 |
| 453 | 3300044842 | Ga0466957_0203217 | Ga0466957_0203217_275_1285 | 316 |
| 454 | 3300045049 | Ga0466959_0094148 | Ga0466959_0094148_237_1247 | 316 |
| 455 | 3300046535 | Ga0495586_0005810 | Ga0495586_0005810_4050_5039 | 316 |
| 456 | 3300031548 | Ga0307408_100013782 | Ga0307408_1000137823 | 317 |
| 457 | 3300031731 | Ga0307405_10053912 | Ga0307405_100539123 | 317 |
| 458 | 3300031731 | Ga0307405_10154368 | Ga0307405_101543682 | 317 |
| 459 | 3300031852 | Ga0307410_10084101 | Ga0307410_100841011 | 317 |
| 460 | 3300031903 | Ga0307407_10152675 | Ga0307407_101526752 | 317 |
| 461 | 3300031903 | Ga0307407_10197490 | Ga0307407_101974901 | 317 |
| 462 | 3300032002 | Ga0307416_100029141 | Ga0307416_1000291413 | 317 |
| 463 | 3300032005 | Ga0307411_10074238 | Ga0307411_100742383 | 317 |
| 464 | 3300032005 | Ga0307411_10089306 | Ga0307411_100893062 | 317 |
| 465 | 3300037312 | Ga0395899_0026430 | Ga0395899_0026430_2155_3201 | 317 |
| 466 | 3300037418 | Ga0395900_0037495 | Ga0395900_0037495_3821_4867 | 317 |
| 467 | 3300037466 | Ga0395898_0078315 | Ga0395898_0078315_141_1187 | 317 |
| 468 | 3300038443 | Ga0395901_0371763 | Ga0395901_0371763_296_1342 | 317 |
| 469 | 3300041405 | Ga0439438_038191 | Ga0439438_038191_15_1067 | 317 |
| 470 | 3300003320 | rootH2_10085513 | rootH2_100855132 | 318 |
| 471 | 3300031548 | Ga0307408_100055570 | Ga0307408_1000555702 | 318 |
| 472 | 3300031852 | Ga0307410_10010463 | Ga0307410_100104634 | 318 |
| 473 | 3300031901 | Ga0307406_10017791 | Ga0307406_100177912 | 318 |
| 474 | 3300049569 | Ga0501032_0003416 | Ga0501032_0003416_7196_8383 | 318 |
| 475 | 3300049574 | Ga0501038_0251056 | Ga0501038_0251056_123_1310 | 318 |
| 476 | 3300037418 | Ga0395900_0033677 | Ga0395900_0033677_2550_3593 | 319 |
| 477 | 3300037466 | Ga0395898_0017201 | Ga0395898_0017201_4547_5590 | 319 |
| 478 | 3300042002 | Ga0439442_000626 | Ga0439442_000626_4172_5233 | 319 |
| 479 | 3300048906 | Ga0496103_0212618 | Ga0496103_0212618_158_1225 | 319 |
| 480 | 3300048910 | Ga0496107_0066381 | Ga0496107_0066381_48_1115 | 319 |
| 481 | 3300009093 | Ga0105240_10494751 | Ga0105240_104947512 | 321 |
| 482 | 3300031251 | Ga0265327_10000185 | Ga0265327_100001855 | 321 |
| 483 | iso_pu_bacteria | 2643221616 | 2644094552 | 321 |
| 484 | 3300045976 | Ga0466967_0000612 | Ga0466967_0000612_494_1483 | 324 |
| 485 | 3300045976 | Ga0466967_0009345 | Ga0466967_0009345_2553_3542 | 324 |
| 486 | 3300044658 | Ga0466972_0030217 | Ga0466972_0030217_1593_2585 | 325 |
| 487 | 3300044683 | Ga0466965_0033576 | Ga0466965_0033576_515_1507 | 325 |
| 488 | 3300044684 | Ga0466966_0020935 | Ga0466966_0020935_1145_2134 | 325 |
| 489 | 3300044693 | Ga0466961_0009077 | Ga0466961_0009077_3239_4228 | 325 |
| 490 | 3300044693 | Ga0466961_0072357 | Ga0466961_0072357_101_1090 | 325 |
| 491 | 3300044694 | Ga0466963_0039236 | Ga0466963_0039236_1083_2075 | 325 |
| 492 | 3300044706 | Ga0466964_0017579 | Ga0466964_0017579_1026_2018 | 325 |
| 493 | 3300044719 | Ga0466971_0019650 | Ga0466971_0019650_1391_2383 | 325 |
| 494 | 3300044842 | Ga0466957_0009318 | Ga0466957_0009318_525_1517 | 325 |
| 495 | 3300044842 | Ga0466957_0038853 | Ga0466957_0038853_1426_2424 | 325 |
| 496 | 3300045049 | Ga0466959_0054389 | Ga0466959_0054389_795_1793 | 325 |
| 497 | 3300045836 | Ga0466958_0033163 | Ga0466958_0033163_1058_2050 | 325 |
