F458907

General Info

Members Datasets Scaffolds Average Seq Length
522 183 1044 226

Family's Representative Sequence

Representative Sequence 3300049667|Ga0501230_003102|Ga0501230_003102_603_1340
Length 245
Sequence MMKKPVLAVALLAAIPMGAASAADIDLVEQARDGGVALLAILALSVLMLAVALERLLHLRPRHVVPPGLADAVLPLWRAGEFARTELELTGQDSTLARIIAYLAAHRHLDYARVSSGAADIASLELRRHQQKFYALSIVATVAPIVGLLGTVLGMIEAFHVIAFADGMGNPALLAGGISKALVNTAAGLCVALPALGMHHFLKHRTAMLALALEQDVNRLLQACFPPRAPGQASQPGLQVVPHAH

Samples

Sample ID Description Type Environment
1 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2643221556 Massilia sp. Root1485 Isolate Unclassified
182 2643221684 Massilia sp. Root133 Isolate Unclassified
183 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 5.17
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501230_003102 3300049667 Bacteria 2178
2 rootH1_10014334 3300003316 Bacteria 20021
3 rootL2_10003893 3300003322 Bacteria 19760
4 rootL2_10024668 3300003322 Bacteria 3611
5 Ga0055525_1000006 3300003759 Bacteria 642912
6 Ga0055525_1000028 3300003759 Bacteria 331683
7 Ga0055530_10029897 3300003791 Bacteria 1450
8 Ga0055531_10000381 3300003794 Bacteria 42797
9 Ga0065165_1011896 3300005262 Bacteria 3582
10 Ga0065165_1022592 3300005262 Bacteria 2153
11 Ga0070658_10026667 3300005327 Bacteria 4637
12 Ga0070658_10042494 3300005327 Bacteria 3671
13 Ga0070658_10133909 3300005327 Bacteria 2067
14 Ga0070682_100235410 3300005337 Bacteria 1312
15 Ga0070660_100001131 3300005339 Bacteria 17999
16 Ga0070660_100099096 3300005339 Bacteria 2307
17 Ga0070660_100486769 3300005339 Bacteria 1025
18 Ga0070659_100014912 3300005366 Bacteria 5813
19 Ga0070659_100054413 3300005366 Bacteria 3152
20 Ga0070659_100086321 3300005366 Bacteria 2511
21 Ga0070662_100080773 3300005457 Bacteria 2421
22 Ga0070662_100173360 3300005457 Bacteria 1696
23 Ga0070662_100240484 3300005457 Bacteria 1452
24 Ga0070679_100605407 3300005530 Bacteria 1039
25 Ga0068855_100012116 3300005563 Bacteria 10419
26 Ga0068855_100360955 3300005563 Bacteria 1598
27 Ga0070664_100002839 3300005564 Bacteria 14014
28 Ga0070664_100055972 3300005564 Bacteria 3351
29 Ga0070664_100069110 3300005564 Bacteria 3021
30 Ga0070664_100275872 3300005564 Bacteria 1515
31 Ga0070664_100358493 3300005564 Bacteria 1328
32 Ga0070664_100571080 3300005564 Bacteria 1047
33 Ga0068852_100063749 3300005616 Bacteria 3210
34 Ga0068852_100710427 3300005616 Bacteria 1016
35 Ga0097621_100380705 3300006237 Bacteria 1260
36 Ga0068871_100322306 3300006358 Bacteria 1361
37 Ga0105244_10001057 3300009036 Bacteria 23037
38 Ga0105245_10487020 3300009098 Bacteria 1247
39 Ga0105243_10060322 3300009148 Bacteria 3030
40 Ga0105243_10167199 3300009148 Bacteria 1902
41 Ga0105242_10026891 3300009176 Bacteria 4563
42 Ga0105237_10388936 3300009545 Bacteria 1400
43 Ga0105238_10381757 3300009551 Bacteria 1400
44 Ga0105239_10116292 3300010375 Bacteria 2968
45 Ga0105246_10108918 3300011119 Bacteria 2031
46 Ga0105246_10827440 3300011119 Bacteria 824
47 Ga0157369_10997828 3300013105 Bacteria 857
48 Ga0157372_10203018 3300013307 Bacteria 2296
49 Ga0157372_10288261 3300013307 Bacteria 1909
50 Ga0157372_10338393 3300013307 Bacteria 1753
51 Ga0157376_10372945 3300014969 Bacteria 1372
52 Ga0182007_10107836 3300015262 Bacteria 925
53 Ga0213872_10000018 3300021361 Bacteria 175951
54 Ga0213872_10077866 3300021361 Bacteria 1490
55 Ga0209563_100011 3300025230 Bacteria 1187808
56 Ga0209563_100022 3300025230 Bacteria 643318
57 Ga0209677_101675 3300025253 Bacteria 9273
58 Ga0209677_103102 3300025253 Bacteria 5653
59 Ga0209148_1000585 3300025254 Bacteria 33334
60 Ga0209050_1005124 3300025298 Bacteria 8422
61 Ga0209257_1000117 3300025304 Bacteria 227328
62 Ga0207655_1001365 3300025728 Bacteria 22873
63 Ga0207705_10000223 3300025909 Bacteria 56633
64 Ga0207705_10088477 3300025909 Bacteria 2266
65 Ga0207705_10160197 3300025909 Bacteria 1690
66 Ga0207695_10434172 3300025913 Bacteria 1197
67 Ga0207657_10004042 3300025919 Bacteria 15582
68 Ga0207657_10011356 3300025919 Bacteria 8847
69 Ga0207657_10028267 3300025919 Bacteria 5118
70 Ga0207649_10296175 3300025920 Bacteria 1181
71 Ga0207652_10724460 3300025921 Bacteria 886
72 Ga0207694_10524844 3300025924 Bacteria 992
73 Ga0207690_10033805 3300025932 Bacteria 3290
74 Ga0207690_10065047 3300025932 Bacteria 2492
75 Ga0207690_10069123 3300025932 Bacteria 2429
76 Ga0207706_10082359 3300025933 Bacteria 2828
77 Ga0207706_10102626 3300025933 Bacteria 2516
78 Ga0207706_10124924 3300025933 Bacteria 2263
79 Ga0207706_10130199 3300025933 Bacteria 2213
80 Ga0207706_10197186 3300025933 Bacteria 1766
81 Ga0207686_10013226 3300025934 Bacteria 4563
82 Ga0207686_10207439 3300025934 Bacteria 1407
83 Ga0207686_10490247 3300025934 Bacteria 952
84 Ga0207709_10101567 3300025935 Bacteria 1902
85 Ga0207679_10101077 3300025945 Bacteria 2255
86 Ga0207679_10117391 3300025945 Bacteria 2111
87 Ga0207679_10128465 3300025945 Bacteria 2029
88 Ga0207679_10270406 3300025945 Bacteria 1453
89 Ga0207679_10571212 3300025945 Bacteria 1016
90 Ga0207667_10006615 3300025949 Bacteria 14011
91 Ga0207702_10480140 3300026078 Bacteria 1209
92 Ga0207648_10391250 3300026089 Bacteria 1258
93 Ga0207674_10362160 3300026116 Bacteria 1402
94 Ga0207698_10085401 3300026142 Bacteria 2563
95 Ga0207698_10420763 3300026142 Bacteria 1282
96 Ga0265331_10001540 3300031250 Bacteria 16957
97 Ga0265327_10000012 3300031251 Bacteria 530403
98 Ga0395899_0001188 3300037312 Bacteria 22947
99 Ga0395899_0007019 3300037312 Bacteria 8716
100 Ga0395899_0009427 3300037312 Bacteria 7498
101 Ga0395899_0013898 3300037312 Bacteria 6149
102 Ga0395899_0028424 3300037312 Bacteria 4210
103 Ga0395899_0085535 3300037312 Bacteria 2291
104 Ga0395900_0000307 3300037418 Bacteria 72665
105 Ga0395900_0000497 3300037418 Bacteria 55302
106 Ga0395900_0000600 3300037418 Bacteria 49320
107 Ga0395900_0001987 3300037418 Bacteria 23090
108 Ga0395900_0002248 3300037418 Bacteria 21475
109 Ga0395900_0012205 3300037418 Bacteria 8782
110 Ga0395900_0013824 3300037418 Bacteria 8237
111 Ga0395900_0022519 3300037418 Bacteria 6445
112 Ga0395900_0071136 3300037418 Bacteria 3575
113 Ga0395900_0175798 3300037418 Bacteria 2177
114 Ga0395900_0209857 3300037418 Bacteria 1967
115 Ga0395900_0224154 3300037418 Bacteria 1893
116 Ga0395900_0270906 3300037418 Bacteria 1692
117 Ga0395900_0798256 3300037418 Bacteria 872
118 Ga0395898_0005084 3300037466 Bacteria 14256
119 Ga0395898_0025962 3300037466 Bacteria 5899
120 Ga0395898_0141584 3300037466 Bacteria 2302
121 Ga0395898_0618811 3300037466 Bacteria 1025
122 Ga0395905_0016771 3300037471 Bacteria 6961
123 Ga0395905_0039956 3300037471 Bacteria 4401
124 Ga0395905_0049473 3300037471 Bacteria 3939
125 Ga0395905_0085717 3300037471 Bacteria 2951
126 Ga0395905_0102436 3300037471 Bacteria 2687
127 Ga0395905_0216512 3300037471 Bacteria 1793
128 Ga0395905_0571161 3300037471 Bacteria 1032
129 Ga0395905_0613985 3300037471 Bacteria 989
130 Ga0395901_0000527 3300038443 Bacteria 44065
131 Ga0395901_0020093 3300038443 Bacteria 6835
132 Ga0395901_0025173 3300038443 Bacteria 6109
133 Ga0395901_0039956 3300038443 Bacteria 4856
134 Ga0395901_0044346 3300038443 Bacteria 4612
135 Ga0395901_0216779 3300038443 Bacteria 2001
136 Ga0395901_0550353 3300038443 Bacteria 1169
137 Ga0436361_0677882 3300039447 Bacteria 228834
138 Ga0436361_0726241 3300039447 Bacteria 1197
139 Ga0436361_1008129 3300039447 Bacteria 10091
140 Ga0451793_1621807 3300041452 Bacteria 1344
141 Ga0439448_0000130 3300042005 Bacteria 14231
142 Ga0439448_0000705 3300042005 Bacteria 8020
143 Ga0439448_0016699 3300042005 Bacteria 2236
144 Ga0439448_0045872 3300042005 Bacteria 1423
145 Ga0439448_0159174 3300042005 Bacteria 785
146 Ga0439449_0053979 3300042007 Bacteria 1485
147 Ga0439450_048737 3300042008 Bacteria 1001
148 Ga0439455_0002445 3300042012 Bacteria 3379
149 Ga0439455_0007397 3300042012 Bacteria 2321
150 Ga0439455_0082935 3300042012 Bacteria 873
151 Ga0439458_0007751 3300042157 Bacteria 2391
152 Ga0439458_0010382 3300042157 Bacteria 2077
153 Ga0466969_0000007 3300044656 Bacteria 152114
154 Ga0466972_0005938 3300044658 Bacteria 6130
155 Ga0466965_0006317 3300044683 Bacteria 5370
156 Ga0466966_0004210 3300044684 Bacteria 9492
157 Ga0466966_0019471 3300044684 Bacteria 4465
158 Ga0466966_0023372 3300044684 Bacteria 4047
159 Ga0466966_0078300 3300044684 Bacteria 2061
160 Ga0466966_0203483 3300044684 Bacteria 1197
161 Ga0466961_0263541 3300044693 Bacteria 1056
162 Ga0466963_0003457 3300044694 Bacteria 9048
163 Ga0466963_0284196 3300044694 Bacteria 1163
164 Ga0466964_0000759 3300044706 Bacteria 10500
165 Ga0466964_0063789 3300044706 Bacteria 1539
166 Ga0466964_0104969 3300044706 Bacteria 1252
167 Ga0466971_0165469 3300044719 Bacteria 1036
168 Ga0466968_0000954 3300044735 Bacteria 10180
169 Ga0466968_0216447 3300044735 Bacteria 901
170 Ga0466970_0472202 3300044765 Bacteria 720
171 Ga0466957_0000005 3300044842 Bacteria 102026
172 Ga0466957_0003769 3300044842 Bacteria 8379
173 Ga0466957_0017236 3300044842 Bacteria 4228
174 Ga0466957_0174227 3300044842 Bacteria 1402
175 Ga0466960_0013823 3300044901 Bacteria 3439
176 Ga0466959_0019207 3300045049 Bacteria 5025
177 Ga0466959_0036851 3300045049 Bacteria 3613
178 Ga0466959_0064019 3300045049 Bacteria 2670
179 Ga0466959_0221346 3300045049 Bacteria 1312
180 Ga0466958_0035281 3300045836 Bacteria 2987
181 Ga0466958_0071792 3300045836 Bacteria 2120
182 Ga0466958_0104601 3300045836 Bacteria 1763
183 Ga0466958_0411393 3300045836 Bacteria 874
184 Ga0466967_0026590 3300045976 Bacteria 4795
185 Ga0466967_0037968 3300045976 Bacteria 4127
186 Ga0466967_0144204 3300045976 Bacteria 2220
187 Ga0495617_000014 3300046452 Bacteria 286979
188 Ga0495627_000780 3300046453 Bacteria 23533
189 Ga0495627_008384 3300046453 Bacteria 3880
190 Ga0495627_017772 3300046453 Bacteria 2409
191 Ga0495603_0087722 3300046455 Bacteria 1820
192 Ga0495590_0000006 3300046457 Bacteria 372949
193 Ga0495590_0001082 3300046457 Bacteria 11989
194 Ga0495590_0019679 3300046457 Bacteria 2402
195 Ga0495591_009562 3300046458 Bacteria 3838
196 Ga0495629_0096104 3300046459 Bacteria 2066
197 Ga0495638_0261994 3300046460 Bacteria 948
198 Ga0495653_0001765 3300046463 Bacteria 17044
199 Ga0495653_0094383 3300046463 Bacteria 2180
200 Ga0495650_0000108 3300046471 Bacteria 200369
201 Ga0495582_0000427 3300046473 Bacteria 23024
202 Ga0495582_0032136 3300046473 Bacteria 2887
203 Ga0495605_0000110 3300046474 Bacteria 104425
204 Ga0495605_0000118 3300046474 Bacteria 102724
205 Ga0495605_0009889 3300046474 Bacteria 5348
206 Ga0495605_0014861 3300046474 Bacteria 4249
207 Ga0495605_0024258 3300046474 Bacteria 3176
208 Ga0495605_0024452 3300046474 Bacteria 3160
209 Ga0495605_0046885 3300046474 Bacteria 2122
210 Ga0495584_0001874 3300046491 Bacteria 12156
211 Ga0495584_0002423 3300046491 Bacteria 10576
212 Ga0495584_0009021 3300046491 Bacteria 5153
213 Ga0495584_0009274 3300046491 Bacteria 5072
214 Ga0495584_0038870 3300046491 Bacteria 2404
215 Ga0495584_0109197 3300046491 Bacteria 1399
216 Ga0495585_0009918 3300046492 Bacteria 5690
217 Ga0495585_0013227 3300046492 Bacteria 4834
218 Ga0495585_0013625 3300046492 Bacteria 4753
219 Ga0495585_0018244 3300046492 Bacteria 4049
220 Ga0495585_0041458 3300046492 Bacteria 2581
221 Ga0495585_0059188 3300046492 Bacteria 2111
222 Ga0495585_0284440 3300046492 Bacteria 816
223 Ga0495585_0312795 3300046492 Bacteria 769
224 Ga0495594_0019250 3300046499 Bacteria 3626
225 Ga0495594_0072680 3300046499 Bacteria 1913
226 Ga0495596_0004363 3300046500 Bacteria 6910
227 Ga0495596_0008387 3300046500 Bacteria 4602
228 Ga0495596_0009330 3300046500 Bacteria 4318
229 Ga0495596_0011518 3300046500 Bacteria 3811
230 Ga0495596_0011795 3300046500 Bacteria 3753
231 Ga0495596_0015447 3300046500 Bacteria 3196
232 Ga0495596_0016613 3300046500 Bacteria 3054
233 Ga0495596_0031492 3300046500 Bacteria 2118
234 Ga0495596_0042755 3300046500 Bacteria 1785
235 Ga0495596_0104747 3300046500 Bacteria 1098
236 Ga0495607_0004432 3300046501 Bacteria 10324
237 Ga0495607_0004748 3300046501 Bacteria 9936
238 Ga0495607_0005340 3300046501 Bacteria 9231
239 Ga0495607_0005448 3300046501 Bacteria 9106
240 Ga0495607_0015621 3300046501 Bacteria 4917
241 Ga0495607_0015663 3300046501 Bacteria 4908
242 Ga0495607_0020231 3300046501 Bacteria 4212
243 Ga0495607_0020905 3300046501 Bacteria 4125
244 Ga0495607_0032073 3300046501 Bacteria 3210
245 Ga0495607_0060957 3300046501 Bacteria 2145
246 Ga0495607_0227282 3300046501 Bacteria 909
247 Ga0495583_0001075 3300046506 Bacteria 30534
248 Ga0495583_0006145 3300046506 Bacteria 7913
249 Ga0495583_0126594 3300046506 Bacteria 1071
250 Ga0495583_0199109 3300046506 Bacteria 814
251 Ga0495606_0000046 3300046507 Bacteria 210855
252 Ga0495606_0000458 3300046507 Bacteria 66935
253 Ga0495606_0012627 3300046507 Bacteria 6751
254 Ga0495606_0017427 3300046507 Bacteria 5432
255 Ga0495606_0027196 3300046507 Bacteria 4061
256 Ga0495606_0088103 3300046507 Bacteria 1914
257 Ga0495610_0001713 3300046512 Bacteria 19221
258 Ga0495616_0000088 3300046513 Bacteria 77629
259 Ga0495616_0001119 3300046513 Bacteria 19010
260 Ga0495616_0003638 3300046513 Bacteria 9845
261 Ga0495616_0004891 3300046513 Bacteria 8375
262 Ga0495616_0010672 3300046513 Bacteria 5306
263 Ga0495616_0011234 3300046513 Bacteria 5140
264 Ga0495616_0024955 3300046513 Bacteria 3199
265 Ga0495616_0028096 3300046513 Bacteria 2980
266 Ga0495616_0076819 3300046513 Bacteria 1604
267 Ga0495616_0085839 3300046513 Bacteria 1498
268 Ga0495616_0303873 3300046513 Bacteria 673
269 Ga0495630_0060588 3300046517 Bacteria 2841
270 Ga0495631_0002058 3300046518 Bacteria 11722
271 Ga0495631_0006518 3300046518 Bacteria 6021
272 Ga0495631_0012507 3300046518 Bacteria 4142
273 Ga0495631_0016260 3300046518 Bacteria 3552
274 Ga0495631_0018775 3300046518 Bacteria 3251
275 Ga0495631_0020790 3300046518 Bacteria 3061
276 Ga0495631_0045182 3300046518 Bacteria 1939
277 Ga0495631_0050182 3300046518 Bacteria 1825
278 Ga0495631_0057090 3300046518 Bacteria 1699
279 Ga0495632_0000041 3300046519 Bacteria 145509
280 Ga0495632_0002462 3300046519 Bacteria 14088
281 Ga0495632_0002478 3300046519 Bacteria 14021
282 Ga0495632_0002700 3300046519 Bacteria 13248
283 Ga0495637_0054178 3300046520 Bacteria 1667
284 Ga0495637_0089855 3300046520 Bacteria 1213
285 Ga0495643_0003305 3300046522 Bacteria 11911
286 Ga0495643_0033227 3300046522 Bacteria 2856
287 Ga0495643_0036268 3300046522 Bacteria 2710
288 Ga0495643_0043812 3300046522 Bacteria 2433
289 Ga0495644_0011479 3300046523 Bacteria 3410
290 Ga0495644_0094592 3300046523 Bacteria 1128
291 Ga0495648_0003276 3300046524 Bacteria 14328
292 Ga0495648_0006050 3300046524 Bacteria 9928
293 Ga0495648_0006756 3300046524 Bacteria 9276
294 Ga0495648_0016175 3300046524 Bacteria 5383
295 Ga0495648_0058121 3300046524 Bacteria 2314
296 Ga0495648_0058134 3300046524 Bacteria 2314
297 Ga0495663_0037801 3300046525 Bacteria 1457
298 Ga0495666_0061475 3300046526 Bacteria 1794
299 Ga0495642_0000017 3300046528 Bacteria 111313
300 Ga0495642_0003740 3300046528 Bacteria 5959
301 Ga0495642_0004962 3300046528 Bacteria 5127
302 Ga0495642_0017269 3300046528 Bacteria 2819
303 Ga0495642_0027271 3300046528 Bacteria 2272
304 Ga0495642_0092936 3300046528 Bacteria 1278
305 Ga0495642_0160874 3300046528 Bacteria 973
306 Ga0495652_0052272 3300046529 Bacteria 3485
307 Ga0495654_0086512 3300046530 Bacteria 1460
308 Ga0495587_0053278 3300046536 Bacteria 2385
309 Ga0495609_0000009 3300046538 Bacteria 354860
310 Ga0495609_0001192 3300046538 Bacteria 17878
311 Ga0495609_0001988 3300046538 Bacteria 12927
312 Ga0495609_0007091 3300046538 Bacteria 5639
313 Ga0495609_0016345 3300046538 Bacteria 3457
314 Ga0495609_0018109 3300046538 Bacteria 3267
315 Ga0495609_0023270 3300046538 Bacteria 2848
316 Ga0495597_0000653 3300046542 Bacteria 28153
317 Ga0495597_0003227 3300046542 Bacteria 9693
318 Ga0495597_0004627 3300046542 Bacteria 7498
319 Ga0495597_0021151 3300046542 Bacteria 3025
320 Ga0495597_0023065 3300046542 Bacteria 2880
321 Ga0495622_0003590 3300046557 Bacteria 7284
322 Ga0495622_0069456 3300046557 Bacteria 1626
323 Ga0495633_0009542 3300046558 Bacteria 5350
324 Ga0495633_0094473 3300046558 Bacteria 1389
325 Ga0495656_0012666 3300046615 Bacteria 3118
326 Ga0495656_0048550 3300046615 Bacteria 1804
327 Ga0495656_0103944 3300046615 Bacteria 1318
328 Ga0495656_0132386 3300046615 Bacteria 1188
329 Ga0495668_0000148 3300046616 Bacteria 105875
330 Ga0495668_0000243 3300046616 Bacteria 77845
331 Ga0495668_0003115 3300046616 Bacteria 12811
332 Ga0495668_0003304 3300046616 Bacteria 12205
333 Ga0495668_0005025 3300046616 Bacteria 9120
334 Ga0495668_0006221 3300046616 Bacteria 7883
335 Ga0495668_0009838 3300046616 Bacteria 5836
336 Ga0495668_0011495 3300046616 Bacteria 5300
337 Ga0495668_0075398 3300046616 Bacteria 1852
338 Ga0495668_0450278 3300046616 Bacteria 708
339 Ga0495611_0012589 3300046648 Bacteria 3596
340 Ga0495611_0050159 3300046648 Bacteria 1879
341 Ga0495611_0135526 3300046648 Bacteria 1149
342 Ga0495625_0007902 3300046660 Bacteria 9152
343 Ga0495625_0014424 3300046660 Bacteria 6308
344 Ga0495625_0016754 3300046660 Bacteria 5756
345 Ga0495625_0209937 3300046660 Bacteria 1280
346 Ga0495661_0000032 3300046665 Bacteria 170076
347 Ga0495661_0000823 3300046665 Bacteria 29101
348 Ga0495661_0002650 3300046665 Bacteria 13699
349 Ga0495661_0004591 3300046665 Bacteria 9939
350 Ga0495661_0007893 3300046665 Bacteria 7392
351 Ga0495661_0015139 3300046665 Bacteria 5152
352 Ga0495661_0016705 3300046665 Bacteria 4857
353 Ga0495661_0034514 3300046665 Bacteria 3182
354 Ga0495661_0044558 3300046665 Bacteria 2718
355 Ga0495661_0048296 3300046665 Bacteria 2586
356 Ga0495661_0069716 3300046665 Bacteria 2059
357 Ga0495661_0078143 3300046665 Bacteria 1915
358 Ga0495661_0115786 3300046665 Bacteria 1488
359 Ga0495661_0148578 3300046665 Bacteria 1267
360 Ga0495588_0000126 3300046674 Bacteria 128815
361 Ga0495588_0005310 3300046674 Bacteria 5729
362 Ga0495588_0119401 3300046674 Bacteria 1390
363 Ga0495623_0014452 3300046679 Bacteria 5109
364 Ga0495646_0097728 3300046680 Bacteria 1687
365 Ga0495669_0002258 3300046684 Bacteria 7902
366 Ga0495669_0009259 3300046684 Bacteria 4149
367 Ga0495669_0061648 3300046684 Bacteria 1698
368 Ga0495613_0191216 3300046689 Bacteria 1446
369 Ga0495670_0006150 3300046691 Bacteria 5895
370 Ga0495670_0006449 3300046691 Bacteria 5762
371 Ga0495670_0007477 3300046691 Bacteria 5366
372 Ga0495670_0008376 3300046691 Bacteria 5085
373 Ga0495670_0029328 3300046691 Bacteria 2730
374 Ga0495670_0063835 3300046691 Bacteria 1854
375 Ga0495670_0106328 3300046691 Bacteria 1449
376 Ga0495670_0135666 3300046691 Bacteria 1285
377 Ga0495671_0002017 3300046692 Bacteria 13033
378 Ga0495671_0002196 3300046692 Bacteria 12422
379 Ga0495671_0003766 3300046692 Bacteria 9215
380 Ga0495671_0036337 3300046692 Bacteria 2496
381 Ga0495649_0003290 3300046694 Bacteria 11003
382 Ga0495649_0008451 3300046694 Bacteria 6194
383 Ga0495649_0012116 3300046694 Bacteria 5031
384 Ga0495649_0030172 3300046694 Bacteria 2995
385 Ga0495649_0069214 3300046694 Bacteria 1893
386 Ga0495649_0095505 3300046694 Bacteria 1582
387 Ga0495649_0109994 3300046694 Bacteria 1461
388 Ga0495589_0000049 3300046794 Bacteria 116553
389 Ga0495589_0000136 3300046794 Bacteria 67764
390 Ga0495589_0001860 3300046794 Bacteria 11959
391 Ga0495589_0008867 3300046794 Bacteria 5231
392 Ga0495589_0011402 3300046794 Bacteria 4616
393 Ga0495589_0022637 3300046794 Bacteria 3206
394 Ga0495589_0080434 3300046794 Bacteria 1585
395 Ga0495589_0085195 3300046794 Bacteria 1535
396 Ga0495589_0137136 3300046794 Bacteria 1173
397 Ga0495600_0233881 3300046809 Bacteria 1172
398 Ga0495660_0000068 3300046810 Bacteria 119060
399 Ga0495660_0009293 3300046810 Bacteria 5737
400 Ga0495660_0022073 3300046810 Bacteria 3637
401 Ga0495660_0022723 3300046810 Bacteria 3579
402 Ga0495660_0033085 3300046810 Bacteria 2901
403 Ga0495660_0036752 3300046810 Bacteria 2730
404 Ga0495660_0118582 3300046810 Bacteria 1341
405 Ga0495660_0167086 3300046810 Bacteria 1074
406 Ga0495660_0186420 3300046810 Bacteria 1000
407 Ga0495660_0243899 3300046810 Bacteria 836
408 Ga0495581_0080588 3300047315 Bacteria 1884
409 Ga0495604_0027158 3300047317 Bacteria 4554
410 Ga0495636_0215854 3300047318 Bacteria 879
411 Ga0495672_0000530 3300047320 Bacteria 43361
412 Ga0495672_0000631 3300047320 Bacteria 39335
413 Ga0495672_0000870 3300047320 Bacteria 31792
414 Ga0495672_0006431 3300047320 Bacteria 9101
415 Ga0495672_0010146 3300047320 Bacteria 6735
416 Ga0495672_0018223 3300047320 Bacteria 4671
417 Ga0495672_0048405 3300047320 Bacteria 2521
418 Ga0495683_0001825 3300047323 Bacteria 13389
419 Ga0495683_0005255 3300047323 Bacteria 7195
420 Ga0495683_0009365 3300047323 Bacteria 5218
421 Ga0495683_0012643 3300047323 Bacteria 4432
422 Ga0495683_0058284 3300047323 Bacteria 1918
423 Ga0495683_0066209 3300047323 Bacteria 1780
424 Ga0495683_0154024 3300047323 Bacteria 1067
425 Ga0495687_000024 3300047443 Bacteria 316676
426 Ga0495687_000052 3300047443 Bacteria 199186
427 Ga0495687_000085 3300047443 Bacteria 145052
428 Ga0495687_001246 3300047443 Bacteria 24247
429 Ga0495687_001382 3300047443 Bacteria 22442
430 Ga0495687_001520 3300047443 Bacteria 21151
431 Ga0495687_001746 3300047443 Bacteria 19234
432 Ga0495687_004137 3300047443 Bacteria 9996
433 Ga0495687_052342 3300047443 Bacteria 1727
434 Ga0495675_0078123 3300047444 Bacteria 2084
435 Ga0495677_0000018 3300047445 Bacteria 120412
436 Ga0495677_0001467 3300047445 Bacteria 9453
437 Ga0495677_0002172 3300047445 Bacteria 7769
438 Ga0495677_0009674 3300047445 Bacteria 3555
439 Ga0495677_0011299 3300047445 Bacteria 3268
440 Ga0495677_0013988 3300047445 Bacteria 2922
441 Ga0495677_0014000 3300047445 Bacteria 2921
442 Ga0495679_013706 3300047446 Bacteria 3030
443 Ga0495679_021904 3300047446 Bacteria 2196
444 Ga0495679_025502 3300047446 Bacteria 1975
445 Ga0495679_026872 3300047446 Bacteria 1905
446 Ga0495685_002912 3300047447 Bacteria 5413
447 Ga0495685_011151 3300047447 Bacteria 3027
448 Ga0495681_0002830 3300047470 Bacteria 12266
449 Ga0495681_0010387 3300047470 Bacteria 5636
450 Ga0495681_0013779 3300047470 Bacteria 4675
451 Ga0495681_0032029 3300047470 Bacteria 2651
452 Ga0495686_0000203 3300047472 Bacteria 110612
453 Ga0495593_0087535 3300047673 Bacteria 1606
454 Ga0495602_0001574 3300048088 Bacteria 22715
455 Ga0495614_0001855 3300048089 Bacteria 9257
456 Ga0495626_0000637 3300048091 Bacteria 34040
457 Ga0495626_0000962 3300048091 Bacteria 24986
458 Ga0495626_0003457 3300048091 Bacteria 10119
459 Ga0495626_0003520 3300048091 Bacteria 10023
460 Ga0495626_0005968 3300048091 Bacteria 7007
461 Ga0495626_0013908 3300048091 Bacteria 4168
462 Ga0495626_0018410 3300048091 Bacteria 3507
463 Ga0495626_0018875 3300048091 Bacteria 3453
464 Ga0495626_0056791 3300048091 Bacteria 1791
465 Ga0495626_0070339 3300048091 Bacteria 1574
466 Ga0496100_0100286 3300048903 Bacteria 1994
467 Ga0496101_0039684 3300048904 Bacteria 3350
468 Ga0496101_0136381 3300048904 Bacteria 1868
469 Ga0496102_0000712 3300048905 Bacteria 32911
470 Ga0496102_0043805 3300048905 Bacteria 4059
471 Ga0496102_0075891 3300048905 Bacteria 3090
472 Ga0496102_0096917 3300048905 Bacteria 2735
473 Ga0496102_0219976 3300048905 Bacteria 1790
474 Ga0496102_0447611 3300048905 Bacteria 1212
475 Ga0496103_0089480 3300048906 Bacteria 1942
476 Ga0496103_0118386 3300048906 Bacteria 1686
477 Ga0496103_0232619 3300048906 Bacteria 1186
478 Ga0496103_0317299 3300048906 Bacteria 1002
479 Ga0496103_0488804 3300048906 Bacteria 788
480 Ga0496105_0454200 3300048908 Bacteria 1011
481 Ga0496106_0012765 3300048909 Bacteria 6203
482 Ga0496107_0007741 3300048910 Bacteria 7422
483 Ga0496107_0112654 3300048910 Bacteria 2000
484 Ga0496109_0005686 3300048912 Bacteria 10435
485 Ga0496110_0000767 3300048913 Bacteria 22265
486 Ga0496112_0301939 3300048915 Bacteria 1546
487 Ga0496113_0006326 3300048916 Bacteria 7494
488 Ga0496113_0012906 3300048916 Bacteria 5634
489 Ga0496113_0164545 3300048916 Bacteria 1755
490 Ga0496115_0053756 3300048918 Bacteria 3233
491 Ga0496115_0869340 3300048918 Bacteria 697
492 Ga0496122_0000629 3300048925 Bacteria 71906
493 Ga0496122_0011703 3300048925 Bacteria 8842
494 Ga0496122_0017669 3300048925 Bacteria 6650
495 Ga0496123_0000099 3300048926 Bacteria 170756
496 Ga0496123_0002457 3300048926 Bacteria 22948
497 Ga0496124_0023465 3300048927 Bacteria 5631
498 Ga0496124_0037702 3300048927 Bacteria 4202
499 Ga0496124_0053693 3300048927 Bacteria 3414
500 Ga0496125_0010809 3300048928 Bacteria 9192
501 Ga0496125_0030806 3300048928 Bacteria 4792
502 Ga0496125_0454540 3300048928 Bacteria 733
503 Ga0495678_003171 3300049459 Bacteria 10366
504 Ga0495678_003430 3300049459 Bacteria 9823
505 Ga0495678_005043 3300049459 Bacteria 7429
506 Ga0495678_006039 3300049459 Bacteria 6523
507 Ga0495682_0001323 3300049460 Bacteria 13761
508 Ga0495682_0001764 3300049460 Bacteria 10927
509 Ga0501036_0032768 3300049572 Bacteria 4393
510 Ga0501042_0327635 3300049578 Bacteria 1107
511 Ga0501207_006248 3300049654 Bacteria 1667
512 Ga0501222_002662 3300049662 Bacteria 2471
513 Ga0501233_033191 3300049668 Bacteria 1178
514 Ga0501221_000900 3300049704 Bacteria 4870
515 Ga0501229_000252 3300049706 Bacteria 6033
516 Ga0501035_0001375 3300049822 Bacteria 25010
517 Ga0501044_0119946 3300049823 Bacteria 2632
518 Ga0501084_0684558 3300054114 Bacteria 865
519 Ga0466962_0103437 3300061719 Bacteria 1368
520 2643796776 2643221556 Bacteria 7251154
521 2644470119 2643221684 Bacteria 7145183
522 8047676964 8047673197 Bacteria 7395230
523 Ga0501230_003102
524 rootH1_10014334
525 rootL2_10003893
526 rootL2_10024668
527 Ga0055525_1000006
528 Ga0055525_1000028
529 Ga0055530_10029897
530 Ga0055531_10000381
531 Ga0065165_1011896
532 Ga0065165_1022592
533 Ga0070658_10026667
534 Ga0070658_10042494
535 Ga0070658_10133909
536 Ga0070682_100235410
537 Ga0070660_100001131
538 Ga0070660_100099096
539 Ga0070660_100486769
540 Ga0070659_100014912
541 Ga0070659_100054413
542 Ga0070659_100086321
543 Ga0070662_100080773
544 Ga0070662_100173360
545 Ga0070662_100240484
546 Ga0070679_100605407
547 Ga0068855_100012116
548 Ga0068855_100360955
549 Ga0070664_100002839
550 Ga0070664_100055972
551 Ga0070664_100069110
552 Ga0070664_100275872
553 Ga0070664_100358493
554 Ga0070664_100571080
555 Ga0068852_100063749
556 Ga0068852_100710427
557 Ga0097621_100380705
558 Ga0068871_100322306
559 Ga0105244_10001057
560 Ga0105245_10487020
561 Ga0105243_10060322
562 Ga0105243_10167199
563 Ga0105242_10026891
564 Ga0105237_10388936
565 Ga0105238_10381757
566 Ga0105239_10116292
567 Ga0105246_10108918
568 Ga0105246_10827440
569 Ga0157369_10997828
570 Ga0157372_10203018
571 Ga0157372_10288261
572 Ga0157372_10338393
573 Ga0157376_10372945
574 Ga0182007_10107836
575 Ga0213872_10000018
576 Ga0213872_10077866
577 Ga0209563_100011
578 Ga0209563_100022
579 Ga0209677_101675
580 Ga0209677_103102
581 Ga0209148_1000585
582 Ga0209050_1005124
583 Ga0209257_1000117
584 Ga0207655_1001365
585 Ga0207705_10000223
586 Ga0207705_10088477
587 Ga0207705_10160197
588 Ga0207695_10434172
589 Ga0207657_10004042
590 Ga0207657_10011356
591 Ga0207657_10028267
592 Ga0207649_10296175
593 Ga0207652_10724460
594 Ga0207694_10524844
595 Ga0207690_10033805
596 Ga0207690_10065047
597 Ga0207690_10069123
598 Ga0207706_10082359
599 Ga0207706_10102626
600 Ga0207706_10124924
601 Ga0207706_10130199
602 Ga0207706_10197186
603 Ga0207686_10013226
604 Ga0207686_10207439
605 Ga0207686_10490247
606 Ga0207709_10101567
607 Ga0207679_10101077
608 Ga0207679_10117391
609 Ga0207679_10128465
610 Ga0207679_10270406
611 Ga0207679_10571212
612 Ga0207667_10006615
613 Ga0207702_10480140
614 Ga0207648_10391250
615 Ga0207674_10362160
616 Ga0207698_10085401
617 Ga0207698_10420763
618 Ga0265331_10001540
619 Ga0265327_10000012
620 Ga0395899_0001188
621 Ga0395899_0007019
622 Ga0395899_0009427
623 Ga0395899_0013898
624 Ga0395899_0028424
625 Ga0395899_0085535
626 Ga0395900_0000307
627 Ga0395900_0000497
628 Ga0395900_0000600
629 Ga0395900_0001987
630 Ga0395900_0002248
631 Ga0395900_0012205
632 Ga0395900_0013824
633 Ga0395900_0022519
634 Ga0395900_0071136
635 Ga0395900_0175798
636 Ga0395900_0209857
637 Ga0395900_0224154
638 Ga0395900_0270906
639 Ga0395900_0798256
640 Ga0395898_0005084
641 Ga0395898_0025962
642 Ga0395898_0141584
643 Ga0395898_0618811
644 Ga0395905_0016771
645 Ga0395905_0039956
646 Ga0395905_0049473
647 Ga0395905_0085717
648 Ga0395905_0102436
649 Ga0395905_0216512
650 Ga0395905_0571161
651 Ga0395905_0613985
652 Ga0395901_0000527
653 Ga0395901_0020093
654 Ga0395901_0025173
655 Ga0395901_0039956
656 Ga0395901_0044346
657 Ga0395901_0216779
658 Ga0395901_0550353
659 Ga0436361_0677882
660 Ga0436361_0726241
661 Ga0436361_1008129
662 Ga0451793_1621807
663 Ga0439448_0000130
664 Ga0439448_0000705
665 Ga0439448_0016699
666 Ga0439448_0045872
667 Ga0439448_0159174
668 Ga0439449_0053979
669 Ga0439450_048737
670 Ga0439455_0002445
671 Ga0439455_0007397
672 Ga0439455_0082935
673 Ga0439458_0007751
674 Ga0439458_0010382
675 Ga0466969_0000007
676 Ga0466972_0005938
677 Ga0466965_0006317
678 Ga0466966_0004210
679 Ga0466966_0019471
680 Ga0466966_0023372
681 Ga0466966_0078300
682 Ga0466966_0203483
683 Ga0466961_0263541
684 Ga0466963_0003457
685 Ga0466963_0284196
686 Ga0466964_0000759
687 Ga0466964_0063789
688 Ga0466964_0104969
689 Ga0466971_0165469
690 Ga0466968_0000954
691 Ga0466968_0216447
692 Ga0466970_0472202
693 Ga0466957_0000005
694 Ga0466957_0003769
695 Ga0466957_0017236
696 Ga0466957_0174227
697 Ga0466960_0013823
698 Ga0466959_0019207
699 Ga0466959_0036851
700 Ga0466959_0064019
701 Ga0466959_0221346
702 Ga0466958_0035281
703 Ga0466958_0071792
704 Ga0466958_0104601
705 Ga0466958_0411393
706 Ga0466967_0026590
707 Ga0466967_0037968
708 Ga0466967_0144204
709 Ga0495617_000014
710 Ga0495627_000780
711 Ga0495627_008384
712 Ga0495627_017772
713 Ga0495603_0087722
714 Ga0495590_0000006
715 Ga0495590_0001082
716 Ga0495590_0019679
717 Ga0495591_009562
718 Ga0495629_0096104
719 Ga0495638_0261994
720 Ga0495653_0001765
721 Ga0495653_0094383
722 Ga0495650_0000108
723 Ga0495582_0000427
724 Ga0495582_0032136
725 Ga0495605_0000110
726 Ga0495605_0000118
727 Ga0495605_0009889
728 Ga0495605_0014861
729 Ga0495605_0024258
730 Ga0495605_0024452
731 Ga0495605_0046885
732 Ga0495584_0001874
733 Ga0495584_0002423
734 Ga0495584_0009021
735 Ga0495584_0009274
736 Ga0495584_0038870
737 Ga0495584_0109197
738 Ga0495585_0009918
739 Ga0495585_0013227
740 Ga0495585_0013625
741 Ga0495585_0018244
742 Ga0495585_0041458
743 Ga0495585_0059188
744 Ga0495585_0284440
745 Ga0495585_0312795
746 Ga0495594_0019250
747 Ga0495594_0072680
748 Ga0495596_0004363
749 Ga0495596_0008387
750 Ga0495596_0009330
751 Ga0495596_0011518
752 Ga0495596_0011795
753 Ga0495596_0015447
754 Ga0495596_0016613
755 Ga0495596_0031492
756 Ga0495596_0042755
757 Ga0495596_0104747
758 Ga0495607_0004432
759 Ga0495607_0004748
760 Ga0495607_0005340
761 Ga0495607_0005448
762 Ga0495607_0015621
763 Ga0495607_0015663
764 Ga0495607_0020231
765 Ga0495607_0020905
766 Ga0495607_0032073
767 Ga0495607_0060957
768 Ga0495607_0227282
769 Ga0495583_0001075
770 Ga0495583_0006145
771 Ga0495583_0126594
772 Ga0495583_0199109
773 Ga0495606_0000046
774 Ga0495606_0000458
775 Ga0495606_0012627
776 Ga0495606_0017427
777 Ga0495606_0027196
778 Ga0495606_0088103
779 Ga0495610_0001713
780 Ga0495616_0000088
781 Ga0495616_0001119
782 Ga0495616_0003638
783 Ga0495616_0004891
784 Ga0495616_0010672
785 Ga0495616_0011234
786 Ga0495616_0024955
787 Ga0495616_0028096
788 Ga0495616_0076819
789 Ga0495616_0085839
790 Ga0495616_0303873
791 Ga0495630_0060588
792 Ga0495631_0002058
793 Ga0495631_0006518
794 Ga0495631_0012507
795 Ga0495631_0016260
796 Ga0495631_0018775
797 Ga0495631_0020790
798 Ga0495631_0045182
799 Ga0495631_0050182
800 Ga0495631_0057090
801 Ga0495632_0000041
802 Ga0495632_0002462
803 Ga0495632_0002478
804 Ga0495632_0002700
805 Ga0495637_0054178
806 Ga0495637_0089855
807 Ga0495643_0003305
808 Ga0495643_0033227
809 Ga0495643_0036268
810 Ga0495643_0043812
811 Ga0495644_0011479
812 Ga0495644_0094592
813 Ga0495648_0003276
814 Ga0495648_0006050
815 Ga0495648_0006756
816 Ga0495648_0016175
817 Ga0495648_0058121
818 Ga0495648_0058134
819 Ga0495663_0037801
820 Ga0495666_0061475
821 Ga0495642_0000017
822 Ga0495642_0003740
823 Ga0495642_0004962
824 Ga0495642_0017269
825 Ga0495642_0027271
826 Ga0495642_0092936
827 Ga0495642_0160874
828 Ga0495652_0052272
829 Ga0495654_0086512
830 Ga0495587_0053278
831 Ga0495609_0000009
832 Ga0495609_0001192
833 Ga0495609_0001988
834 Ga0495609_0007091
835 Ga0495609_0016345
836 Ga0495609_0018109
837 Ga0495609_0023270
838 Ga0495597_0000653
839 Ga0495597_0003227
840 Ga0495597_0004627
841 Ga0495597_0021151
842 Ga0495597_0023065
843 Ga0495622_0003590
844 Ga0495622_0069456
845 Ga0495633_0009542
846 Ga0495633_0094473
847 Ga0495656_0012666
848 Ga0495656_0048550
849 Ga0495656_0103944
850 Ga0495656_0132386
851 Ga0495668_0000148
852 Ga0495668_0000243
853 Ga0495668_0003115
854 Ga0495668_0003304
855 Ga0495668_0005025
856 Ga0495668_0006221
857 Ga0495668_0009838
858 Ga0495668_0011495
859 Ga0495668_0075398
860 Ga0495668_0450278
861 Ga0495611_0012589
862 Ga0495611_0050159
863 Ga0495611_0135526
864 Ga0495625_0007902
865 Ga0495625_0014424
866 Ga0495625_0016754
867 Ga0495625_0209937
868 Ga0495661_0000032
869 Ga0495661_0000823
870 Ga0495661_0002650
871 Ga0495661_0004591
872 Ga0495661_0007893
873 Ga0495661_0015139
874 Ga0495661_0016705
875 Ga0495661_0034514
876 Ga0495661_0044558
877 Ga0495661_0048296
878 Ga0495661_0069716
879 Ga0495661_0078143
880 Ga0495661_0115786
881 Ga0495661_0148578
882 Ga0495588_0000126
883 Ga0495588_0005310
884 Ga0495588_0119401
885 Ga0495623_0014452
886 Ga0495646_0097728
887 Ga0495669_0002258
888 Ga0495669_0009259
889 Ga0495669_0061648
890 Ga0495613_0191216
891 Ga0495670_0006150
892 Ga0495670_0006449
893 Ga0495670_0007477
894 Ga0495670_0008376
895 Ga0495670_0029328
896 Ga0495670_0063835
897 Ga0495670_0106328
898 Ga0495670_0135666
899 Ga0495671_0002017
900 Ga0495671_0002196
901 Ga0495671_0003766
902 Ga0495671_0036337
903 Ga0495649_0003290
904 Ga0495649_0008451
905 Ga0495649_0012116
906 Ga0495649_0030172
907 Ga0495649_0069214
908 Ga0495649_0095505
909 Ga0495649_0109994
910 Ga0495589_0000049
911 Ga0495589_0000136
912 Ga0495589_0001860
913 Ga0495589_0008867
914 Ga0495589_0011402
915 Ga0495589_0022637
916 Ga0495589_0080434
917 Ga0495589_0085195
918 Ga0495589_0137136
919 Ga0495600_0233881
920 Ga0495660_0000068
921 Ga0495660_0009293
922 Ga0495660_0022073
923 Ga0495660_0022723
924 Ga0495660_0033085
925 Ga0495660_0036752
926 Ga0495660_0118582
927 Ga0495660_0167086
928 Ga0495660_0186420
929 Ga0495660_0243899
930 Ga0495581_0080588
931 Ga0495604_0027158
932 Ga0495636_0215854
933 Ga0495672_0000530
934 Ga0495672_0000631
935 Ga0495672_0000870
936 Ga0495672_0006431
937 Ga0495672_0010146
938 Ga0495672_0018223
939 Ga0495672_0048405
940 Ga0495683_0001825
941 Ga0495683_0005255
942 Ga0495683_0009365
943 Ga0495683_0012643
944 Ga0495683_0058284
945 Ga0495683_0066209
946 Ga0495683_0154024
947 Ga0495687_000024
948 Ga0495687_000052
949 Ga0495687_000085
950 Ga0495687_001246
951 Ga0495687_001382
952 Ga0495687_001520
953 Ga0495687_001746
954 Ga0495687_004137
955 Ga0495687_052342
956 Ga0495675_0078123
957 Ga0495677_0000018
958 Ga0495677_0001467
959 Ga0495677_0002172
960 Ga0495677_0009674
961 Ga0495677_0011299
962 Ga0495677_0013988
963 Ga0495677_0014000
964 Ga0495679_013706
965 Ga0495679_021904
966 Ga0495679_025502
967 Ga0495679_026872
968 Ga0495685_002912
969 Ga0495685_011151
970 Ga0495681_0002830
971 Ga0495681_0010387
972 Ga0495681_0013779
973 Ga0495681_0032029
974 Ga0495686_0000203
975 Ga0495593_0087535
976 Ga0495602_0001574
977 Ga0495614_0001855
978 Ga0495626_0000637
979 Ga0495626_0000962
980 Ga0495626_0003457
981 Ga0495626_0003520
982 Ga0495626_0005968
983 Ga0495626_0013908
984 Ga0495626_0018410
985 Ga0495626_0018875
986 Ga0495626_0056791
987 Ga0495626_0070339
988 Ga0496100_0100286
989 Ga0496101_0039684
990 Ga0496101_0136381
991 Ga0496102_0000712
992 Ga0496102_0043805
993 Ga0496102_0075891
994 Ga0496102_0096917
995 Ga0496102_0219976
996 Ga0496102_0447611
997 Ga0496103_0089480
998 Ga0496103_0118386
999 Ga0496103_0232619
1000 Ga0496103_0317299
1001 Ga0496103_0488804
1002 Ga0496105_0454200
1003 Ga0496106_0012765
1004 Ga0496107_0007741
1005 Ga0496107_0112654
1006 Ga0496109_0005686
1007 Ga0496110_0000767
1008 Ga0496112_0301939
1009 Ga0496113_0006326
1010 Ga0496113_0012906
1011 Ga0496113_0164545
1012 Ga0496115_0053756
1013 Ga0496115_0869340
1014 Ga0496122_0000629
1015 Ga0496122_0011703
1016 Ga0496122_0017669
1017 Ga0496123_0000099
1018 Ga0496123_0002457
1019 Ga0496124_0023465
1020 Ga0496124_0037702
1021 Ga0496124_0053693
1022 Ga0496125_0010809
1023 Ga0496125_0030806
1024 Ga0496125_0454540
1025 Ga0495678_003171
1026 Ga0495678_003430
1027 Ga0495678_005043
1028 Ga0495678_006039
1029 Ga0495682_0001323
1030 Ga0495682_0001764
1031 Ga0501036_0032768
1032 Ga0501042_0327635
1033 Ga0501207_006248
1034 Ga0501222_002662
1035 Ga0501233_033191
1036 Ga0501221_000900
1037 Ga0501229_000252
1038 Ga0501035_0001375
1039 Ga0501044_0119946
1040 Ga0501084_0684558
1041 Ga0466962_0103437
1042 2643796776
1043 2644470119
1044 8047676964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

92

215

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tz4-assembly1.cif.gz_JB cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (right-handed) 0.7894 122 220
8odt-assembly1.cif.gz_E structure of tolqr complex from e.coli 0.7769 20 222
5sv0-assembly2.cif.gz_J structure of the exbb/exbd complex from e. coli at ph 7.0 0.7156 34 221
6tyi-assembly1.cif.gz_D exbb-exbd complex in msp1e3d1 nanodisc 0.712 21 221
6ye4-assembly1.cif.gz_C structure of exbb pentamer from serratia marcescens by single particle cryo electron microscopy 0.6952 21 221
ID Description Score Start End Superfamily
1c0vA00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6102 130 200 1.20.20.10
af_D3ZX38_7_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6001 119 217 1.10.287.370
af_A0A2R8QSC2_1_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5714 126 194 1.20.140.150
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.5692 94 214 1.20.58.220
af_K7MIZ8_1_105_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.567 118 216 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A0Q5CR93-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.9761 19 226 GO:0005886
GO:0017038
AF-A0A257SFI2-F1-model_v4 Flagellar motor protein MotA 0.9668 26 201 GO:0005886
GO:0017038
AF-A0A1V6DBH7-F1-model_v4 Biopolymer transport protein ExbB 0.9644 26 227 GO:0005886
GO:0017038
AF-A0A6J4YN35-F1-model_v4 MotA/TolQ/ExbB proton channel family protein 0.9609 31 218 GO:0005886
GO:0017038
AF-G0JMZ8-F1-model_v4 MotA/TolQ/ExbB proton channel 0.9606 26 222 GO:0005886
GO:0017038

Map