F458902

General Info

Members Datasets Scaffolds Average Seq Length
522 295 489 325

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0003416|Ga0501032_0003416_7196_8383
Length 379
Sequence MFAPSIGIKCHLAPNNPDSAPVIKERGSFKPLRSGTTGEHAIMIEITRLEAPTSLARTEPSTRTPLRVGVVQHRWHADEAVLRAELNEGIERAAKLGAAVVFLPELTLSRYPADTRPANNPAAGVRPSDIAEDLLTGPTFTFAAEAARKFGVSVHASLYQRAENPDGTDDGLGLNTAILVSPAGELVARTHKLHIPVTAGYYEDKFFRKGPDADDAYAVHAPAELGGARLGMPTCWDEWFPELARLYSLGGAEILVYPTAIGSEPDHPDFDTQPLWQQVIVGNGIANGLFMVAPNRHGSEGTLNFYGSSFISDPYGRILVQAPRDESAVLVADLDLDQRKDWLTLFPFLTTRRPETYGRLTEPVNHDAPLGAQPQAVPA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221711 Terrabacter sp. Root85 Isolate Unclassified
8 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
11 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
12 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
13 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
14 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
15 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
16 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
17 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
18 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
19 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
20 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
21 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
22 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
23 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
24 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
25 2922554459 Rhodococcus sp. 66b Isolate Unclassified
26 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
27 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
28 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
29 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
30 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
31 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
32 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
292 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 13.41
Rhizosphere 76.05
Stem 0
Stem Tuber 0.19
Unclassified 6.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1010273 3300002737 Bacteria 1193
2 JGI25164J39214_1001102 3300002772 Bacteria 7765
3 JGI25165J46597_1000014 3300003214 Bacteria 390383
4 rootH2_10085513 3300003320 Bacteria 2394
5 Ga0070683_100155886 3300005329 Bacteria 2165
6 Ga0070670_100138735 3300005331 Bacteria 2102
7 Ga0070666_10038337 3300005335 Bacteria 3188
8 Ga0070666_10180959 3300005335 Bacteria 1478
9 Ga0070689_100231213 3300005340 Bacteria 1520
10 Ga0070668_100244320 3300005347 Bacteria 1488
11 Ga0070669_100008474 3300005353 Bacteria 7341
12 Ga0070669_100010580 3300005353 Bacteria 6550
13 Ga0070675_100004238 3300005354 Bacteria 10909
14 Ga0070671_100017642 3300005355 Bacteria 5784
15 Ga0070674_100127830 3300005356 Bacteria 1890
16 Ga0070673_100279268 3300005364 Bacteria 1464
17 Ga0070688_100005702 3300005365 Bacteria 6582
18 Ga0070688_100005975 3300005365 Bacteria 6452
19 Ga0070667_100128201 3300005367 Bacteria 2213
20 Ga0070667_100139945 3300005367 Bacteria 2118
21 Ga0070714_100037632 3300005435 Bacteria 4066
22 Ga0070714_100078053 3300005435 Bacteria 2877
23 Ga0070714_100118612 3300005435 Bacteria 2351
24 Ga0070713_100001904 3300005436 Bacteria 13443
25 Ga0070713_100050180 3300005436 Bacteria 3445
26 Ga0070713_100140360 3300005436 Bacteria 2140
27 Ga0070708_100283441 3300005445 Bacteria 1559
28 Ga0070663_100000859 3300005455 Bacteria 16482
29 Ga0070678_100012734 3300005456 Bacteria 5243
30 Ga0070685_10000018 3300005466 Bacteria 110132
31 Ga0070685_10001560 3300005466 Bacteria 12073
32 Ga0070706_100099689 3300005467 Bacteria 2699
33 Ga0070707_100158946 3300005468 Bacteria 2201
34 Ga0070698_100014435 3300005471 Bacteria 8342
35 Ga0070698_100128061 3300005471 Bacteria 2495
36 Ga0070699_100031996 3300005518 Bacteria 4542
37 Ga0070679_100037721 3300005530 Bacteria 4802
38 Ga0070684_100049369 3300005535 Bacteria 3652
39 Ga0070672_100000004 3300005543 Bacteria 129970
40 Ga0070672_100108289 3300005543 Bacteria 2262
41 Ga0070665_100051052 3300005548 Bacteria 4149
42 Ga0070665_100090558 3300005548 Bacteria 3064
43 Ga0068855_100009285 3300005563 Bacteria 11879
44 Ga0068857_100089264 3300005577 Bacteria 2758
45 Ga0068856_100149750 3300005614 Bacteria 2342
46 Ga0068852_100039173 3300005616 Bacteria 3989
47 Ga0068863_100063307 3300005841 Bacteria 3498
48 Ga0068863_100468378 3300005841 Bacteria 1238
49 Ga0081540_1000129 3300005983 Bacteria 80446
50 Ga0070717_10038018 3300006028 Bacteria 3910
51 Ga0070717_10083773 3300006028 Bacteria 2682
52 Ga0075365_10050547 3300006038 Bacteria 2742
53 Ga0075365_10242647 3300006038 Bacteria 1265
54 Ga0075363_100055329 3300006048 Bacteria 2125
55 Ga0075364_10093978 3300006051 Bacteria 1992
56 Ga0075432_10000095 3300006058 Bacteria 18569
57 Ga0075428_100302719 3300006844 Bacteria 1719
58 Ga0075433_10010907 3300006852 Bacteria 7311
59 Ga0075434_100021060 3300006871 Bacteria 6334
60 Ga0075429_100006435 3300006880 Bacteria 10172
61 Ga0075436_100059614 3300006914 Bacteria 2636
62 Ga0105251_10014085 3300009011 Bacteria 4441
63 Ga0105244_10004517 3300009036 Bacteria 9549
64 Ga0105244_10086106 3300009036 Bacteria 1550
65 Ga0105240_10494751 3300009093 Bacteria 1361
66 Ga0111539_10047017 3300009094 Bacteria 5159
67 Ga0105245_10000283 3300009098 Bacteria 48302
68 Ga0105245_10011020 3300009098 Bacteria 7868
69 Ga0105245_10127864 3300009098 Bacteria 2380
70 Ga0105245_10331354 3300009098 Bacteria 1502
71 Ga0105247_10000649 3300009101 Bacteria 27562
72 Ga0114129_10429267 3300009147 Bacteria 1736
73 Ga0105243_10026965 3300009148 Bacteria 4400
74 Ga0105243_10064123 3300009148 Bacteria 2947
75 Ga0105241_10028290 3300009174 Bacteria 4177
76 Ga0105248_10002486 3300009177 Bacteria 20480
77 Ga0105248_10051753 3300009177 Bacteria 4608
78 Ga0105237_10087995 3300009545 Bacteria 3095
79 Ga0105238_10242197 3300009551 Bacteria 1781
80 Ga0105246_10013664 3300011119 Bacteria 5095
81 Ga0157369_10011880 3300013105 Bacteria 9891
82 Ga0157369_10128563 3300013105 Bacteria 2685
83 Ga0163162_10087353 3300013306 Bacteria 3197
84 Ga0163162_10166688 3300013306 Bacteria 2327
85 Ga0163162_10196397 3300013306 Bacteria 2147
86 Ga0157375_10051386 3300013308 Bacteria 4047
87 Ga0157375_10225014 3300013308 Bacteria 2035
88 Ga0163163_10029162 3300014325 Bacteria 5307
89 Ga0157380_10001287 3300014326 Bacteria 16323
90 Ga0182008_10081392 3300014497 Bacteria 1594
91 Ga0157377_10105179 3300014745 Bacteria 1689
92 Ga0157379_10063437 3300014968 Bacteria 3303
93 Ga0157379_10084390 3300014968 Bacteria 2846
94 Ga0157376_10072535 3300014969 Bacteria 2929
95 Ga0163161_10098728 3300017792 Bacteria 2171
96 Ga0207427_100121 3300025231 Bacteria 99954
97 Ga0209437_100398 3300025233 Bacteria 40556
98 Ga0209233_1000014 3300025261 Bacteria 996641
99 Ga0209051_1014337 3300025303 Bacteria 3705
100 Ga0207697_10000412 3300025315 Bacteria 24182
101 Ga0207697_10000805 3300025315 Bacteria 17773
102 Ga0207655_1001561 3300025728 Bacteria 20650
103 Ga0207655_1015236 3300025728 Bacteria 4286
104 Ga0207655_1072177 3300025728 Bacteria 1278
105 Ga0207713_1035501 3300025735 Bacteria 2151
106 Ga0207682_10009340 3300025893 Bacteria 3875
107 Ga0207692_10019244 3300025898 Bacteria 3082
108 Ga0207692_10046702 3300025898 Bacteria 2172
109 Ga0207710_10000426 3300025900 Bacteria 27570
110 Ga0207680_10005659 3300025903 Bacteria 5980
111 Ga0207680_10015104 3300025903 Bacteria 4021
112 Ga0207645_10011034 3300025907 Bacteria 6182
113 Ga0207684_10053071 3300025910 Bacteria 3441
114 Ga0207671_10015734 3300025914 Bacteria 5909
115 Ga0207652_10000307 3300025921 Bacteria 50351
116 Ga0207681_10006222 3300025923 Bacteria 7321
117 Ga0207650_10017213 3300025925 Bacteria 5059
118 Ga0207687_10000007 3300025927 Bacteria 604185
119 Ga0207687_10006313 3300025927 Bacteria 7836
120 Ga0207687_10096326 3300025927 Bacteria 2168
121 Ga0207687_10183817 3300025927 Bacteria 1621
122 Ga0207700_10068410 3300025928 Bacteria 2722
123 Ga0207700_10078482 3300025928 Bacteria 2569
124 Ga0207700_10086654 3300025928 Bacteria 2461
125 Ga0207664_10070326 3300025929 Bacteria 2816
126 Ga0207664_10071978 3300025929 Bacteria 2786
127 Ga0207664_10099587 3300025929 Bacteria 2399
128 Ga0207690_10140296 3300025932 Bacteria 1780
129 Ga0207709_10012655 3300025935 Bacteria 4650
130 Ga0207709_10091230 3300025935 Bacteria 1992
131 Ga0207709_10204160 3300025935 Bacteria 1414
132 Ga0207670_10366002 3300025936 Bacteria 1145
133 Ga0207691_10000020 3300025940 Bacteria 133465
134 Ga0207691_10004975 3300025940 Bacteria 12820
135 Ga0207711_10003747 3300025941 Bacteria 13102
136 Ga0207711_10033740 3300025941 Bacteria 4333
137 Ga0207661_10028785 3300025944 Bacteria 4259
138 Ga0207661_10059884 3300025944 Bacteria 3070
139 Ga0207667_10017456 3300025949 Bacteria 8075
140 Ga0207658_10033339 3300025986 Bacteria 3673
141 Ga0207677_10002503 3300026023 Bacteria 9629
142 Ga0207678_10008282 3300026067 Bacteria 9160
143 Ga0207641_10452932 3300026088 Bacteria 1240
144 Ga0207674_10089520 3300026116 Bacteria 3070
145 Ga0207675_100120076 3300026118 Bacteria 2486
146 Ga0207683_10010818 3300026121 Bacteria 7780
147 Ga0207698_10004988 3300026142 Bacteria 8138
148 Ga0268266_10000247 3300028379 Bacteria 91489
149 Ga0268266_10055236 3300028379 Bacteria 3414
150 Ga0268266_10216492 3300028379 Bacteria 1759
151 Ga0265327_10000185 3300031251 Bacteria 131884
152 Ga0307408_100013782 3300031548 Bacteria 5367
153 Ga0307408_100023549 3300031548 Bacteria 4196
154 Ga0307408_100040648 3300031548 Bacteria 3293
155 Ga0307408_100055570 3300031548 Bacteria 2867
156 Ga0307408_100111811 3300031548 Bacteria 2099
157 Ga0307408_100291219 3300031548 Bacteria 1363
158 Ga0316575_10057679 3300031665 Bacteria 1548
159 Ga0265314_10196952 3300031711 Bacteria 1194
160 Ga0316576_10054072 3300031727 Bacteria 2927
161 Ga0316576_10198281 3300031727 Bacteria 1512
162 Ga0316578_10104212 3300031728 Bacteria 1701
163 Ga0307405_10011780 3300031731 Bacteria 4602
164 Ga0307405_10036506 3300031731 Bacteria 2945
165 Ga0307405_10053912 3300031731 Bacteria 2507
166 Ga0307405_10119569 3300031731 Bacteria 1800
167 Ga0307405_10154368 3300031731 Bacteria 1618
168 Ga0307405_10270291 3300031731 Bacteria 1274
169 Ga0316577_10064343 3300031733 Bacteria 2047
170 Ga0307413_10034494 3300031824 Bacteria 2893
171 Ga0307413_10174299 3300031824 Bacteria 1526
172 Ga0307410_10010463 3300031852 Bacteria 5255
173 Ga0307410_10013862 3300031852 Bacteria 4720
174 Ga0307410_10020455 3300031852 Bacteria 4048
175 Ga0307410_10053308 3300031852 Bacteria 2736
176 Ga0307410_10070214 3300031852 Bacteria 2425
177 Ga0307410_10084101 3300031852 Bacteria 2242
178 Ga0307410_10218937 3300031852 Bacteria 1463
179 Ga0307406_10017791 3300031901 Bacteria 4144
180 Ga0307406_10358366 3300031901 Bacteria 1142
181 Ga0307407_10080587 3300031903 Bacteria 1967
182 Ga0307407_10152675 3300031903 Bacteria 1502
183 Ga0307407_10197490 3300031903 Bacteria 1345
184 Ga0307407_10260019 3300031903 Bacteria 1193
185 Ga0307412_10013690 3300031911 Bacteria 4764
186 Ga0307412_10037005 3300031911 Bacteria 3132
187 Ga0307412_10064761 3300031911 Bacteria 2470
188 Ga0307412_10080167 3300031911 Bacteria 2254
189 Ga0307412_10091620 3300031911 Bacteria 2128
190 Ga0307409_100012546 3300031995 Bacteria 5406
191 Ga0307409_100071534 3300031995 Bacteria 2758
192 Ga0307409_100481273 3300031995 Bacteria 1204
193 Ga0307416_100010248 3300032002 Bacteria 6181
194 Ga0307416_100029141 3300032002 Bacteria 4119
195 Ga0307416_100137154 3300032002 Bacteria 2216
196 Ga0307416_100196760 3300032002 Bacteria 1907
197 Ga0307414_10073426 3300032004 Bacteria 2475
198 Ga0307411_10074238 3300032005 Bacteria 2317
199 Ga0307411_10089306 3300032005 Bacteria 2146
200 Ga0307415_100141554 3300032126 Bacteria 1838
201 Ga0307415_100184087 3300032126 Bacteria 1642
202 Ga0373955_0035028 3300035172 Bacteria 2656
203 Ga0316574_0005931 3300035398 Bacteria 6554
204 Ga0316574_0006035 3300035398 Bacteria 6509
205 Ga0373933_0048202 3300035724 Bacteria 2536
206 Ga0373937_0132777 3300036401 Bacteria 2326
207 Ga0373937_0179742 3300036401 Bacteria 1986
208 Ga0316584_0007562 3300036712 Bacteria 7444
209 Ga0395899_0026430 3300037312 Bacteria 4380
210 Ga0395899_0054998 3300037312 Bacteria 2944
211 Ga0395900_0033677 3300037418 Bacteria 5272
212 Ga0395900_0037495 3300037418 Bacteria 4997
213 Ga0395900_0045178 3300037418 Bacteria 4537
214 Ga0395900_0118224 3300037418 Bacteria 2720
215 Ga0395898_0004605 3300037466 Bacteria 15056
216 Ga0395898_0017201 3300037466 Bacteria 7385
217 Ga0395898_0078315 3300037466 Bacteria 3189
218 Ga0395898_0170274 3300037466 Bacteria 2082
219 Ga0395898_0267589 3300037466 Bacteria 1630
220 Ga0395905_0027277 3300037471 Bacteria 5386
221 Ga0395905_0210047 3300037471 Bacteria 1824
222 Ga0395905_0264361 3300037471 Bacteria 1606
223 Ga0395905_0324355 3300037471 Bacteria 1430
224 Ga0395901_0003181 3300038443 Bacteria 16522
225 Ga0395901_0011883 3300038443 Bacteria 8830
226 Ga0395901_0035723 3300038443 Bacteria 5135
227 Ga0395901_0080928 3300038443 Bacteria 3392
228 Ga0395901_0256804 3300038443 Bacteria 1820
229 Ga0395901_0371763 3300038443 Bacteria 1472
230 Ga0395901_0524316 3300038443 Bacteria 1203
231 Ga0436365_0724850 3300039437 Bacteria 1564
232 Ga0439436_0007508 3300041404 Bacteria 3355
233 Ga0439438_038191 3300041405 Bacteria 1254
234 Ga0439433_0000691 3300041999 Bacteria 6540
235 Ga0439442_000626 3300042002 Bacteria 7588
236 Ga0439442_001124 3300042002 Bacteria 5337
237 Ga0439442_007323 3300042002 Bacteria 2218
238 Ga0439449_0002127 3300042007 Bacteria 7772
239 Ga0450920_005486 3300042122 Bacteria 2255
240 Ga0450907_021614 3300042146 Bacteria 1083
241 Ga0439434_0051787 3300042435 Bacteria 1273
242 Ga0450918_000907 3300042531 Bacteria 6221
243 Ga0466972_0030217 3300044658 Bacteria 2667
244 Ga0466965_0033576 3300044683 Bacteria 2508
245 Ga0466966_0020935 3300044684 Bacteria 4299
246 Ga0466966_0041355 3300044684 Bacteria 2962
247 Ga0466966_0043899 3300044684 Bacteria 2864
248 Ga0466966_0103634 3300044684 Bacteria 1758
249 Ga0466961_0009077 3300044693 Bacteria 6341
250 Ga0466961_0025242 3300044693 Bacteria 3822
251 Ga0466961_0072357 3300044693 Bacteria 2187
252 Ga0466963_0039236 3300044694 Bacteria 3100
253 Ga0466963_0073702 3300044694 Bacteria 2302
254 Ga0466964_0008906 3300044706 Bacteria 3774
255 Ga0466964_0017579 3300044706 Bacteria 2736
256 Ga0466971_0019650 3300044719 Bacteria 3001
257 Ga0466957_0009318 3300044842 Bacteria 5601
258 Ga0466957_0038853 3300044842 Bacteria 2870
259 Ga0466957_0066346 3300044842 Bacteria 2224
260 Ga0466957_0203217 3300044842 Bacteria 1302
261 Ga0466957_0236820 3300044842 Bacteria 1210
262 Ga0466957_0317545 3300044842 Bacteria 1050
263 Ga0466960_0032948 3300044901 Bacteria 2404
264 Ga0466960_0103361 3300044901 Bacteria 1471
265 Ga0466959_0054389 3300045049 Bacteria 2925
266 Ga0466959_0094148 3300045049 Bacteria 2149
267 Ga0466959_0130226 3300045049 Bacteria 1783
268 Ga0466958_0033163 3300045836 Bacteria 3075
269 Ga0466958_0178183 3300045836 Bacteria 1348
270 Ga0466967_0000046 3300045976 Bacteria 43911
271 Ga0466967_0000612 3300045976 Bacteria 17825
272 Ga0466967_0005868 3300045976 Bacteria 8595
273 Ga0466967_0009345 3300045976 Bacteria 7268
274 Ga0466967_0044098 3300045976 Bacteria 3866
275 Ga0466967_0061255 3300045976 Bacteria 3338
276 Ga0466967_0153368 3300045976 Bacteria 2155
277 Ga0466967_0572783 3300045976 Bacteria 1112
278 Ga0495603_0024979 3300046455 Bacteria 3614
279 Ga0495629_0004724 3300046459 Bacteria 10209
280 Ga0495641_0020863 3300046461 Bacteria 3310
281 Ga0495651_0128347 3300046462 Bacteria 1854
282 Ga0495653_0009152 3300046463 Bacteria 8097
283 Ga0495653_0022005 3300046463 Bacteria 5159
284 Ga0495662_0009886 3300046476 Bacteria 4685
285 Ga0495664_0006098 3300046477 Bacteria 6652
286 Ga0495608_0013436 3300046511 Bacteria 5678
287 Ga0495608_0019322 3300046511 Bacteria 4691
288 Ga0495628_0032870 3300046516 Bacteria 4184
289 Ga0495628_0085569 3300046516 Bacteria 2446
290 Ga0495630_0053754 3300046517 Bacteria 3016
291 Ga0495643_0059295 3300046522 Bacteria 2035
292 Ga0495644_0051253 3300046523 Bacteria 1550
293 Ga0495652_0000963 3300046529 Bacteria 32966
294 Ga0495652_0139583 3300046529 Bacteria 1907
295 Ga0495665_0004768 3300046531 Bacteria 7323
296 Ga0495665_0009914 3300046531 Bacteria 5158
297 Ga0495640_0036993 3300046533 Bacteria 3446
298 Ga0495586_0001117 3300046535 Bacteria 15104
299 Ga0495586_0005810 3300046535 Bacteria 6597
300 Ga0495586_0074036 3300046535 Bacteria 1863
301 Ga0495587_0001817 3300046536 Bacteria 14247
302 Ga0495587_0017319 3300046536 Bacteria 4477
303 Ga0495587_0028986 3300046536 Bacteria 3363
304 Ga0495587_0038827 3300046536 Bacteria 2852
305 Ga0495645_0010369 3300046543 Bacteria 6530
306 Ga0495667_0004558 3300046559 Bacteria 9357
307 Ga0495667_0114280 3300046559 Bacteria 1744
308 Ga0495656_0119711 3300046615 Bacteria 1241
309 Ga0495668_0001186 3300046616 Bacteria 26476
310 Ga0495625_0000405 3300046660 Bacteria 65434
311 Ga0495635_0013408 3300046663 Bacteria 5738
312 Ga0495635_0056709 3300046663 Bacteria 2696
313 Ga0495588_0050607 3300046674 Bacteria 2138
314 Ga0495588_0084628 3300046674 Bacteria 1657
315 Ga0495657_0001607 3300046675 Bacteria 19422
316 Ga0495657_0088487 3300046675 Bacteria 1991
317 Ga0495657_0227745 3300046675 Bacteria 1128
318 Ga0495599_0064303 3300046678 Bacteria 2292
319 Ga0495623_0075488 3300046679 Bacteria 2093
320 Ga0495646_0168007 3300046680 Bacteria 1210
321 Ga0495613_0317023 3300046689 Bacteria 1077
322 Ga0495600_0037813 3300046809 Bacteria 3139
323 Ga0495581_0002683 3300047315 Bacteria 10124
324 Ga0495581_0020363 3300047315 Bacteria 3850
325 Ga0495581_0086250 3300047315 Bacteria 1820
326 Ga0495604_0059748 3300047317 Bacteria 2921
327 Ga0495604_0074833 3300047317 Bacteria 2551
328 Ga0495636_0027125 3300047318 Bacteria 2333
329 Ga0495674_0000010 3300047319 Bacteria 285794
330 Ga0495674_0061276 3300047319 Bacteria 3280
331 Ga0495680_0031417 3300047322 Bacteria 4323
332 Ga0495675_0058871 3300047444 Bacteria 2436
333 Ga0495685_050541 3300047447 Bacteria 1411
334 Ga0495681_0092848 3300047470 Bacteria 1330
335 Ga0495602_0032497 3300048088 Bacteria 4911
336 Ga0495602_0034084 3300048088 Bacteria 4768
337 Ga0496100_0002534 3300048903 Bacteria 9310
338 Ga0496100_0082682 3300048903 Bacteria 2172
339 Ga0496100_0264148 3300048903 Bacteria 1277
340 Ga0496101_0067947 3300048904 Bacteria 2604
341 Ga0496101_0106070 3300048904 Bacteria 2109
342 Ga0496101_0234649 3300048904 Bacteria 1426
343 Ga0496102_0016228 3300048905 Bacteria 6508
344 Ga0496102_0078635 3300048905 Bacteria 3036
345 Ga0496102_0103738 3300048905 Bacteria 2644
346 Ga0496102_0622148 3300048905 Bacteria 1003
347 Ga0496103_0006871 3300048906 Bacteria 6795
348 Ga0496103_0074188 3300048906 Bacteria 2132
349 Ga0496103_0095568 3300048906 Bacteria 1877
350 Ga0496103_0162656 3300048906 Bacteria 1432
351 Ga0496103_0193503 3300048906 Bacteria 1307
352 Ga0496103_0212618 3300048906 Bacteria 1244
353 Ga0496104_0011647 3300048907 Bacteria 7883
354 Ga0496104_0081051 3300048907 Bacteria 3094
355 Ga0496104_0082565 3300048907 Bacteria 3064
356 Ga0496104_0100173 3300048907 Bacteria 2773
357 Ga0496104_0126230 3300048907 Bacteria 2457
358 Ga0496104_0352886 3300048907 Bacteria 1383
359 Ga0496104_0473952 3300048907 Bacteria 1163
360 Ga0496104_0616458 3300048907 Bacteria 995
361 Ga0496105_0001910 3300048908 Bacteria 14963
362 Ga0496105_0010789 3300048908 Bacteria 7195
363 Ga0496105_0011313 3300048908 Bacteria 7046
364 Ga0496105_0012678 3300048908 Bacteria 6676
365 Ga0496106_0066818 3300048909 Bacteria 2739
366 Ga0496107_0066381 3300048910 Bacteria 2616
367 Ga0496107_0089133 3300048910 Bacteria 2252
368 Ga0496107_0099363 3300048910 Bacteria 2132
369 Ga0496107_0101513 3300048910 Bacteria 2109
370 Ga0496108_0060794 3300048911 Bacteria 3179
371 Ga0496108_0284587 3300048911 Bacteria 1439
372 Ga0496109_0065082 3300048912 Bacteria 3337
373 Ga0496109_0090027 3300048912 Bacteria 2837
374 Ga0496109_0142977 3300048912 Bacteria 2237
375 Ga0496109_0143866 3300048912 Bacteria 2230
376 Ga0496109_0172745 3300048912 Bacteria 2028
377 Ga0496109_0446707 3300048912 Bacteria 1221
378 Ga0496110_0000033 3300048913 Bacteria 65539
379 Ga0496110_0019534 3300048913 Bacteria 5704
380 Ga0496110_0034154 3300048913 Bacteria 4404
381 Ga0496110_0065488 3300048913 Bacteria 3212
382 Ga0496110_0094192 3300048913 Bacteria 2681
383 Ga0496110_0106804 3300048913 Bacteria 2512
384 Ga0496110_0150154 3300048913 Bacteria 2109
385 Ga0496110_0220100 3300048913 Bacteria 1726
386 Ga0496111_0000125 3300048914 Bacteria 33642
387 Ga0496111_0010066 3300048914 Bacteria 6327
388 Ga0496111_0037221 3300048914 Bacteria 3482
389 Ga0496111_0049676 3300048914 Bacteria 3025
390 Ga0496111_0052692 3300048914 Bacteria 2938
391 Ga0496111_0082037 3300048914 Bacteria 2354
392 Ga0496111_0109015 3300048914 Bacteria 2038
393 Ga0496111_0125473 3300048914 Bacteria 1897
394 Ga0496112_0008431 3300048915 Bacteria 9230
395 Ga0496112_0010109 3300048915 Bacteria 8544
396 Ga0496112_0028414 3300048915 Bacteria 5398
397 Ga0496112_0045827 3300048915 Bacteria 4286
398 Ga0496113_0037714 3300048916 Bacteria 3549
399 Ga0496113_0194175 3300048916 Bacteria 1612
400 Ga0496113_0415677 3300048916 Bacteria 1080
401 Ga0496114_0000014 3300048917 Bacteria 297902
402 Ga0496114_0015629 3300048917 Bacteria 6104
403 Ga0496114_0043091 3300048917 Bacteria 3742
404 Ga0496114_0095133 3300048917 Bacteria 2534
405 Ga0496114_0516034 3300048917 Bacteria 1057
406 Ga0496115_0000255 3300048918 Bacteria 47200
407 Ga0496116_0004412 3300048919 Bacteria 13448
408 Ga0496117_0013864 3300048920 Bacteria 6990
409 Ga0496118_0004985 3300048921 Bacteria 15350
410 Ga0496118_0033975 3300048921 Bacteria 4172
411 Ga0496118_0055942 3300048921 Bacteria 2971
412 Ga0496119_0001069 3300048922 Bacteria 34780
413 Ga0496119_0004707 3300048922 Bacteria 13419
414 Ga0496119_0027032 3300048922 Bacteria 3959
415 Ga0496120_0000954 3300048923 Bacteria 39412
416 Ga0496120_0012901 3300048923 Bacteria 5656
417 Ga0496121_0001544 3300048924 Bacteria 38548
418 Ga0496121_0011110 3300048924 Bacteria 10049
419 Ga0496124_0022784 3300048927 Bacteria 5734
420 Ga0496124_0318505 3300048927 Bacteria 1115
421 Ga0496125_0050035 3300048928 Bacteria 3465
422 Ga0496126_0004638 3300048929 Bacteria 16263
423 Ga0496126_0042775 3300048929 Bacteria 4182
424 Ga0501031_0010455 3300049568 Bacteria 6044
425 Ga0501032_0003416 3300049569 Bacteria 12159
426 Ga0501032_0013510 3300049569 Bacteria 5805
427 Ga0501033_0001230 3300049570 Bacteria 22966
428 Ga0501034_0000488 3300049571 Bacteria 64385
429 Ga0501034_0007155 3300049571 Bacteria 11908
430 Ga0501036_0015200 3300049572 Bacteria 6426
431 Ga0501036_0033895 3300049572 Bacteria 4319
432 Ga0501037_0003173 3300049573 Bacteria 11932
433 Ga0501037_0060828 3300049573 Bacteria 2755
434 Ga0501038_0011896 3300049574 Bacteria 7942
435 Ga0501038_0019496 3300049574 Bacteria 6112
436 Ga0501038_0027134 3300049574 Bacteria 5097
437 Ga0501038_0251056 3300049574 Bacteria 1401
438 Ga0501039_0034021 3300049575 Bacteria 3932
439 Ga0501040_0029679 3300049576 Bacteria 3693
440 Ga0501042_0047764 3300049578 Bacteria 3052
441 Ga0501043_0003943 3300049579 Bacteria 12172
442 Ga0501043_0015464 3300049579 Bacteria 5977
443 Ga0501043_0271003 3300049579 Bacteria 1303
444 Ga0501046_0005091 3300049580 Bacteria 11789
445 Ga0501047_0003010 3300049581 Bacteria 15995
446 Ga0501047_0004573 3300049581 Bacteria 13013
447 Ga0501047_0157361 3300049581 Bacteria 2145
448 Ga0501047_0187966 3300049581 Bacteria 1930
449 Ga0501048_0013723 3300049582 Bacteria 6011
450 Ga0501067_0159944 3300049583 Bacteria 1254
451 Ga0501068_0016389 3300049584 Bacteria 4272
452 Ga0501069_0018808 3300049585 Bacteria 3730
453 Ga0501070_0001442 3300049586 Bacteria 21250
454 Ga0501070_0009904 3300049586 Bacteria 8056
455 Ga0501073_0004815 3300049589 Bacteria 10129
456 Ga0501074_0262451 3300049590 Bacteria 1228
457 Ga0501079_0022506 3300049741 Bacteria 4833
458 Ga0501080_0015178 3300049742 Bacteria 7097
459 Ga0501080_0027273 3300049742 Bacteria 5312
460 Ga0501083_0013347 3300049744 Bacteria 5744
461 Ga0501083_0015680 3300049744 Bacteria 5304
462 Ga0501035_0006942 3300049822 Bacteria 10578
463 Ga0501035_0038818 3300049822 Bacteria 4310
464 Ga0501044_0003363 3300049823 Bacteria 18035
465 Ga0501044_0007886 3300049823 Bacteria 11703
466 Ga0501044_0103282 3300049823 Bacteria 2865
467 Ga0501044_0149191 3300049823 Bacteria 2321
468 Ga0501044_0264730 3300049823 Bacteria 1657
469 Ga0501045_0135018 3300049824 Bacteria 1834
470 nmdc:mga00v17_111408_c1 3300050491 Bacteria 1736
471 nmdc:mga07m45_56218_c1 3300050496 Bacteria 2224
472 nmdc:mga09592_5164_c1 3300050508 Bacteria 10606
473 nmdc:mga08y16_10921_c1 3300050511 Bacteria 9538
474 nmdc:mga08x19_62034_c1 3300050514 Bacteria 2423
475 nmdc:mga0a205_86829_c1 3300050515 Bacteria 3022
476 Ga0495601_0089996 3300053077 Bacteria 1974
477 Ga0495655_0032815 3300053083 Bacteria 1274
478 Ga0495595_0001728 3300053084 Bacteria 8542
479 Ga0495619_0000022 3300053085 Bacteria 184144
480 Ga0495619_0008692 3300053085 Bacteria 6423
481 Ga0495619_0025018 3300053085 Bacteria 3831
482 Ga0500641_0014422 3300053096 Bacteria 2917
483 Ga0500556_0000644 3300053104 Bacteria 21874
484 Ga0500568_0000032 3300053139 Bacteria 147655
485 Ga0500590_051967 3300053148 Bacteria 2081
486 Ga0500599_002653 3300053736 Bacteria 2157
487 Ga0501082_0074467 3300060353 Bacteria 2924
488 Ga0466962_0005187 3300061719 Bacteria 6270
489 Ga0466962_0146809 3300061719 Bacteria 1144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0317023 Ga0495613_0317023_16_795 251
2 3300048917 Ga0496114_0516034 Ga0496114_0516034_14_805 255
3 3300048907 Ga0496104_0473952 Ga0496104_0473952_315_1145 270
4 3300048907 Ga0496104_0100173 Ga0496104_0100173_310_1167 277
5 3300049571 Ga0501034_0007155 Ga0501034_0007155_3433_4299 279
6 3300049572 Ga0501036_0033895 Ga0501036_0033895_2885_3751 279
7 3300049574 Ga0501038_0011896 Ga0501038_0011896_2465_3331 279
8 3300049581 Ga0501047_0004573 Ga0501047_0004573_6974_7840 279
9 3300049822 Ga0501035_0006942 Ga0501035_0006942_2739_3605 279
10 3300049823 Ga0501044_0007886 Ga0501044_0007886_727_1593 279
11 3300031665 Ga0316575_10057679 Ga0316575_100576792 284
12 3300031727 Ga0316576_10054072 Ga0316576_100540722 284
13 3300031728 Ga0316578_10104212 Ga0316578_101042122 284
14 3300031733 Ga0316577_10064343 Ga0316577_100643431 284
15 3300035398 Ga0316574_0005931 Ga0316574_0005931_366_1334 284
16 3300036712 Ga0316584_0007562 Ga0316584_0007562_632_1600 284
17 3300009147 Ga0114129_10429267 Ga0114129_104292672 286
18 3300038443 Ga0395901_0256804 Ga0395901_0256804_33_911 286
19 3300044684 Ga0466966_0103634 Ga0466966_0103634_425_1309 286
20 3300048903 Ga0496100_0264148 Ga0496100_0264148_249_1142 287
21 3300025893 Ga0207682_10009340 Ga0207682_100093402 288
22 3300042146 Ga0450907_021614 Ga0450907_021614_15_968 289
23 3300049579 Ga0501043_0271003 Ga0501043_0271003_331_1269 291
24 3300005435 Ga0070714_100078053 Ga0070714_1000780532 292
25 3300006028 Ga0070717_10038018 Ga0070717_100380184 292
26 3300025928 Ga0207700_10078482 Ga0207700_100784822 292
27 3300049574 Ga0501038_0027134 Ga0501038_0027134_686_1657 294
28 3300049579 Ga0501043_0003943 Ga0501043_0003943_2293_3264 294
29 3300044693 Ga0466961_0025242 Ga0466961_0025242_362_1360 295
30 3300026023 Ga0207677_10002503 Ga0207677_100025033 296
31 3300049568 Ga0501031_0010455 Ga0501031_0010455_1599_2552 296
32 3300049569 Ga0501032_0013510 Ga0501032_0013510_1379_2332 296
33 3300049570 Ga0501033_0001230 Ga0501033_0001230_17942_18895 296
34 3300049572 Ga0501036_0015200 Ga0501036_0015200_1404_2357 296
35 3300049573 Ga0501037_0003173 Ga0501037_0003173_9379_10332 296
36 3300049574 Ga0501038_0019496 Ga0501038_0019496_3466_4419 296
37 3300049575 Ga0501039_0034021 Ga0501039_0034021_796_1749 296
38 3300049576 Ga0501040_0029679 Ga0501040_0029679_1524_2477 296
39 3300049578 Ga0501042_0047764 Ga0501042_0047764_1396_2349 296
40 3300049579 Ga0501043_0015464 Ga0501043_0015464_1523_2476 296
41 3300049580 Ga0501046_0005091 Ga0501046_0005091_1434_2387 296
42 3300049581 Ga0501047_0003010 Ga0501047_0003010_13458_14411 296
43 3300049582 Ga0501048_0013723 Ga0501048_0013723_3496_4449 296
44 3300049583 Ga0501067_0159944 Ga0501067_0159944_109_1062 296
45 3300049584 Ga0501068_0016389 Ga0501068_0016389_756_1709 296
46 3300049585 Ga0501069_0018808 Ga0501069_0018808_1119_2072 296
47 3300049586 Ga0501070_0001442 Ga0501070_0001442_9202_10155 296
48 3300049589 Ga0501073_0004815 Ga0501073_0004815_1345_2298 296
49 3300049741 Ga0501079_0022506 Ga0501079_0022506_1270_2223 296
50 3300049742 Ga0501080_0027273 Ga0501080_0027273_3384_4337 296
51 3300049744 Ga0501083_0013347 Ga0501083_0013347_1287_2240 296
52 3300049822 Ga0501035_0038818 Ga0501035_0038818_776_1729 296
53 3300049823 Ga0501044_0003363 Ga0501044_0003363_1592_2545 296
54 3300049824 Ga0501045_0135018 Ga0501045_0135018_676_1629 296
55 3300053104 Ga0500556_0000644 Ga0500556_0000644_11748_12665 296
56 3300053736 Ga0500599_002653 Ga0500599_002653_959_1876 296
57 3300060353 Ga0501082_0074467 Ga0501082_0074467_699_1652 296
58 3300006038 Ga0075365_10242647 Ga0075365_102426472 298
59 3300028379 Ga0268266_10055236 Ga0268266_100552362 298
60 3300031711 Ga0265314_10196952 Ga0265314_101969522 298
61 3300046559 Ga0495667_0114280 Ga0495667_0114280_800_1726 298
62 3300048915 Ga0496112_0045827 Ga0496112_0045827_325_1245 298
63 3300049742 Ga0501080_0015178 Ga0501080_0015178_3660_4583 298
64 3300005335 Ga0070666_10038337 Ga0070666_100383373 299
65 3300005367 Ga0070667_100128201 Ga0070667_1001282014 299
66 3300005548 Ga0070665_100051052 Ga0070665_1000510524 299
67 3300006038 Ga0075365_10050547 Ga0075365_100505472 299
68 3300006844 Ga0075428_100302719 Ga0075428_1003027192 299
69 3300006852 Ga0075433_10010907 Ga0075433_100109076 299
70 3300006871 Ga0075434_100021060 Ga0075434_1000210606 299
71 3300006914 Ga0075436_100059614 Ga0075436_1000596143 299
72 3300009094 Ga0111539_10047017 Ga0111539_100470174 299
73 3300013306 Ga0163162_10196397 Ga0163162_101963972 299
74 3300025903 Ga0207680_10005659 Ga0207680_100056594 299
75 3300025986 Ga0207658_10033339 Ga0207658_100333394 299
76 3300028379 Ga0268266_10000247 Ga0268266_1000024772 299
77 3300037466 Ga0395898_0004605 Ga0395898_0004605_3117_4043 299
78 3300037466 Ga0395898_0267589 Ga0395898_0267589_579_1505 299
79 3300037471 Ga0395905_0210047 Ga0395905_0210047_473_1399 299
80 3300038443 Ga0395901_0003181 Ga0395901_0003181_5500_6426 299
81 3300048904 Ga0496101_0067947 Ga0496101_0067947_1380_2306 299
82 3300048907 Ga0496104_0011647 Ga0496104_0011647_2923_3849 299
83 3300048907 Ga0496104_0616458 Ga0496104_0616458_54_980 299
84 3300048908 Ga0496105_0001910 Ga0496105_0001910_3494_4420 299
85 3300048912 Ga0496109_0090027 Ga0496109_0090027_113_1039 299
86 3300048912 Ga0496109_0446707 Ga0496109_0446707_165_1091 299
87 3300048915 Ga0496112_0010109 Ga0496112_0010109_3484_4410 299
88 3300048915 Ga0496112_0028414 Ga0496112_0028414_2961_3887 299
89 3300049581 Ga0501047_0157361 Ga0501047_0157361_556_1509 299
90 3300049823 Ga0501044_0103282 Ga0501044_0103282_890_1843 299
91 3300050511 nmdc:mga08y16_10921_c1 nmdc:mga08y16_10921_c1_5288_6214 299
92 3300050514 nmdc:mga08x19_62034_c1 nmdc:mga08x19_62034_c1_780_1706 299
93 3300050515 nmdc:mga0a205_86829_c1 nmdc:mga0a205_86829_c1_911_1837 299
94 3300005329 Ga0070683_100155886 Ga0070683_1001558861 300
95 3300005455 Ga0070663_100000859 Ga0070663_1000008594 300
96 3300005530 Ga0070679_100037721 Ga0070679_1000377213 300
97 3300006051 Ga0075364_10093978 Ga0075364_100939782 300
98 3300025921 Ga0207652_10000307 Ga0207652_1000030734 300
99 3300025944 Ga0207661_10028785 Ga0207661_100287852 300
100 3300026067 Ga0207678_10008282 Ga0207678_100082823 300
101 3300050491 nmdc:mga00v17_111408_c1 nmdc:mga00v17_111408_c1_311_1243 300
102 3300044901 Ga0466960_0103361 Ga0466960_0103361_517_1440 301
103 3300046523 Ga0495644_0051253 Ga0495644_0051253_428_1360 301
104 3300053083 Ga0495655_0032815 Ga0495655_0032815_76_1011 301
105 3300005616 Ga0068852_100039173 Ga0068852_1000391733 302
106 3300026142 Ga0207698_10004988 Ga0207698_100049885 302
107 3300048907 Ga0496104_0126230 Ga0496104_0126230_203_1129 302
108 3300048911 Ga0496108_0284587 Ga0496108_0284587_275_1201 302
109 3300048914 Ga0496111_0049676 Ga0496111_0049676_568_1494 302
110 3300048914 Ga0496111_0109015 Ga0496111_0109015_703_1647 302
111 3300048916 Ga0496113_0415677 Ga0496113_0415677_43_969 302
112 3300048924 Ga0496121_0001544 Ga0496121_0001544_18708_19655 302
113 3300048927 Ga0496124_0318505 Ga0496124_0318505_157_1101 302
114 3300053148 Ga0500590_051967 Ga0500590_051967_837_1772 302
115 iso_pu_bacteria 2643221617 2644102111 302
116 iso_pu_bacteria 2643221620 2644115334 302
117 iso_pu_bacteria 2738541305 2738870294 302
118 iso_pu_bacteria 2974315732 2974316489 302
119 3300005347 Ga0070668_100244320 Ga0070668_1002443202 303
120 3300005435 Ga0070714_100037632 Ga0070714_1000376323 303
121 3300005436 Ga0070713_100050180 Ga0070713_1000501802 303
122 3300005436 Ga0070713_100140360 Ga0070713_1001403602 303
123 3300005614 Ga0068856_100149750 Ga0068856_1001497502 303
124 3300009098 Ga0105245_10127864 Ga0105245_101278642 303
125 3300025898 Ga0207692_10019244 Ga0207692_100192444 303
126 3300025927 Ga0207687_10096326 Ga0207687_100963262 303
127 3300025928 Ga0207700_10068410 Ga0207700_100684102 303
128 3300025928 Ga0207700_10086654 Ga0207700_100866542 303
129 3300025929 Ga0207664_10070326 Ga0207664_100703262 303
130 3300025929 Ga0207664_10071978 Ga0207664_100719784 303
131 3300026118 Ga0207675_100120076 Ga0207675_1001200761 303
132 3300035172 Ga0373955_0035028 Ga0373955_0035028_1657_2607 303
133 3300035724 Ga0373933_0048202 Ga0373933_0048202_1147_2097 303
134 3300036401 Ga0373937_0179742 Ga0373937_0179742_773_1723 303
135 3300046455 Ga0495603_0024979 Ga0495603_0024979_515_1456 303
136 3300046459 Ga0495629_0004724 Ga0495629_0004724_5281_6219 303
137 3300046461 Ga0495641_0020863 Ga0495641_0020863_1392_2333 303
138 3300046463 Ga0495653_0022005 Ga0495653_0022005_4070_5020 303
139 3300046511 Ga0495608_0013436 Ga0495608_0013436_1306_2256 303
140 3300046516 Ga0495628_0032870 Ga0495628_0032870_378_1328 303
141 3300046529 Ga0495652_0139583 Ga0495652_0139583_493_1443 303
142 3300046536 Ga0495587_0038827 Ga0495587_0038827_1407_2357 303
143 3300046615 Ga0495656_0119711 Ga0495656_0119711_194_1135 303
144 3300046660 Ga0495625_0000405 Ga0495625_0000405_4672_5616 303
145 3300046663 Ga0495635_0056709 Ga0495635_0056709_1249_2199 303
146 3300046675 Ga0495657_0227745 Ga0495657_0227745_91_1041 303
147 3300046678 Ga0495599_0064303 Ga0495599_0064303_309_1259 303
148 3300046680 Ga0495646_0168007 Ga0495646_0168007_103_1053 303
149 3300047317 Ga0495604_0059748 Ga0495604_0059748_1767_2717 303
150 3300047319 Ga0495674_0061276 Ga0495674_0061276_307_1257 303
151 3300048088 Ga0495602_0032497 Ga0495602_0032497_2069_3019 303
152 3300048907 Ga0496104_0082565 Ga0496104_0082565_1681_2631 303
153 3300048908 Ga0496105_0011313 Ga0496105_0011313_2509_3459 303
154 3300048912 Ga0496109_0143866 Ga0496109_0143866_749_1699 303
155 3300048913 Ga0496110_0094192 Ga0496110_0094192_1523_2464 303
156 3300048914 Ga0496111_0082037 Ga0496111_0082037_1173_2114 303
157 3300048915 Ga0496112_0008431 Ga0496112_0008431_3902_4852 303
158 3300053077 Ga0495601_0089996 Ga0495601_0089996_325_1275 303
159 3300053084 Ga0495595_0001728 Ga0495595_0001728_83_1033 303
160 3300053085 Ga0495619_0008692 Ga0495619_0008692_2730_3680 303
161 3300005841 Ga0068863_100063307 Ga0068863_1000633075 304
162 3300005983 Ga0081540_1000129 Ga0081540_10001296 304
163 3300014745 Ga0157377_10105179 Ga0157377_101051792 304
164 3300025932 Ga0207690_10140296 Ga0207690_101402963 304
165 3300025935 Ga0207709_10091230 Ga0207709_100912303 304
166 3300026088 Ga0207641_10452932 Ga0207641_104529321 304
167 3300044684 Ga0466966_0041355 Ga0466966_0041355_1484_2437 304
168 3300044706 Ga0466964_0008906 Ga0466964_0008906_668_1603 304
169 3300045976 Ga0466967_0153368 Ga0466967_0153368_816_1751 304
170 3300046529 Ga0495652_0000963 Ga0495652_0000963_30229_31170 304
171 3300046533 Ga0495640_0036993 Ga0495640_0036993_1008_1949 304
172 3300046536 Ga0495587_0017319 Ga0495587_0017319_438_1427 304
173 3300047319 Ga0495674_0000010 Ga0495674_0000010_239587_240528 304
174 3300048916 Ga0496113_0037714 Ga0496113_0037714_2061_3029 304
175 3300053096 Ga0500641_0014422 Ga0500641_0014422_1675_2616 304
176 3300053139 Ga0500568_0000032 Ga0500568_0000032_2491_3462 304
177 3300061719 Ga0466962_0005187 Ga0466962_0005187_3557_4492 304
178 3300061719 Ga0466962_0146809 Ga0466962_0146809_171_1106 304
179 iso_pu_bacteria 2643221711 2644607547 304
180 iso_pu_bacteria 2811994882 2812373694 304
181 iso_pu_bacteria 2818991318 2819426307 304
182 iso_pu_bacteria 2818991462 2819691446 304
183 iso_pu_bacteria 2818991469 2819727517 304
184 3300005353 Ga0070669_100008474 Ga0070669_1000084748 305
185 3300005841 Ga0068863_100468378 Ga0068863_1004683781 305
186 3300014497 Ga0182008_10081392 Ga0182008_100813921 305
187 3300025923 Ga0207681_10006222 Ga0207681_100062222 305
188 3300044684 Ga0466966_0043899 Ga0466966_0043899_1130_2080 305
189 3300044901 Ga0466960_0032948 Ga0466960_0032948_494_1444 305
190 3300045976 Ga0466967_0044098 Ga0466967_0044098_2686_3636 305
191 iso_pu_bacteria 2565956761 2566992160 305
192 iso_pu_bacteria 2738541308 2738888348 305
193 iso_pu_bacteria 2904535858 2904538018 305
194 iso_pu_bacteria 2922554459 2922557201 305
195 3300005365 Ga0070688_100005702 Ga0070688_1000057026 306
196 3300005466 Ga0070685_10000018 Ga0070685_1000001889 306
197 3300005471 Ga0070698_100014435 Ga0070698_1000144353 306
198 3300014968 Ga0157379_10084390 Ga0157379_100843902 306
199 3300036401 Ga0373937_0132777 Ga0373937_0132777_1058_2020 306
200 3300045049 Ga0466959_0130226 Ga0466959_0130226_287_1246 306
201 3300046462 Ga0495651_0128347 Ga0495651_0128347_333_1295 306
202 3300046511 Ga0495608_0019322 Ga0495608_0019322_881_1843 306
203 3300046516 Ga0495628_0085569 Ga0495628_0085569_189_1151 306
204 3300046536 Ga0495587_0028986 Ga0495587_0028986_731_1693 306
205 3300046559 Ga0495667_0004558 Ga0495667_0004558_7749_8711 306
206 3300046675 Ga0495657_0001607 Ga0495657_0001607_2529_3491 306
207 3300046679 Ga0495623_0075488 Ga0495623_0075488_700_1662 306
208 3300046809 Ga0495600_0037813 Ga0495600_0037813_926_1888 306
209 3300047444 Ga0495675_0058871 Ga0495675_0058871_983_1945 306
210 3300048088 Ga0495602_0034084 Ga0495602_0034084_2010_2972 306
211 3300048922 Ga0496119_0027032 Ga0496119_0027032_656_1603 306
212 3300048923 Ga0496120_0012901 Ga0496120_0012901_2688_3641 306
213 3300048924 Ga0496121_0011110 Ga0496121_0011110_6428_7381 306
214 3300048929 Ga0496126_0042775 Ga0496126_0042775_1798_2748 306
215 3300049744 Ga0501083_0015680 Ga0501083_0015680_2455_3402 306
216 3300049823 Ga0501044_0264730 Ga0501044_0264730_498_1445 306
217 3300053085 Ga0495619_0025018 Ga0495619_0025018_1299_2261 306
218 3300009551 Ga0105238_10242197 Ga0105238_102421972 307
219 3300014326 Ga0157380_10001287 Ga0157380_100012871 307
220 3300044842 Ga0466957_0317545 Ga0466957_0317545_15_977 307
221 3300048921 Ga0496118_0055942 Ga0496118_0055942_1601_2551 307
222 3300049586 Ga0501070_0009904 Ga0501070_0009904_2746_3702 307
223 3300013308 Ga0157375_10051386 Ga0157375_100513864 308
224 3300014969 Ga0157376_10072535 Ga0157376_100725352 308
225 3300031727 Ga0316576_10198281 Ga0316576_101982812 308
226 3300035398 Ga0316574_0006035 Ga0316574_0006035_191_1165 308
227 3300037466 Ga0395898_0170274 Ga0395898_0170274_566_1540 308
228 3300037471 Ga0395905_0324355 Ga0395905_0324355_399_1373 308
229 3300038443 Ga0395901_0080928 Ga0395901_0080928_780_1754 308
230 3300044842 Ga0466957_0236820 Ga0466957_0236820_67_1032 308
231 3300045836 Ga0466958_0178183 Ga0466958_0178183_54_1019 308
232 3300048903 Ga0496100_0082682 Ga0496100_0082682_1019_1981 308
233 3300048905 Ga0496102_0016228 Ga0496102_0016228_3098_4051 308
234 3300048905 Ga0496102_0078635 Ga0496102_0078635_1491_2453 308
235 3300048906 Ga0496103_0074188 Ga0496103_0074188_584_1546 308
236 3300048906 Ga0496103_0162656 Ga0496103_0162656_264_1220 308
237 3300048907 Ga0496104_0081051 Ga0496104_0081051_1678_2640 308
238 3300048908 Ga0496105_0012678 Ga0496105_0012678_3956_4918 308
239 3300048910 Ga0496107_0099363 Ga0496107_0099363_59_1021 308
240 3300048911 Ga0496108_0060794 Ga0496108_0060794_691_1635 308
241 3300048912 Ga0496109_0172745 Ga0496109_0172745_321_1283 308
242 3300048913 Ga0496110_0034154 Ga0496110_0034154_3087_4061 308
243 3300048913 Ga0496110_0220100 Ga0496110_0220100_506_1468 308
244 3300048914 Ga0496111_0125473 Ga0496111_0125473_321_1283 308
245 3300048916 Ga0496113_0194175 Ga0496113_0194175_202_1176 308
246 3300048917 Ga0496114_0095133 Ga0496114_0095133_425_1387 308
247 3300048920 Ga0496117_0013864 Ga0496117_0013864_3487_4440 308
248 3300048921 Ga0496118_0004985 Ga0496118_0004985_11846_12799 308
249 3300049590 Ga0501074_0262451 Ga0501074_0262451_40_975 308
250 iso_pu_bacteria 2945941187 2945944506 308
251 3300005435 Ga0070714_100118612 Ga0070714_1001186122 309
252 3300006048 Ga0075363_100055329 Ga0075363_1000553292 309
253 3300009101 Ga0105247_10000649 Ga0105247_1000064910 309
254 3300009177 Ga0105248_10002486 Ga0105248_100024864 309
255 3300014325 Ga0163163_10029162 Ga0163163_100291623 309
256 3300014968 Ga0157379_10063437 Ga0157379_100634372 309
257 3300017792 Ga0163161_10098728 Ga0163161_100987282 309
258 3300025900 Ga0207710_10000426 Ga0207710_1000042615 309
259 3300025929 Ga0207664_10099587 Ga0207664_100995873 309
260 3300025941 Ga0207711_10003747 Ga0207711_1000374712 309
261 3300039437 Ga0436365_0724850 Ga0436365_0724850_183_1163 309
262 3300046616 Ga0495668_0001186 Ga0495668_0001186_24305_25252 309
263 3300048917 Ga0496114_0000014 Ga0496114_0000014_53405_54361 309
264 3300048918 Ga0496115_0000255 Ga0496115_0000255_25466_26422 309
265 3300048919 Ga0496116_0004412 Ga0496116_0004412_11212_12168 309
266 3300048921 Ga0496118_0033975 Ga0496118_0033975_2105_3061 309
267 3300048922 Ga0496119_0001069 Ga0496119_0001069_14227_15291 309
268 3300048922 Ga0496119_0004707 Ga0496119_0004707_1275_2231 309
269 3300048923 Ga0496120_0000954 Ga0496120_0000954_24113_25177 309
270 3300050496 nmdc:mga07m45_56218_c1 nmdc:mga07m45_56218_c1_771_1718 309
271 3300005340 Ga0070689_100231213 Ga0070689_1002312131 310
272 3300005365 Ga0070688_100005975 Ga0070688_1000059751 310
273 3300005466 Ga0070685_10001560 Ga0070685_100015603 310
274 3300005577 Ga0068857_100089264 Ga0068857_1000892642 310
275 3300009098 Ga0105245_10011020 Ga0105245_100110201 310
276 3300009148 Ga0105243_10026965 Ga0105243_100269652 310
277 3300009174 Ga0105241_10028290 Ga0105241_100282903 310
278 3300025927 Ga0207687_10006313 Ga0207687_100063138 310
279 3300025935 Ga0207709_10012655 Ga0207709_100126554 310
280 3300025936 Ga0207670_10366002 Ga0207670_103660021 310
281 3300026116 Ga0207674_10089520 Ga0207674_100895204 310
282 3300044842 Ga0466957_0066346 Ga0466957_0066346_619_1578 310
283 3300048913 Ga0496110_0000033 Ga0496110_0000033_37567_38526 310
284 3300048914 Ga0496111_0000125 Ga0496111_0000125_23901_24860 310
285 3300053085 Ga0495619_0000022 Ga0495619_0000022_151981_152940 310
286 iso_pu_bacteria 2808606370 2808894272 310
287 iso_pu_bacteria 2904776348 2904778125 310
288 iso_pu_bacteria 2910809715 2910814818 310
289 iso_pu_bacteria 2919059106 2919060178 310
290 iso_pu_bacteria 2939647034 2939650308 310
291 iso_pu_bacteria 2945920336 2945923835 310
292 iso_pu_bacteria 2946037020 2946040421 310
293 iso_pu_bacteria 2953998280 2954001686 310
294 iso_pu_bacteria 8054107350 8054109746 310
295 3300005535 Ga0070684_100049369 Ga0070684_1000493693 311
296 3300005543 Ga0070672_100000004 Ga0070672_100000004107 311
297 3300013105 Ga0157369_10011880 Ga0157369_1001188010 311
298 3300025940 Ga0207691_10000020 Ga0207691_1000002019 311
299 3300025944 Ga0207661_10059884 Ga0207661_100598842 311
300 3300046522 Ga0495643_0059295 Ga0495643_0059295_120_1205 311
301 3300048904 Ga0496101_0234649 Ga0496101_0234649_50_1105 311
302 3300048906 Ga0496103_0095568 Ga0496103_0095568_131_1216 311