| 498 | 3300045976 | Ga0466967_0005868 | Ga0466967_0005868_4103_5101 | 325 |
| 499 | 3300045976 | Ga0466967_0572783 | Ga0466967_0572783_80_1072 | 325 |
| 500 | 3300049581 | Ga0501047_0187966 | Ga0501047_0187966_731_1723 | 325 |
| 501 | 3300049823 | Ga0501044_0149191 | Ga0501044_0149191_781_1773 | 325 |
| 502 | 3300005563 | Ga0068855_100009285 | Ga0068855_1000092859 | 326 |
| 503 | 3300009545 | Ga0105237_10087995 | Ga0105237_100879952 | 326 |
| 504 | 3300025914 | Ga0207671_10015734 | Ga0207671_100157342 | 326 |
| 505 | 3300025949 | Ga0207667_10017456 | Ga0207667_100174565 | 326 |
| 506 | 3300005445 | Ga0070708_100283441 | Ga0070708_1002834412 | 327 |
| 507 | 3300005467 | Ga0070706_100099689 | Ga0070706_1000996892 | 327 |
| 508 | 3300005468 | Ga0070707_100158946 | Ga0070707_1001589462 | 327 |
| 509 | 3300005471 | Ga0070698_100128061 | Ga0070698_1001280612 | 327 |
| 510 | 3300005518 | Ga0070699_100031996 | Ga0070699_1000319962 | 327 |
| 511 | 3300006028 | Ga0070717_10083773 | Ga0070717_100837732 | 327 |
| 512 | 3300025910 | Ga0207684_10053071 | Ga0207684_100530713 | 327 |
| 513 | 3300044694 | Ga0466963_0073702 | Ga0466963_0073702_1091_2080 | 328 |
| 514 | 3300045976 | Ga0466967_0061255 | Ga0466967_0061255_163_1152 | 328 |
| 515 | 3300048929 | Ga0496126_0004638 | Ga0496126_0004638_8411_9469 | 328 |
| 516 | iso_pu_bacteria | 2884763398 | 2884764023 | 328 |
| 517 | 3300002737 | JGI25162J39368_1010273 | JGI25162J39368_10102731 | 332 |
| 518 | 3300002772 | JGI25164J39214_1001102 | JGI25164J39214_10011022 | 332 |
| 519 | 3300003214 | JGI25165J46597_1000014 | JGI25165J46597_1000014113 | 332 |
| 520 | 3300025231 | Ga0207427_100121 | Ga0207427_1001212 | 332 |
| 521 | 3300025233 | Ga0209437_100398 | Ga0209437_1003982 | 332 |
| 522 | 3300025261 | Ga0209233_1000014 | Ga0209233_1000014521 | 332 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h8j-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9393 | 23 | 318 |
| 5h8l-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine | 0.9335 | 24 | 318 |
| 5h8i-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine | 0.9293 | 24 | 321 |
| 5h8j-assembly2.cif.gz_I | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9288 | 23 | 318 |
| 5h8l-assembly2.cif.gz_I | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine | 0.926 | 23 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9213 | 22 | 321 | 3.60.110.10 |
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9168 | 27 | 320 | 3.60.110.10 |
| af_O59829_1_271_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9125 | 29 | 318 | 3.60.110.10 |
| 1j31B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9018 | 29 | 313 | 3.60.110.10 |
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9009 | 22 | 321 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A6UK21-F1-model_v4 | Hydrolase | 0.9804 | 3 | 316 |
GO:0033388
GO:0050126 |
| AF-A0A0A6UK21-F1-model_v4 | Hydrolase | 0.974 | 3 | 316 |
GO:0033388
GO:0050126 |
| AF-A0A127A5F8-F1-model_v4 | Hydrolase | 0.9729 | 3 | 319 |
GO:0033388
GO:0050126 |
| AF-A0A352B1E9-F1-model_v4 | Hydrolase | 0.9717 | 36 | 318 |
GO:0033388
GO:0050126 |
| AF-A0A4Z1CGV4-F1-model_v4 | Hydrolase | 0.9657 | 3 | 324 |
GO:0033388
GO:0050126 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar