F458910

General Info

Members Datasets Scaffolds Average Seq Length
522 323 1044 187

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_237078_c1|nmdc:mga05p37_237078_c1_625_1269
Length 214
Sequence MRAVEQRRHAALPPSGKGVAMTTLPDRPNSALLVIDVQNGVVGEAYEKDSIIANVRTLIDKARSSGTPVVWVQHNAKGLEADTEPWQYVPELIRDDNEPLVQKRYGDSFEATDLEQVLAERGIGRLFVSGAQTDECIRSTLHGAFTRGYDTVLVTDAHTTEDLTEWGAPTPDKVIAHTNMYWEGHRAPGRTAGIVTTNDVDFSSKPEEKAGTTS

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 2643221616 Leifsonia sp. Root227 Isolate Unclassified
321 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
322 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
323 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.15
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0.19
Rhizoplane 6.51
Rhizosphere 86.02
Stem 0
Stem Tuber 0.19
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_237078_c1 3300050507 Bacteria 2195
2 JGI24735J21928_10014665 3300002067 Unclassified 2453
3 JGI24748J21848_1018014 3300002074 Bacteria 846
4 JGI24738J21930_10035461 3300002075 Bacteria 1016
5 JGI24744J21845_10002507 3300002077 Bacteria 3745
6 JGI24034J26672_10008463 3300002239 Bacteria 1504
7 JGI24742J22300_10005122 3300002244 Bacteria 2155
8 JGI25164J39214_1000348 3300002772 Bacteria 28820
9 JGI25165J46597_1000002 3300003214 Bacteria 765387
10 Ga0070676_10021442 3300005328 Bacteria 3618
11 Ga0070683_100000145 3300005329 Bacteria 45857
12 Ga0070683_100617781 3300005329 Bacteria 1037
13 Ga0070683_100921654 3300005329 Bacteria 838
14 Ga0070670_100175987 3300005331 Bacteria 1857
15 Ga0068869_100044570 3300005334 Bacteria 3190
16 Ga0068869_101262895 3300005334 Bacteria 651
17 Ga0070666_10040277 3300005335 Bacteria 3118
18 Ga0070680_100034223 3300005336 Bacteria 4097
19 Ga0070680_100147082 3300005336 Bacteria 1977
20 Ga0070680_100193650 3300005336 Bacteria 1713
21 Ga0070682_100024444 3300005337 Bacteria 3596
22 Ga0070682_100071243 3300005337 Bacteria 2224
23 Ga0068868_100010771 3300005338 Bacteria 6630
24 Ga0068868_100172505 3300005338 Bacteria 1791
25 Ga0070660_100152802 3300005339 Bacteria 1857
26 Ga0070660_100326320 3300005339 Bacteria 1261
27 Ga0070689_100043311 3300005340 Bacteria 3459
28 Ga0070689_100364549 3300005340 Bacteria 1215
29 Ga0070687_100037788 3300005343 Bacteria 2416
30 Ga0070692_10177708 3300005345 Bacteria 1232
31 Ga0070668_100000260 3300005347 Bacteria 35142
32 Ga0070669_100005020 3300005353 Bacteria 9564
33 Ga0070671_100029057 3300005355 Bacteria 4558
34 Ga0070674_100001471 3300005356 Bacteria 12561
35 Ga0070688_100130092 3300005365 Bacteria 1697
36 Ga0070688_100252324 3300005365 Bacteria 1257
37 Ga0070659_100015434 3300005366 Bacteria 5721
38 Ga0070659_100553907 3300005366 Bacteria 985
39 Ga0070667_100003154 3300005367 Bacteria 14147
40 Ga0070709_10036407 3300005434 Bacteria 2998
41 Ga0070714_100000018 3300005435 Bacteria 173975
42 Ga0070714_100005053 3300005435 Bacteria 10033
43 Ga0070714_100098852 3300005435 Bacteria 2568
44 Ga0070714_100640791 3300005435 Bacteria 1022
45 Ga0070713_100030818 3300005436 Bacteria 4265
46 Ga0070713_100232375 3300005436 Bacteria 1677
47 Ga0070713_100478729 3300005436 Bacteria 1172
48 Ga0070710_10000061 3300005437 Bacteria 50295
49 Ga0070710_10001204 3300005437 Bacteria 12244
50 Ga0070710_10005198 3300005437 Bacteria 6169
51 Ga0070710_10007636 3300005437 Bacteria 5241
52 Ga0070701_10023735 3300005438 Bacteria 2958
53 Ga0070701_10052375 3300005438 Bacteria 2120
54 Ga0070711_100002291 3300005439 Bacteria 10853
55 Ga0070711_100153591 3300005439 Bacteria 1738
56 Ga0070700_100008610 3300005441 Bacteria 5559
57 Ga0070700_100030791 3300005441 Bacteria 3210
58 Ga0070700_100109051 3300005441 Bacteria 1837
59 Ga0070694_100082402 3300005444 Bacteria 2240
60 Ga0070708_100152916 3300005445 Bacteria 2147
61 Ga0070663_100166854 3300005455 Bacteria 1699
62 Ga0070678_100015526 3300005456 Bacteria 4843
63 Ga0070678_100244111 3300005456 Bacteria 1503
64 Ga0070662_100048981 3300005457 Bacteria 3046
65 Ga0070662_100227151 3300005457 Bacteria 1492
66 Ga0070681_10049236 3300005458 Bacteria 4209
67 Ga0070681_10183115 3300005458 Bacteria 2016
68 Ga0070681_10221429 3300005458 Bacteria 1807
69 Ga0068867_100001593 3300005459 Bacteria 15770
70 Ga0070685_10029193 3300005466 Bacteria 3062
71 Ga0070707_100041696 3300005468 Bacteria 4394
72 Ga0070698_100108649 3300005471 Bacteria 2741
73 Ga0070699_100074657 3300005518 Bacteria 2951
74 Ga0070679_100089513 3300005530 Bacteria 3065
75 Ga0070679_100122828 3300005530 Bacteria 2580
76 Ga0070679_100733796 3300005530 Bacteria 931
77 Ga0070684_100014905 3300005535 Bacteria 6309
78 Ga0070684_100091957 3300005535 Bacteria 2699
79 Ga0070684_100097031 3300005535 Bacteria 2628
80 Ga0068853_100007611 3300005539 Bacteria 8676
81 Ga0068853_100196441 3300005539 Bacteria 1835
82 Ga0070672_100172258 3300005543 Bacteria 1800
83 Ga0070686_100032805 3300005544 Bacteria 3186
84 Ga0070695_100073989 3300005545 Bacteria 2238
85 Ga0070695_100262876 3300005545 Bacteria 1261
86 Ga0070696_100061788 3300005546 Bacteria 2621
87 Ga0070665_100016945 3300005548 Bacteria 7306
88 Ga0070704_100000340 3300005549 Bacteria 21256
89 Ga0068855_100282294 3300005563 Bacteria 1843
90 Ga0068855_100324270 3300005563 Bacteria 1701
91 Ga0070664_100005937 3300005564 Bacteria 9864
92 Ga0070664_100262190 3300005564 Bacteria 1555
93 Ga0068857_100000293 3300005577 Bacteria 34584
94 Ga0068857_100187810 3300005577 Bacteria 1882
95 Ga0068854_100019080 3300005578 Bacteria 4615
96 Ga0068854_100060799 3300005578 Bacteria 2734
97 Ga0068856_100281869 3300005614 Bacteria 1678
98 Ga0068856_100885560 3300005614 Bacteria 912
99 Ga0070702_100003127 3300005615 Bacteria 7332
100 Ga0070702_100011634 3300005615 Bacteria 4381
101 Ga0068852_100209016 3300005616 Bacteria 1850
102 Ga0068852_100225760 3300005616 Bacteria 1783
103 Ga0068859_100009269 3300005617 Bacteria 9940
104 Ga0068859_100156874 3300005617 Bacteria 2354
105 Ga0068864_100925847 3300005618 Bacteria 862
106 Ga0068866_10000121 3300005718 Bacteria 34325
107 Ga0068861_100000790 3300005719 Bacteria 19056
108 Ga0068851_10276849 3300005834 Bacteria 958
109 Ga0068858_100001167 3300005842 Bacteria 27244
110 Ga0068858_100383038 3300005842 Bacteria 1350
111 Ga0068860_100000694 3300005843 Bacteria 38692
112 Ga0068860_100259941 3300005843 Bacteria 1692
113 Ga0068862_100009025 3300005844 Bacteria 8253
114 Ga0081539_10001747 3300005985 Bacteria 34662
115 Ga0070717_10012977 3300006028 Bacteria 6364
116 Ga0070717_10035068 3300006028 Bacteria 4058
117 Ga0070717_10525660 3300006028 Bacteria 1070
118 Ga0075364_10010779 3300006051 Bacteria 5530
119 Ga0075364_10172829 3300006051 Bacteria 1460
120 Ga0070715_10051927 3300006163 Bacteria 1767
121 Ga0070716_100031533 3300006173 Bacteria 2883
122 Ga0070716_100035259 3300006173 Bacteria 2750
123 Ga0070716_100638943 3300006173 Bacteria 805
124 Ga0070712_100001253 3300006175 Bacteria 15341
125 Ga0070712_100346062 3300006175 Bacteria 1215
126 Ga0075362_10075608 3300006177 Bacteria 1545
127 Ga0097621_100038249 3300006237 Bacteria 3850
128 Ga0097621_100046781 3300006237 Bacteria 3502
129 Ga0068871_100023578 3300006358 Bacteria 4763
130 Ga0075433_10072317 3300006852 Bacteria 3032
131 Ga0075433_10075369 3300006852 Bacteria 2969
132 Ga0075433_10357116 3300006852 Bacteria 1291
133 Ga0075434_100009510 3300006871 Bacteria 9067
134 Ga0075434_100104701 3300006871 Bacteria 2839
135 Ga0068865_100001845 3300006881 Bacteria 12433
136 Ga0068865_100002458 3300006881 Bacteria 10968
137 Ga0068865_100196151 3300006881 Bacteria 1565
138 Ga0097620_100009269 3300006931 Bacteria 9940
139 Ga0097620_100156869 3300006931 Bacteria 2354
140 Ga0075435_100063755 3300007076 Bacteria 2993
141 Ga0105240_10487365 3300009093 Bacteria 1373
142 Ga0111539_10142614 3300009094 Bacteria 2804
143 Ga0105245_10004378 3300009098 Bacteria 12498
144 Ga0105245_10041755 3300009098 Bacteria 4089
145 Ga0105247_10001791 3300009101 Bacteria 15085
146 Ga0105243_10001167 3300009148 Bacteria 23810
147 Ga0105241_11044410 3300009174 Bacteria 767
148 Ga0105242_10003499 3300009176 Bacteria 12205
149 Ga0105248_10010767 3300009177 Bacteria 10096
150 Ga0105248_10401001 3300009177 Bacteria 1544
151 Ga0105237_10132863 3300009545 Bacteria 2483
152 Ga0105238_10588448 3300009551 Bacteria 1120
153 Ga0105249_10013190 3300009553 Bacteria 7293
154 Ga0105249_10498436 3300009553 Bacteria 1263
155 Ga0105239_10021292 3300010375 Bacteria 7149
156 Ga0105239_10168983 3300010375 Bacteria 2445
157 Ga0105239_11341371 3300010375 Bacteria 825
158 Ga0105246_10012365 3300011119 Bacteria 5323
159 Ga0105246_10069750 3300011119 Bacteria 2470
160 Ga0157369_10267410 3300013105 Bacteria 1782
161 Ga0157369_10507267 3300013105 Bacteria 1248
162 Ga0157369_10876902 3300013105 Bacteria 921
163 Ga0157369_11539231 3300013105 Bacteria 676
164 Ga0157374_10690722 3300013296 Bacteria 1033
165 Ga0157374_10866662 3300013296 Bacteria 920
166 Ga0157378_10003368 3300013297 Bacteria 14211
167 Ga0157378_10342521 3300013297 Bacteria 1458
168 Ga0163162_10002977 3300013306 Bacteria 16179
169 Ga0163162_10102420 3300013306 Bacteria 2956
170 Ga0157372_10054371 3300013307 Bacteria 4466
171 Ga0157372_10139573 3300013307 Bacteria 2791
172 Ga0157372_10384682 3300013307 Bacteria 1635
173 Ga0157372_11053736 3300013307 Bacteria 941
174 Ga0157375_10000845 3300013308 Bacteria 26724
175 Ga0157375_10065658 3300013308 Bacteria 3618
176 Ga0157380_10010769 3300014326 Bacteria 6589
177 Ga0182008_10357236 3300014497 Bacteria 776
178 Ga0157377_10022725 3300014745 Bacteria 3316
179 Ga0157377_10144601 3300014745 Bacteria 1464
180 Ga0157379_10005753 3300014968 Bacteria 10668
181 Ga0157379_10156070 3300014968 Bacteria 2059
182 Ga0157376_10083265 3300014969 Bacteria 2751
183 Ga0157376_10086507 3300014969 Bacteria 2703
184 Ga0163161_10009845 3300017792 Bacteria 6620
185 Ga0197907_10873831 3300020069 Bacteria 1632
186 Ga0206349_1774794 3300020075 Bacteria 790
187 Ga0206350_10171960 3300020080 Bacteria 1222
188 Ga0206353_10147238 3300020082 Bacteria 1769
189 Ga0213874_10008690 3300021377 Unclassified 2485
190 Ga0213876_10001978 3300021384 Bacteria 12254
191 Ga0224712_10029903 3300022467 Bacteria 1961
192 Ga0207427_100052 3300025231 Bacteria 218228
193 Ga0209437_100821 3300025233 Bacteria 13822
194 Ga0209233_1000001 3300025261 Bacteria 2992747
195 Ga0209233_1048006 3300025261 Bacteria 884
196 Ga0207692_10003379 3300025898 Bacteria 6230
197 Ga0207692_10014116 3300025898 Bacteria 3483
198 Ga0207692_10195117 3300025898 Bacteria 1187
199 Ga0207642_10001157 3300025899 Bacteria 8143
200 Ga0207642_10065762 3300025899 Bacteria 1705
201 Ga0207710_10045891 3300025900 Bacteria 1950
202 Ga0207688_10001866 3300025901 Bacteria 11278
203 Ga0207680_10048400 3300025903 Bacteria 2525
204 Ga0207647_10084507 3300025904 Bacteria 1899
205 Ga0207647_10249433 3300025904 Bacteria 1018
206 Ga0207647_10401307 3300025904 Bacteria 772
207 Ga0207699_10069959 3300025906 Bacteria 2141
208 Ga0207699_10375926 3300025906 Bacteria 1007
209 Ga0207643_10240520 3300025908 Bacteria 1113
210 Ga0207705_10183093 3300025909 Bacteria 1582
211 Ga0207671_10094571 3300025914 Bacteria 2256
212 Ga0207693_10000174 3300025915 Bacteria 58853
213 Ga0207693_10002716 3300025915 Bacteria 15336
214 Ga0207693_10107257 3300025915 Bacteria 2191
215 Ga0207663_10000793 3300025916 Bacteria 14165
216 Ga0207663_10005542 3300025916 Bacteria 6370
217 Ga0207663_10058137 3300025916 Bacteria 2439
218 Ga0207660_10080933 3300025917 Bacteria 2386
219 Ga0207660_10089557 3300025917 Bacteria 2278
220 Ga0207660_10217177 3300025917 Bacteria 1499
221 Ga0207662_10035117 3300025918 Bacteria 2927
222 Ga0207657_10001374 3300025919 Bacteria 25948
223 Ga0207657_10028883 3300025919 Bacteria 5053
224 Ga0207657_10073206 3300025919 Bacteria 2896
225 Ga0207652_10098358 3300025921 Bacteria 2580
226 Ga0207652_10505585 3300025921 Bacteria 1088
227 Ga0207652_10519011 3300025921 Bacteria 1072
228 Ga0207646_10655381 3300025922 Bacteria 940
229 Ga0207681_10005060 3300025923 Bacteria 8105
230 Ga0207650_10503523 3300025925 Bacteria 1012
231 Ga0207659_10255784 3300025926 Bacteria 1423
232 Ga0207687_10002539 3300025927 Bacteria 12389
233 Ga0207687_10019627 3300025927 Bacteria 4480
234 Ga0207700_10032720 3300025928 Bacteria 3712
235 Ga0207700_10579183 3300025928 Bacteria 998
236 Ga0207664_10000003 3300025929 Bacteria 510966
237 Ga0207664_10036820 3300025929 Bacteria 3783
238 Ga0207664_10141987 3300025929 Bacteria 2032
239 Ga0207644_10018078 3300025931 Bacteria 4767
240 Ga0207644_10145942 3300025931 Bacteria 1827
241 Ga0207690_10248051 3300025932 Bacteria 1374
242 Ga0207690_10546680 3300025932 Bacteria 941
243 Ga0207706_10001344 3300025933 Bacteria 24550
244 Ga0207706_10062718 3300025933 Bacteria 3273
245 Ga0207686_10023480 3300025934 Bacteria 3563
246 Ga0207686_10066157 3300025934 Bacteria 2307
247 Ga0207686_10147967 3300025934 Bacteria 1631
248 Ga0207709_10004446 3300025935 Bacteria 8096
249 Ga0207670_10035793 3300025936 Bacteria 3223
250 Ga0207669_10001213 3300025937 Bacteria 10953
251 Ga0207704_10000200 3300025938 Bacteria 30767
252 Ga0207704_10004673 3300025938 Bacteria 6276
253 Ga0207704_10073200 3300025938 Bacteria 2181
254 Ga0207665_10008658 3300025939 Bacteria 6698
255 Ga0207665_10044816 3300025939 Bacteria 2960
256 Ga0207665_10102891 3300025939 Bacteria 1997
257 Ga0207691_10252457 3300025940 Bacteria 1522
258 Ga0207711_10050559 3300025941 Bacteria 3558
259 Ga0207689_10020111 3300025942 Bacteria 5621
260 Ga0207689_10413172 3300025942 Bacteria 1125
261 Ga0207661_10001823 3300025944 Bacteria 14563
262 Ga0207679_10152476 3300025945 Bacteria 1883
263 Ga0207667_10375870 3300025949 Bacteria 1448
264 Ga0207667_10491265 3300025949 Bacteria 1245
265 Ga0207712_10010432 3300025961 Bacteria 5897
266 Ga0207712_10148294 3300025961 Bacteria 1809
267 Ga0207640_10038803 3300025981 Bacteria 3009
268 Ga0207658_10079966 3300025986 Bacteria 2502
269 Ga0207677_10133922 3300026023 Bacteria 1886
270 Ga0207677_10638812 3300026023 Bacteria 938
271 Ga0207703_10013257 3300026035 Bacteria 6420
272 Ga0207639_10027148 3300026041 Bacteria 4167
273 Ga0207639_10622571 3300026041 Bacteria 997
274 Ga0207678_10014942 3300026067 Bacteria 6831
275 Ga0207678_10267526 3300026067 Bacteria 1465
276 Ga0207708_10000934 3300026075 Bacteria 21911
277 Ga0207708_10001717 3300026075 Bacteria 16217
278 Ga0207702_10422509 3300026078 Bacteria 1289
279 Ga0207648_10000562 3300026089 Bacteria 41578
280 Ga0207676_11234149 3300026095 Bacteria 741
281 Ga0207674_10003139 3300026116 Bacteria 20371
282 Ga0207674_10013984 3300026116 Bacteria 8873
283 Ga0207674_10146973 3300026116 Bacteria 2315
284 Ga0207675_100000185 3300026118 Bacteria 56425
285 Ga0207683_10000357 3300026121 Bacteria 41951
286 Ga0207683_10448501 3300026121 Bacteria 1189
287 Ga0207698_10265558 3300026142 Bacteria 1579
288 Ga0207698_10538732 3300026142 Bacteria 1142
289 Ga0268266_10015856 3300028379 Bacteria 6449
290 Ga0268265_10083252 3300028380 Bacteria 2532
291 Ga0268264_10002563 3300028381 Bacteria 15930
292 Ga0268264_10247081 3300028381 Bacteria 1656
293 Ga0307511_10171547 3300030521 Bacteria 1191
294 Ga0307512_10012799 3300030522 Bacteria 7895
295 Ga0265760_10027803 3300031090 Bacteria 1658
296 Ga0265340_10365905 3300031247 Bacteria 637
297 Ga0307413_10207865 3300031824 Bacteria 1419
298 Ga0307413_10239330 3300031824 Bacteria 1339
299 Ga0307410_10004706 3300031852 Bacteria 7101
300 Ga0307406_10230514 3300031901 Bacteria 1383
301 Ga0307407_10265992 3300031903 Bacteria 1181
302 Ga0307409_100109798 3300031995 Bacteria 2310
303 Ga0307409_100731361 3300031995 Bacteria 992
304 Ga0307416_100013235 3300032002 Bacteria 5600
305 Ga0307415_100032036 3300032126 Bacteria 3395
306 Ga0373923_0013907 3300035111 Bacteria 3011
307 Ga0373923_0074226 3300035111 Bacteria 1466
308 Ga0373936_0007345 3300035113 Bacteria 4147
309 Ga0373953_0000821 3300035117 Bacteria 8685
310 Ga0373953_0049244 3300035117 Bacteria 1700
311 Ga0373956_0020094 3300035119 Bacteria 2838
312 Ga0373956_0105971 3300035119 Bacteria 1306
313 Ga0373957_0020275 3300035120 Bacteria 2347
314 Ga0373943_0239509 3300035170 Bacteria 1016
315 Ga0373955_0025298 3300035172 Bacteria 3046
316 Ga0373962_0090015 3300035242 Bacteria 944
317 Ga0373924_0018681 3300035410 Bacteria 2675
318 Ga0373931_0028520 3300035691 Bacteria 2859
319 Ga0373933_0055563 3300035724 Bacteria 2375
320 Ga0373937_0010654 3300036401 Bacteria 8037
321 Ga0373925_0128846 3300037068 Bacteria 1971
322 Ga0395899_0177467 3300037312 Bacteria 1497
323 Ga0395900_0208501 3300037418 Bacteria 1974
324 Ga0395898_0303500 3300037466 Bacteria 1523
325 Ga0436364_0967055 3300037853 Bacteria 1303
326 Ga0395901_0156334 3300038443 Bacteria 2395
327 Ga0436365_0305834 3300039437 Bacteria 14509
328 Ga0436363_1441021 3300039450 Bacteria 4934
329 Ga0451837_0570561 3300041494 Bacteria 1017
330 Ga0466972_0015282 3300044658 Bacteria 3838
331 Ga0466972_0021827 3300044658 Bacteria 3189
332 Ga0466972_0026122 3300044658 Bacteria 2893
333 Ga0466965_0027794 3300044683 Bacteria 2746
334 Ga0466966_0033179 3300044684 Bacteria 3343
335 Ga0466966_0310513 3300044684 Bacteria 948
336 Ga0466961_0027897 3300044693 Bacteria 3630
337 Ga0466961_0078094 3300044693 Bacteria 2097
338 Ga0466961_0119207 3300044693 Bacteria 1657
339 Ga0466961_0190710 3300044693 Bacteria 1270
340 Ga0466963_0039194 3300044694 Bacteria 3102
341 Ga0466964_0033284 3300044706 Bacteria 2053
342 Ga0466971_0068066 3300044719 Bacteria 1614
343 Ga0466970_0004746 3300044765 Bacteria 6714
344 Ga0466970_0333215 3300044765 Bacteria 859
345 Ga0466957_0148129 3300044842 Bacteria 1516
346 Ga0466957_0225010 3300044842 Bacteria 1240
347 Ga0466960_0049951 3300044901 Bacteria 2015
348 Ga0466960_0120504 3300044901 Bacteria 1373
349 Ga0466960_0410356 3300044901 Bacteria 781
350 Ga0466959_0022507 3300045049 Bacteria 4660
351 Ga0466959_0532720 3300045049 Bacteria 793
352 Ga0466958_0163782 3300045836 Bacteria 1406
353 Ga0466958_0302480 3300045836 Bacteria 1027
354 Ga0466958_0610780 3300045836 Bacteria 709
355 Ga0466967_0380370 3300045976 Bacteria 1370
356 Ga0466967_0488521 3300045976 Bacteria 1207
357 Ga0466967_0582379 3300045976 Bacteria 1103
358 Ga0466967_0615114 3300045976 Bacteria 1073
359 Ga0495592_0077696 3300046454 Bacteria 2405
360 Ga0495641_0114854 3300046461 Bacteria 1201
361 Ga0495651_0058089 3300046462 Bacteria 2968
362 Ga0495651_0083159 3300046462 Bacteria 2414
363 Ga0495653_0098467 3300046463 Bacteria 2123
364 Ga0495653_0207474 3300046463 Bacteria 1325
365 Ga0495605_0143270 3300046474 Bacteria 1071
366 Ga0495639_0196858 3300046475 Bacteria 985
367 Ga0495662_0062737 3300046476 Bacteria 1795
368 Ga0495664_0055858 3300046477 Bacteria 2348
369 Ga0495584_0143427 3300046491 Bacteria 1213
370 Ga0495594_0265789 3300046499 Bacteria 977
371 Ga0495608_0063970 3300046511 Bacteria 2412
372 Ga0495608_0089567 3300046511 Bacteria 1991
373 Ga0495618_0047145 3300046514 Bacteria 2720
374 Ga0495628_0079666 3300046516 Bacteria 2546
375 Ga0495630_0088997 3300046517 Bacteria 2332
376 Ga0495630_0177116 3300046517 Bacteria 1625
377 Ga0495631_0184395 3300046518 Bacteria 894
378 Ga0495642_0181958 3300046528 Bacteria 915
379 Ga0495652_0079903 3300046529 Bacteria 2702
380 Ga0495652_0197861 3300046529 Bacteria 1527
381 Ga0495665_0200152 3300046531 Bacteria 1035
382 Ga0495586_0100162 3300046535 Bacteria 1607
383 Ga0495587_0143939 3300046536 Bacteria 1359
384 Ga0495645_0010242 3300046543 Bacteria 6569
385 Ga0495645_0178482 3300046543 Bacteria 1457
386 Ga0495667_0025699 3300046559 Bacteria 3966
387 Ga0495667_0094784 3300046559 Bacteria 1932
388 Ga0495667_0668368 3300046559 Bacteria 645
389 Ga0495668_0160145 3300046616 Bacteria 1233
390 Ga0495668_0167907 3300046616 Bacteria 1202
391 Ga0495634_0224108 3300046642 Bacteria 1159
392 Ga0495635_0109767 3300046663 Bacteria 1884
393 Ga0495659_0114803 3300046664 Bacteria 1055
394 Ga0495657_0023275 3300046675 Bacteria 4428
395 Ga0495657_0038134 3300046675 Bacteria 3309
396 Ga0495657_0050898 3300046675 Bacteria 2783
397 Ga0495599_0043191 3300046678 Bacteria 2828
398 Ga0495623_0019997 3300046679 Bacteria 4328
399 Ga0495646_0004480 3300046680 Bacteria 8799
400 Ga0495613_0414008 3300046689 Bacteria 918
401 Ga0495624_0202285 3300046690 Bacteria 1206
402 Ga0495600_0084728 3300046809 Bacteria 2068
403 Ga0495600_0168475 3300046809 Bacteria 1414
404 Ga0495604_0036841 3300047317 Bacteria 3855
405 Ga0495604_0177047 3300047317 Bacteria 1494
406 Ga0495674_0130848 3300047319 Bacteria 2114
407 Ga0495674_0150224 3300047319 Bacteria 1953
408 Ga0495680_0001602 3300047322 Bacteria 24122
409 Ga0495680_0026737 3300047322 Bacteria 4751
410 Ga0495675_0156840 3300047444 Bacteria 1403
411 Ga0495684_0144856 3300047471 Bacteria 1780
412 Ga0495684_0193481 3300047471 Bacteria 1502
413 Ga0495602_0083615 3300048088 Bacteria 2673
414 Ga0495602_0200607 3300048088 Bacteria 1523
415 Ga0496100_0000851 3300048903 Bacteria 14590
416 Ga0496100_0083347 3300048903 Bacteria 2164
417 Ga0496100_0495810 3300048903 Bacteria 940
418 Ga0496101_0002010 3300048904 Bacteria 12348
419 Ga0496101_0068031 3300048904 Bacteria 2602
420 Ga0496101_0086535 3300048904 Bacteria 2324
421 Ga0496101_0301746 3300048904 Bacteria 1254
422 Ga0496102_0004401 3300048905 Bacteria 11902
423 Ga0496102_0171282 3300048905 Bacteria 2044
424 Ga0496102_0391652 3300048905 Bacteria 1307
425 Ga0496102_0398618 3300048905 Bacteria 1294
426 Ga0496102_0400927 3300048905 Bacteria 1290
427 Ga0496103_0001478 3300048906 Bacteria 15713
428 Ga0496103_0370536 3300048906 Bacteria 920
429 Ga0496104_0290796 3300048907 Bacteria 1546
430 Ga0496104_0481101 3300048907 Bacteria 1153
431 Ga0496105_0385523 3300048908 Bacteria 1115
432 Ga0496106_0009123 3300048909 Bacteria 7329
433 Ga0496106_0126173 3300048909 Bacteria 2004
434 Ga0496106_0165676 3300048909 Bacteria 1749
435 Ga0496107_0011198 3300048910 Bacteria 6243
436 Ga0496107_0058090 3300048910 Bacteria 2797
437 Ga0496108_0592774 3300048911 Bacteria 966
438 Ga0496109_0098941 3300048912 Bacteria 2705
439 Ga0496109_0127162 3300048912 Bacteria 2376
440 Ga0496110_0138279 3300048913 Bacteria 2202
441 Ga0496113_0009571 3300048916 Bacteria 6359
442 Ga0496114_0003807 3300048917 Bacteria 11632
443 Ga0496114_0019296 3300048917 Bacteria 5524
444 Ga0496114_0114369 3300048917 Bacteria 2314
445 Ga0496114_0331417 3300048917 Bacteria 1345
446 Ga0496114_0333990 3300048917 Bacteria 1340
447 Ga0496115_0098691 3300048918 Bacteria 2392
448 Ga0496115_0123382 3300048918 Bacteria 2132
449 Ga0496116_0000657 3300048919 Bacteria 45190
450 Ga0496117_0004492 3300048920 Bacteria 15334
451 Ga0496117_0031265 3300048920 Bacteria 4068
452 Ga0496118_0003347 3300048921 Bacteria 20293
453 Ga0496118_0026698 3300048921 Bacteria 4910
454 Ga0496118_0352257 3300048921 Bacteria 784
455 Ga0496119_0006305 3300048922 Bacteria 11045
456 Ga0496119_0066921 3300048922 Bacteria 2120
457 Ga0496119_0423867 3300048922 Bacteria 631
458 Ga0496120_0076898 3300048923 Bacteria 1818
459 Ga0496122_0000548 3300048925 Bacteria 77737
460 Ga0496126_0000003 3300048929 Bacteria 961576
461 Ga0496126_0188413 3300048929 Bacteria 1748
462 Ga0501031_0384582 3300049568 Bacteria 908
463 Ga0501033_0021472 3300049570 Bacteria 4871
464 Ga0501033_0404717 3300049570 Bacteria 951
465 Ga0501034_0011675 3300049571 Bacteria 9089
466 Ga0501034_0175520 3300049571 Bacteria 2109
467 Ga0501034_0199962 3300049571 Bacteria 1957
468 Ga0501036_0099736 3300049572 Bacteria 2456
469 Ga0501037_0280629 3300049573 Bacteria 1161
470 Ga0501038_0266139 3300049574 Bacteria 1353
471 Ga0501039_0477640 3300049575 Bacteria 979
472 Ga0501040_0160470 3300049576 Bacteria 1589
473 Ga0501040_0178952 3300049576 Bacteria 1503
474 Ga0501041_0384798 3300049577 Bacteria 888
475 Ga0501046_0168612 3300049580 Bacteria 1644
476 Ga0501046_0217618 3300049580 Bacteria 1416
477 Ga0501047_0112240 3300049581 Bacteria 2608
478 Ga0501047_0180739 3300049581 Bacteria 1976
479 Ga0501047_0231161 3300049581 Bacteria 1703
480 Ga0501048_0069702 3300049582 Bacteria 2483
481 Ga0501068_0018370 3300049584 Bacteria 4050
482 Ga0501068_0282929 3300049584 Bacteria 1060
483 Ga0501070_0526317 3300049586 Bacteria 948
484 Ga0501071_0748822 3300049587 Bacteria 753
485 Ga0501073_0138864 3300049589 Bacteria 1684
486 Ga0501074_0093501 3300049590 Bacteria 2153
487 Ga0501076_0201262 3300049592 Bacteria 1626
488 Ga0501076_0678275 3300049592 Bacteria 851
489 Ga0501080_0167338 3300049742 Bacteria 2028
490 Ga0501083_0409633 3300049744 Bacteria 882
491 Ga0501035_0204735 3300049822 Bacteria 1691
492 Ga0501035_0240394 3300049822 Bacteria 1540
493 Ga0501044_0123801 3300049823 Bacteria 2584
494 nmdc:mga00v17_8860_c1 3300050491 Bacteria 5424
495 nmdc:mga08y16_411951_c1 3300050511 Bacteria 1382
496 nmdc:mga0n895_13252_c1 3300050512 Bacteria 7430
497 nmdc:mga0rr50_281857_c1 3300050513 Bacteria 1387
498 nmdc:mga0rr50_478241_c1 3300050513 Bacteria 1058
499 nmdc:mga0a205_29194_c1 3300050515 Bacteria 5278
500 nmdc:mga0a205_613002_c1 3300050515 Bacteria 941
501 nmdc:mga0a205_87875_c1 3300050515 Bacteria 3003
502 Ga0495601_0039518 3300053077 Bacteria 2954
503 Ga0495601_0129459 3300053077 Bacteria 1643
504 Ga0495595_0156958 3300053084 Bacteria 1121
505 Ga0495619_0013366 3300053085 Bacteria 5172
506 Ga0495619_0207890 3300053085 Bacteria 1355
507 Ga0495619_0444634 3300053085 Bacteria 894
508 Ga0500644_0143652 3300053088 Bacteria 950
509 Ga0500628_056438 3300053129 Bacteria 948
510 Ga0500559_0162538 3300053136 Bacteria 1049
511 Ga0500577_0053454 3300053142 Bacteria 1526
512 Ga0501084_0105644 3300054114 Bacteria 2365
513 Ga0590075_003347 3300059424 Bacteria 3818
514 Ga0590077_004715 3300059426 Bacteria 2793
515 Ga0501082_0023773 3300060353 Bacteria 5284
516 Ga0501082_0233977 3300060353 Bacteria 1599
517 Ga0501082_0486103 3300060353 Bacteria 1079
518 Ga0466962_0036989 3300061719 Bacteria 2336
519 2644096004 2643221616 Bacteria 4066575
520 2884765364 2884763398 Bacteria 4091164
521 2917739280 2917736166 Bacteria 9690793
522 8002792000 8002784119 Bacteria 9788632
523 nmdc:mga05p37_237078_c1
524 JGI24735J21928_10014665
525 JGI24748J21848_1018014
526 JGI24738J21930_10035461
527 JGI24744J21845_10002507
528 JGI24034J26672_10008463
529 JGI24742J22300_10005122
530 JGI25164J39214_1000348
531 JGI25165J46597_1000002
532 Ga0070676_10021442
533 Ga0070683_100000145
534 Ga0070683_100617781
535 Ga0070683_100921654
536 Ga0070670_100175987
537 Ga0068869_100044570
538 Ga0068869_101262895
539 Ga0070666_10040277
540 Ga0070680_100034223
541 Ga0070680_100147082
542 Ga0070680_100193650
543 Ga0070682_100024444
544 Ga0070682_100071243
545 Ga0068868_100010771
546 Ga0068868_100172505
547 Ga0070660_100152802
548 Ga0070660_100326320
549 Ga0070689_100043311
550 Ga0070689_100364549
551 Ga0070687_100037788
552 Ga0070692_10177708
553 Ga0070668_100000260
554 Ga0070669_100005020
555 Ga0070671_100029057
556 Ga0070674_100001471
557 Ga0070688_100130092
558 Ga0070688_100252324
559 Ga0070659_100015434
560 Ga0070659_100553907
561 Ga0070667_100003154
562 Ga0070709_10036407
563 Ga0070714_100000018
564 Ga0070714_100005053
565 Ga0070714_100098852
566 Ga0070714_100640791
567 Ga0070713_100030818
568 Ga0070713_100232375
569 Ga0070713_100478729
570 Ga0070710_10000061
571 Ga0070710_10001204
572 Ga0070710_10005198
573 Ga0070710_10007636
574 Ga0070701_10023735
575 Ga0070701_10052375
576 Ga0070711_100002291
577 Ga0070711_100153591
578 Ga0070700_100008610
579 Ga0070700_100030791
580 Ga0070700_100109051
581 Ga0070694_100082402
582 Ga0070708_100152916
583 Ga0070663_100166854
584 Ga0070678_100015526
585 Ga0070678_100244111
586 Ga0070662_100048981
587 Ga0070662_100227151
588 Ga0070681_10049236
589 Ga0070681_10183115
590 Ga0070681_10221429
591 Ga0068867_100001593
592 Ga0070685_10029193
593 Ga0070707_100041696
594 Ga0070698_100108649
595 Ga0070699_100074657
596 Ga0070679_100089513
597 Ga0070679_100122828
598 Ga0070679_100733796
599 Ga0070684_100014905
600 Ga0070684_100091957
601 Ga0070684_100097031
602 Ga0068853_100007611
603 Ga0068853_100196441
604 Ga0070672_100172258
605 Ga0070686_100032805
606 Ga0070695_100073989
607 Ga0070695_100262876
608 Ga0070696_100061788
609 Ga0070665_100016945
610 Ga0070704_100000340
611 Ga0068855_100282294
612 Ga0068855_100324270
613 Ga0070664_100005937
614 Ga0070664_100262190
615 Ga0068857_100000293
616 Ga0068857_100187810
617 Ga0068854_100019080
618 Ga0068854_100060799
619 Ga0068856_100281869
620 Ga0068856_100885560
621 Ga0070702_100003127
622 Ga0070702_100011634
623 Ga0068852_100209016
624 Ga0068852_100225760
625 Ga0068859_100009269
626 Ga0068859_100156874
627 Ga0068864_100925847
628 Ga0068866_10000121
629 Ga0068861_100000790
630 Ga0068851_10276849
631 Ga0068858_100001167
632 Ga0068858_100383038
633 Ga0068860_100000694
634 Ga0068860_100259941
635 Ga0068862_100009025
636 Ga0081539_10001747
637 Ga0070717_10012977
638 Ga0070717_10035068
639 Ga0070717_10525660
640 Ga0075364_10010779
641 Ga0075364_10172829
642 Ga0070715_10051927
643 Ga0070716_100031533
644 Ga0070716_100035259
645 Ga0070716_100638943
646 Ga0070712_100001253
647 Ga0070712_100346062
648 Ga0075362_10075608
649 Ga0097621_100038249
650 Ga0097621_100046781
651 Ga0068871_100023578
652 Ga0075433_10072317
653 Ga0075433_10075369
654 Ga0075433_10357116
655 Ga0075434_100009510
656 Ga0075434_100104701
657 Ga0068865_100001845
658 Ga0068865_100002458
659 Ga0068865_100196151
660 Ga0097620_100009269
661 Ga0097620_100156869
662 Ga0075435_100063755
663 Ga0105240_10487365
664 Ga0111539_10142614
665 Ga0105245_10004378
666 Ga0105245_10041755
667 Ga0105247_10001791
668 Ga0105243_10001167
669 Ga0105241_11044410
670 Ga0105242_10003499
671 Ga0105248_10010767
672 Ga0105248_10401001
673 Ga0105237_10132863
674 Ga0105238_10588448
675 Ga0105249_10013190
676 Ga0105249_10498436
677 Ga0105239_10021292
678 Ga0105239_10168983
679 Ga0105239_11341371
680 Ga0105246_10012365
681 Ga0105246_10069750
682 Ga0157369_10267410
683 Ga0157369_10507267
684 Ga0157369_10876902
685 Ga0157369_11539231
686 Ga0157374_10690722
687 Ga0157374_10866662
688 Ga0157378_10003368
689 Ga0157378_10342521
690 Ga0163162_10002977
691 Ga0163162_10102420
692 Ga0157372_10054371
693 Ga0157372_10139573
694 Ga0157372_10384682
695 Ga0157372_11053736
696 Ga0157375_10000845
697 Ga0157375_10065658
698 Ga0157380_10010769
699 Ga0182008_10357236
700 Ga0157377_10022725
701 Ga0157377_10144601
702 Ga0157379_10005753
703 Ga0157379_10156070
704 Ga0157376_10083265
705 Ga0157376_10086507
706 Ga0163161_10009845
707 Ga0197907_10873831
708 Ga0206349_1774794
709 Ga0206350_10171960
710 Ga0206353_10147238
711 Ga0213874_10008690
712 Ga0213876_10001978
713 Ga0224712_10029903
714 Ga0207427_100052
715 Ga0209437_100821
716 Ga0209233_1000001
717 Ga0209233_1048006
718 Ga0207692_10003379
719 Ga0207692_10014116
720 Ga0207692_10195117
721 Ga0207642_10001157
722 Ga0207642_10065762
723 Ga0207710_10045891
724 Ga0207688_10001866
725 Ga0207680_10048400
726 Ga0207647_10084507
727 Ga0207647_10249433
728 Ga0207647_10401307
729 Ga0207699_10069959
730 Ga0207699_10375926
731 Ga0207643_10240520
732 Ga0207705_10183093
733 Ga0207671_10094571
734 Ga0207693_10000174
735 Ga0207693_10002716
736 Ga0207693_10107257
737 Ga0207663_10000793
738 Ga0207663_10005542
739 Ga0207663_10058137
740 Ga0207660_10080933
741 Ga0207660_10089557
742 Ga0207660_10217177
743 Ga0207662_10035117
744 Ga0207657_10001374
745 Ga0207657_10028883
746 Ga0207657_10073206
747 Ga0207652_10098358
748 Ga0207652_10505585
749 Ga0207652_10519011
750 Ga0207646_10655381
751 Ga0207681_10005060
752 Ga0207650_10503523
753 Ga0207659_10255784
754 Ga0207687_10002539
755 Ga0207687_10019627
756 Ga0207700_10032720
757 Ga0207700_10579183
758 Ga0207664_10000003
759 Ga0207664_10036820
760 Ga0207664_10141987
761 Ga0207644_10018078
762 Ga0207644_10145942
763 Ga0207690_10248051
764 Ga0207690_10546680
765 Ga0207706_10001344
766 Ga0207706_10062718
767 Ga0207686_10023480
768 Ga0207686_10066157
769 Ga0207686_10147967
770 Ga0207709_10004446
771 Ga0207670_10035793
772 Ga0207669_10001213
773 Ga0207704_10000200
774 Ga0207704_10004673
775 Ga0207704_10073200
776 Ga0207665_10008658
777 Ga0207665_10044816
778 Ga0207665_10102891
779 Ga0207691_10252457
780 Ga0207711_10050559
781 Ga0207689_10020111
782 Ga0207689_10413172
783 Ga0207661_10001823
784 Ga0207679_10152476
785 Ga0207667_10375870
786 Ga0207667_10491265
787 Ga0207712_10010432
788 Ga0207712_10148294
789 Ga0207640_10038803
790 Ga0207658_10079966
791 Ga0207677_10133922
792 Ga0207677_10638812
793 Ga0207703_10013257
794 Ga0207639_10027148
795 Ga0207639_10622571
796 Ga0207678_10014942
797 Ga0207678_10267526
798 Ga0207708_10000934
799 Ga0207708_10001717
800 Ga0207702_10422509
801 Ga0207648_10000562
802 Ga0207676_11234149
803 Ga0207674_10003139
804 Ga0207674_10013984
805 Ga0207674_10146973
806 Ga0207675_100000185
807 Ga0207683_10000357
808 Ga0207683_10448501
809 Ga0207698_10265558
810 Ga0207698_10538732
811 Ga0268266_10015856
812 Ga0268265_10083252
813 Ga0268264_10002563
814 Ga0268264_10247081
815 Ga0307511_10171547
816 Ga0307512_10012799
817 Ga0265760_10027803
818 Ga0265340_10365905
819 Ga0307413_10207865
820 Ga0307413_10239330
821 Ga0307410_10004706
822 Ga0307406_10230514
823 Ga0307407_10265992
824 Ga0307409_100109798
825 Ga0307409_100731361
826 Ga0307416_100013235
827 Ga0307415_100032036
828 Ga0373923_0013907
829 Ga0373923_0074226
830 Ga0373936_0007345
831 Ga0373953_0000821
832 Ga0373953_0049244
833 Ga0373956_0020094
834 Ga0373956_0105971
835 Ga0373957_0020275
836 Ga0373943_0239509
837 Ga0373955_0025298
838 Ga0373962_0090015
839 Ga0373924_0018681
840 Ga0373931_0028520
841 Ga0373933_0055563
842 Ga0373937_0010654
843 Ga0373925_0128846
844 Ga0395899_0177467
845 Ga0395900_0208501
846 Ga0395898_0303500
847 Ga0436364_0967055
848 Ga0395901_0156334
849 Ga0436365_0305834
850 Ga0436363_1441021
851 Ga0451837_0570561
852 Ga0466972_0015282
853 Ga0466972_0021827
854 Ga0466972_0026122
855 Ga0466965_0027794
856 Ga0466966_0033179
857 Ga0466966_0310513
858 Ga0466961_0027897
859 Ga0466961_0078094
860 Ga0466961_0119207
861 Ga0466961_0190710
862 Ga0466963_0039194
863 Ga0466964_0033284
864 Ga0466971_0068066
865 Ga0466970_0004746
866 Ga0466970_0333215
867 Ga0466957_0148129
868 Ga0466957_0225010
869 Ga0466960_0049951
870 Ga0466960_0120504
871 Ga0466960_0410356
872 Ga0466959_0022507
873 Ga0466959_0532720
874 Ga0466958_0163782
875 Ga0466958_0302480
876 Ga0466958_0610780
877 Ga0466967_0380370
878 Ga0466967_0488521
879 Ga0466967_0582379
880 Ga0466967_0615114
881 Ga0495592_0077696
882 Ga0495641_0114854
883 Ga0495651_0058089
884 Ga0495651_0083159
885 Ga0495653_0098467
886 Ga0495653_0207474
887 Ga0495605_0143270
888 Ga0495639_0196858
889 Ga0495662_0062737
890 Ga0495664_0055858
891 Ga0495584_0143427
892 Ga0495594_0265789
893 Ga0495608_0063970
894 Ga0495608_0089567
895 Ga0495618_0047145
896 Ga0495628_0079666
897 Ga0495630_0088997
898 Ga0495630_0177116
899 Ga0495631_0184395
900 Ga0495642_0181958
901 Ga0495652_0079903
902 Ga0495652_0197861
903 Ga0495665_0200152
904 Ga0495586_0100162
905 Ga0495587_0143939
906 Ga0495645_0010242
907 Ga0495645_0178482
908 Ga0495667_0025699
909 Ga0495667_0094784
910 Ga0495667_0668368
911 Ga0495668_0160145
912 Ga0495668_0167907
913 Ga0495634_0224108
914 Ga0495635_0109767
915 Ga0495659_0114803
916 Ga0495657_0023275
917 Ga0495657_0038134
918 Ga0495657_0050898
919 Ga0495599_0043191
920 Ga0495623_0019997
921 Ga0495646_0004480
922 Ga0495613_0414008
923 Ga0495624_0202285
924 Ga0495600_0084728
925 Ga0495600_0168475
926 Ga0495604_0036841
927 Ga0495604_0177047
928 Ga0495674_0130848
929 Ga0495674_0150224
930 Ga0495680_0001602
931 Ga0495680_0026737
932 Ga0495675_0156840
933 Ga0495684_0144856
934 Ga0495684_0193481
935 Ga0495602_0083615
936 Ga0495602_0200607
937 Ga0496100_0000851
938 Ga0496100_0083347
939 Ga0496100_0495810
940 Ga0496101_0002010
941 Ga0496101_0068031
942 Ga0496101_0086535
943 Ga0496101_0301746
944 Ga0496102_0004401
945 Ga0496102_0171282
946 Ga0496102_0391652
947 Ga0496102_0398618
948 Ga0496102_0400927
949 Ga0496103_0001478
950 Ga0496103_0370536
951 Ga0496104_0290796
952 Ga0496104_0481101
953 Ga0496105_0385523
954 Ga0496106_0009123
955 Ga0496106_0126173
956 Ga0496106_0165676
957 Ga0496107_0011198
958 Ga0496107_0058090
959 Ga0496108_0592774
960 Ga0496109_0098941
961 Ga0496109_0127162
962 Ga0496110_0138279
963 Ga0496113_0009571
964 Ga0496114_0003807
965 Ga0496114_0019296
966 Ga0496114_0114369
967 Ga0496114_0331417
968 Ga0496114_0333990
969 Ga0496115_0098691
970 Ga0496115_0123382
971 Ga0496116_0000657
972 Ga0496117_0004492
973 Ga0496117_0031265
974 Ga0496118_0003347
975 Ga0496118_0026698
976 Ga0496118_0352257
977 Ga0496119_0006305
978 Ga0496119_0066921
979 Ga0496119_0423867
980 Ga0496120_0076898
981 Ga0496122_0000548
982 Ga0496126_0000003
983 Ga0496126_0188413
984 Ga0501031_0384582
985 Ga0501033_0021472
986 Ga0501033_0404717
987 Ga0501034_0011675
988 Ga0501034_0175520
989 Ga0501034_0199962
990 Ga0501036_0099736
991 Ga0501037_0280629
992 Ga0501038_0266139
993 Ga0501039_0477640
994 Ga0501040_0160470
995 Ga0501040_0178952
996 Ga0501041_0384798
997 Ga0501046_0168612
998 Ga0501046_0217618
999 Ga0501047_0112240
1000 Ga0501047_0180739
1001 Ga0501047_0231161
1002 Ga0501048_0069702
1003 Ga0501068_0018370
1004 Ga0501068_0282929
1005 Ga0501070_0526317
1006 Ga0501071_0748822
1007 Ga0501073_0138864
1008 Ga0501074_0093501
1009 Ga0501076_0201262
1010 Ga0501076_0678275
1011 Ga0501080_0167338
1012 Ga0501083_0409633
1013 Ga0501035_0204735
1014 Ga0501035_0240394
1015 Ga0501044_0123801
1016 nmdc:mga00v17_8860_c1
1017 nmdc:mga08y16_411951_c1
1018 nmdc:mga0n895_13252_c1
1019 nmdc:mga0rr50_281857_c1
1020 nmdc:mga0rr50_478241_c1
1021 nmdc:mga0a205_29194_c1
1022 nmdc:mga0a205_613002_c1
1023 nmdc:mga0a205_87875_c1
1024 Ga0495601_0039518
1025 Ga0495601_0129459
1026 Ga0495595_0156958
1027 Ga0495619_0013366
1028 Ga0495619_0207890
1029 Ga0495619_0444634
1030 Ga0500644_0143652
1031 Ga0500628_056438
1032 Ga0500559_0162538
1033 Ga0500577_0053454
1034 Ga0501084_0105644
1035 Ga0590075_003347
1036 Ga0590077_004715
1037 Ga0501082_0023773
1038 Ga0501082_0233977
1039 Ga0501082_0486103
1040 Ga0466962_0036989
1041 2644096004
1042 2884765364
1043 2917739280
1044 8002792000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

30

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.9505 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.9499 9 181
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.9294 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.9289 9 181
2a67-assembly1.cif.gz_A crystal structure of isochorismatase family protein 0.9032 7 176
ID Description Score Start End Superfamily
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9017 8 176 3.40.50.850
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8859 8 176 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8858 9 179 3.40.50.850
3irvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8824 6 179 3.40.50.850
4h17B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8708 9 181 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A522QCS9-F1-model_v4 Isochorismatase family protein 0.9825 1 116 GO:0016810
AF-A0A6H0SEK1-F1-model_v4 Isochorismatase family protein 0.9798 9 140 GO:0016787
AF-A0A2H1KAL9-F1-model_v4 Nicotinamidase-related amidase 0.9771 7 182 GO:0016787
AF-K0JTM8-F1-model_v4 Isochorismatase 0.9751 1 182 GO:0016787
AF-H0QP25-F1-model_v4 Isochorismatase family protein 0.9749 1 182 GO:0016810

Map