303 3300048908 Ga0496105_0010789 Ga0496105_0010789_4813_5838 311
304 3300048912 Ga0496109_0065082 Ga0496109_0065082_318_1343 311
305 3300048913 Ga0496110_0019534 Ga0496110_0019534_151_1266 311
306 3300048913 Ga0496110_0065488 Ga0496110_0065488_131_1201 311
307 3300048913 Ga0496110_0106804 Ga0496110_0106804_265_1290 311
308 3300048914 Ga0496111_0010066 Ga0496111_0010066_4444_5544 311
309 3300048914 Ga0496111_0037221 Ga0496111_0037221_2312_3427 311
310 3300048917 Ga0496114_0015629 Ga0496114_0015629_5032_6057 311
311 iso_pu_bacteria 2818991458 2819665342 311
312 3300025898 Ga0207692_10046702 Ga0207692_100467022 312
313 3300048907 Ga0496104_0352886 Ga0496104_0352886_131_1216 312
314 iso_pu_bacteria 2554235227 2555230342 312
315 iso_pu_bacteria 2751185725 2753035989 312
316 iso_pu_bacteria 2751185792 2753325986 312
317 3300009098 Ga0105245_10000283 Ga0105245_1000028328 313
318 3300013306 Ga0163162_10087353 Ga0163162_100873532 313
319 3300013308 Ga0157375_10225014 Ga0157375_102250142 313
320 3300025927 Ga0207687_10000007 Ga0207687_10000007156 313
321 3300037312 Ga0395899_0054998 Ga0395899_0054998_195_1196 313
322 3300037418 Ga0395900_0045178 Ga0395900_0045178_2861_3862 313
323 3300037418 Ga0395900_0118224 Ga0395900_0118224_870_1871 313
324 3300037471 Ga0395905_0027277 Ga0395905_0027277_354_1355 313
325 3300037471 Ga0395905_0264361 Ga0395905_0264361_354_1355 313
326 3300038443 Ga0395901_0011883 Ga0395901_0011883_3265_4266 313
327 3300038443 Ga0395901_0035723 Ga0395901_0035723_896_1897 313
328 3300045976 Ga0466967_0000046 Ga0466967_0000046_34789_35808 313
329 3300047318 Ga0495636_0027125 Ga0495636_0027125_453_1553 313
330 3300048903 Ga0496100_0002534 Ga0496100_0002534_254_1354 313
331 3300048905 Ga0496102_0103738 Ga0496102_0103738_110_1210 313
332 3300048905 Ga0496102_0622148 Ga0496102_0622148_16_987 313
333 3300048906 Ga0496103_0006871 Ga0496103_0006871_228_1328 313
334 3300048909 Ga0496106_0066818 Ga0496106_0066818_959_2059 313
335 3300048910 Ga0496107_0089133 Ga0496107_0089133_297_1397 313
336 3300048912 Ga0496109_0142977 Ga0496109_0142977_251_1351 313
337 iso_pu_bacteria 2537561592 2537900890 313
338 iso_pu_bacteria 2654587600 2655033937 313
339 iso_pu_bacteria 2919391150 2919395304 313
340 iso_pu_bacteria 2945956166 2945957304 313
341 3300005331 Ga0070670_100138735 Ga0070670_1001387352 314
342 3300005335 Ga0070666_10180959 Ga0070666_101809592 314
343 3300005353 Ga0070669_100010580 Ga0070669_1000105804 314
344 3300005354 Ga0070675_100004238 Ga0070675_1000042389 314
345 3300005355 Ga0070671_100017642 Ga0070671_1000176424 314
346 3300005356 Ga0070674_100127830 Ga0070674_1001278302 314
347 3300005364 Ga0070673_100279268 Ga0070673_1002792681 314
348 3300005367 Ga0070667_100139945 Ga0070667_1001399452 314
349 3300005456 Ga0070678_100012734 Ga0070678_1000127343 314
350 3300005543 Ga0070672_100108289 Ga0070672_1001082892 314
351 3300005548 Ga0070665_100090558 Ga0070665_1000905582 314
352 3300006058 Ga0075432_10000095 Ga0075432_100000956 314
353 3300006880 Ga0075429_100006435 Ga0075429_10000643510 314
354 3300009011 Ga0105251_10014085 Ga0105251_100140856 314
355 3300009036 Ga0105244_10004517 Ga0105244_100045173 314
356 3300009036 Ga0105244_10086106 Ga0105244_100861062 314
357 3300009098 Ga0105245_10331354 Ga0105245_103313542 314
358 3300009148 Ga0105243_10064123 Ga0105243_100641233 314
359 3300009177 Ga0105248_10051753 Ga0105248_100517535 314
360 3300011119 Ga0105246_10013664 Ga0105246_100136646 314
361 3300013105 Ga0157369_10128563 Ga0157369_101285632 314
362 3300013306 Ga0163162_10166688 Ga0163162_101666882 314
363 3300025315 Ga0207697_10000412 Ga0207697_1000041225 314
364 3300025315 Ga0207697_10000805 Ga0207697_1000080512 314
365 3300025728 Ga0207655_1001561 Ga0207655_100156115 314
366 3300025728 Ga0207655_1015236 Ga0207655_10152362 314
367 3300025728 Ga0207655_1072177 Ga0207655_10721771 314
368 3300025735 Ga0207713_1035501 Ga0207713_10355011 314
369 3300025903 Ga0207680_10015104 Ga0207680_100151044 314
370 3300025907 Ga0207645_10011034 Ga0207645_100110344 314
371 3300025925 Ga0207650_10017213 Ga0207650_100172137 314
372 3300025927 Ga0207687_10183817 Ga0207687_101838171 314
373 3300025935 Ga0207709_10204160 Ga0207709_102041601 314
374 3300025940 Ga0207691_10004975 Ga0207691_100049753 314
375 3300025941 Ga0207711_10033740 Ga0207711_100337404 314
376 3300026121 Ga0207683_10010818 Ga0207683_100108189 314
377 3300028379 Ga0268266_10216492 Ga0268266_102164922 314
378 3300031548 Ga0307408_100023549 Ga0307408_1000235492 314
379 3300031548 Ga0307408_100040648 Ga0307408_1000406482 314
380 3300031548 Ga0307408_100111811 Ga0307408_1001118112 314
381 3300031548 Ga0307408_100291219 Ga0307408_1002912191 314
382 3300031731 Ga0307405_10011780 Ga0307405_100117805 314
383 3300031731 Ga0307405_10036506 Ga0307405_100365062 314
384 3300031731 Ga0307405_10119569 Ga0307405_101195692 314
385 3300031731 Ga0307405_10270291 Ga0307405_102702911 314
386 3300031824 Ga0307413_10034494 Ga0307413_100344942 314
387 3300031824 Ga0307413_10174299 Ga0307413_101742992 314
388 3300031852 Ga0307410_10013862 Ga0307410_100138622 314
389 3300031852 Ga0307410_10020455 Ga0307410_100204551 314
390 3300031852 Ga0307410_10053308 Ga0307410_100533083 314
391 3300031852 Ga0307410_10070214 Ga0307410_100702142 314
392 3300031852 Ga0307410_10218937 Ga0307410_102189372 314
393 3300031901 Ga0307406_10358366 Ga0307406_103583661 314
394 3300031903 Ga0307407_10080587 Ga0307407_100805872 314
395 3300031903 Ga0307407_10260019 Ga0307407_102600192 314
396 3300031911 Ga0307412_10013690 Ga0307412_100136904 314
397 3300031911 Ga0307412_10037005 Ga0307412_100370052 314
398 3300031911 Ga0307412_10064761 Ga0307412_100647612 314
399 3300031911 Ga0307412_10091620 Ga0307412_100916202 314
400 3300031995 Ga0307409_100012546 Ga0307409_1000125461 314
401 3300031995 Ga0307409_100071534 Ga0307409_1000715342 314
402 3300031995 Ga0307409_100481273 Ga0307409_1004812731 314
403 3300032002 Ga0307416_100010248 Ga0307416_1000102483 314
404 3300032002 Ga0307416_100137154 Ga0307416_1001371543 314
405 3300032002 Ga0307416_100196760 Ga0307416_1001967602 314
406 3300032004 Ga0307414_10073426 Ga0307414_100734261 314
407 3300032126 Ga0307415_100141554 Ga0307415_1001415542 314
408 3300032126 Ga0307415_100184087 Ga0307415_1001840871 314
409 3300041404 Ga0439436_0007508 Ga0439436_0007508_883_1917 314
410 3300041999 Ga0439433_0000691 Ga0439433_0000691_2016_3050 314
411 3300042002 Ga0439442_001124 Ga0439442_001124_2367_3401 314
412 3300042002 Ga0439442_007323 Ga0439442_007323_427_1461 314
413 3300042007 Ga0439449_0002127 Ga0439449_0002127_1429_2463 314
414 3300042122 Ga0450920_005486 Ga0450920_005486_599_1633 314
415 3300042435 Ga0439434_0051787 Ga0439434_0051787_106_1140 314
416 3300046463 Ga0495653_0009152 Ga0495653_0009152_251_1303 314
417 3300046476 Ga0495662_0009886 Ga0495662_0009886_708_1790 314
418 3300046477 Ga0495664_0006098 Ga0495664_0006098_2713_3795 314
419 3300046517 Ga0495630_0053754 Ga0495630_0053754_642_1694 314
420 3300046531 Ga0495665_0004768 Ga0495665_0004768_4855_5835 314
421 3300046531 Ga0495665_0009914 Ga0495665_0009914_3087_4169 314
422 3300046535 Ga0495586_0001117 Ga0495586_0001117_11875_12927 314
423 3300046535 Ga0495586_0074036 Ga0495586_0074036_595_1644 314
424 3300046536 Ga0495587_0001817 Ga0495587_0001817_12926_14008 314
425 3300046543 Ga0495645_0010369 Ga0495645_0010369_5326_6378 314
426 3300046663 Ga0495635_0013408 Ga0495635_0013408_3486_4538 314
427 3300046674 Ga0495588_0050607 Ga0495588_0050607_541_1521 314
428 3300046674 Ga0495588_0084628 Ga0495588_0084628_146_1186 314
429 3300046675 Ga0495657_0088487 Ga0495657_0088487_670_1752 314
430 3300047315 Ga0495581_0002683 Ga0495581_0002683_4414_5394 314
431 3300047315 Ga0495581_0020363 Ga0495581_0020363_781_1806 314
432 3300047315 Ga0495581_0086250 Ga0495581_0086250_155_1180 314
433 3300047317 Ga0495604_0074833 Ga0495604_0074833_1002_2084 314
434 3300047322 Ga0495680_0031417 Ga0495680_0031417_437_1489 314
435 3300047447 Ga0495685_050541 Ga0495685_050541_178_1218 314
436 3300047470 Ga0495681_0092848 Ga0495681_0092848_145_1215 314
437 3300048904 Ga0496101_0106070 Ga0496101_0106070_107_1132 314
438 3300048906 Ga0496103_0193503 Ga0496103_0193503_176_1201 314
439 3300048910 Ga0496107_0101513 Ga0496107_0101513_107_1132 314
440 3300048913 Ga0496110_0150154 Ga0496110_0150154_107_1132 314
441 3300048914 Ga0496111_0052692 Ga0496111_0052692_978_2003 314
442 3300048917 Ga0496114_0043091 Ga0496114_0043091_130_1155 314
443 3300048927 Ga0496124_0022784 Ga0496124_0022784_3436_4461 314
444 3300048928 Ga0496125_0050035 Ga0496125_0050035_1722_2747 314
445 3300049571 Ga0501034_0000488 Ga0501034_0000488_47074_48087 314
446 3300049573 Ga0501037_0060828 Ga0501037_0060828_735_1748 314
447 3300050508 nmdc:mga09592_5164_c1 nmdc:mga09592_5164_c1_8459_9439 314
448 3300005436 Ga0070713_100001904 Ga0070713_1000019041 315
449 3300042531 Ga0450918_000907 Ga0450918_000907_1848_2894 315
450 3300025303 Ga0209051_1014337 Ga0209051_10143373 316
451 3300031911 Ga0307412_10080167 Ga0307412_100801672 316
452 3300038443 Ga0395901_0524316 Ga0395901_0524316_129_1118 316
453 3300044842 Ga0466957_0203217 Ga0466957_0203217_275_1285 316
454 3300045049 Ga0466959_0094148 Ga0466959_0094148_237_1247 316
455 3300046535 Ga0495586_0005810 Ga0495586_0005810_4050_5039 316
456 3300031548 Ga0307408_100013782 Ga0307408_1000137823 317
457 3300031731 Ga0307405_10053912 Ga0307405_100539123 317
458 3300031731 Ga0307405_10154368 Ga0307405_101543682 317
459 3300031852 Ga0307410_10084101 Ga0307410_100841011 317
460 3300031903 Ga0307407_10152675 Ga0307407_101526752 317
461 3300031903 Ga0307407_10197490 Ga0307407_101974901 317
462 3300032002 Ga0307416_100029141 Ga0307416_1000291413 317
463 3300032005 Ga0307411_10074238 Ga0307411_100742383 317
464 3300032005 Ga0307411_10089306 Ga0307411_100893062 317
465 3300037312 Ga0395899_0026430 Ga0395899_0026430_2155_3201 317
466 3300037418 Ga0395900_0037495 Ga0395900_0037495_3821_4867 317
467 3300037466 Ga0395898_0078315 Ga0395898_0078315_141_1187 317
468 3300038443 Ga0395901_0371763 Ga0395901_0371763_296_1342 317
469 3300041405 Ga0439438_038191 Ga0439438_038191_15_1067 317
470 3300003320 rootH2_10085513 rootH2_100855132 318
471 3300031548 Ga0307408_100055570 Ga0307408_1000555702 318
472 3300031852 Ga0307410_10010463 Ga0307410_100104634 318
473 3300031901 Ga0307406_10017791 Ga0307406_100177912 318
474 3300049569 Ga0501032_0003416 Ga0501032_0003416_7196_8383 318
475 3300049574 Ga0501038_0251056 Ga0501038_0251056_123_1310 318
476 3300037418 Ga0395900_0033677 Ga0395900_0033677_2550_3593 319
477 3300037466 Ga0395898_0017201 Ga0395898_0017201_4547_5590 319
478 3300042002 Ga0439442_000626 Ga0439442_000626_4172_5233 319
479 3300048906 Ga0496103_0212618 Ga0496103_0212618_158_1225 319
480 3300048910 Ga0496107_0066381 Ga0496107_0066381_48_1115 319
481 3300009093 Ga0105240_10494751 Ga0105240_104947512 321
482 3300031251 Ga0265327_10000185 Ga0265327_100001855 321
483 iso_pu_bacteria 2643221616 2644094552 321
484 3300045976 Ga0466967_0000612 Ga0466967_0000612_494_1483 324
485 3300045976 Ga0466967_0009345 Ga0466967_0009345_2553_3542 324
486 3300044658 Ga0466972_0030217 Ga0466972_0030217_1593_2585 325
487 3300044683 Ga0466965_0033576 Ga0466965_0033576_515_1507 325
488 3300044684 Ga0466966_0020935 Ga0466966_0020935_1145_2134 325
489 3300044693 Ga0466961_0009077 Ga0466961_0009077_3239_4228 325
490 3300044693 Ga0466961_0072357 Ga0466961_0072357_101_1090 325
491 3300044694 Ga0466963_0039236 Ga0466963_0039236_1083_2075 325
492 3300044706 Ga0466964_0017579 Ga0466964_0017579_1026_2018 325
493 3300044719 Ga0466971_0019650 Ga0466971_0019650_1391_2383 325
494 3300044842 Ga0466957_0009318 Ga0466957_0009318_525_1517 325
495 3300044842 Ga0466957_0038853 Ga0466957_0038853_1426_2424 325
496 3300045049 Ga0466959_0054389 Ga0466959_0054389_795_1793 325
497 3300045836 Ga0466958_0033163 Ga0466958_0033163_1058_2050 325
498 3300045976 Ga0466967_0005868 Ga0466967_0005868_4103_5101 325
499 3300045976 Ga0466967_0572783 Ga0466967_0572783_80_1072 325
500 3300049581 Ga0501047_0187966 Ga0501047_0187966_731_1723 325
501 3300049823 Ga0501044_0149191 Ga0501044_0149191_781_1773 325
502 3300005563 Ga0068855_100009285 Ga0068855_1000092859 326
503 3300009545 Ga0105237_10087995 Ga0105237_100879952 326
504 3300025914 Ga0207671_10015734 Ga0207671_100157342 326
505 3300025949 Ga0207667_10017456 Ga0207667_100174565 326
506 3300005445 Ga0070708_100283441 Ga0070708_1002834412 327
507 3300005467 Ga0070706_100099689 Ga0070706_1000996892 327
508 3300005468 Ga0070707_100158946 Ga0070707_1001589462 327
509 3300005471 Ga0070698_100128061 Ga0070698_1001280612 327
510 3300005518 Ga0070699_100031996 Ga0070699_1000319962 327
511 3300006028 Ga0070717_10083773 Ga0070717_100837732 327
512 3300025910 Ga0207684_10053071 Ga0207684_100530713 327
513 3300044694 Ga0466963_0073702 Ga0466963_0073702_1091_2080 328
514 3300045976 Ga0466967_0061255 Ga0466967_0061255_163_1152 328
515 3300048929 Ga0496126_0004638 Ga0496126_0004638_8411_9469 328
516 iso_pu_bacteria 2884763398 2884764023 328
517 3300002737 JGI25162J39368_1010273 JGI25162J39368_10102731 332
518 3300002772 JGI25164J39214_1001102 JGI25164J39214_10011022 332
519 3300003214 JGI25165J46597_1000014 JGI25165J46597_1000014113 332
520 3300025231 Ga0207427_100121 Ga0207427_1001212 332
521 3300025233 Ga0209437_100398 Ga0209437_1003982 332
522 3300025261 Ga0209233_1000014 Ga0209233_1000014521 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

67

343

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9393 23 318
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9335 24 318
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9293 24 321
5h8j-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9288 23 318
5h8l-assembly2.cif.gz_I crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.926 23 320
ID Description Score Start End Superfamily
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9213 22 321 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9168 27 320 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9125 29 318 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9018 29 313 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9009 22 321 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A0A6UK21-F1-model_v4 Hydrolase 0.9804 3 316 GO:0033388
GO:0050126
AF-A0A0A6UK21-F1-model_v4 Hydrolase 0.974 3 316 GO:0033388
GO:0050126
AF-A0A127A5F8-F1-model_v4 Hydrolase 0.9729 3 319 GO:0033388
GO:0050126
AF-A0A352B1E9-F1-model_v4 Hydrolase 0.9717 36 318 GO:0033388
GO:0050126
AF-A0A4Z1CGV4-F1-model_v4 Hydrolase 0.9657 3 324 GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
92.05 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map