F458919

General Info

Members Datasets Scaffolds Average Seq Length
522 284 1044 254

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541280|2738738631
Length 287
Sequence NSITAPTADAPDIAVAQPDTDLAVGVAVPAGAAAPPATPEAAAAPAPAIAGLPPRFACFVTGTDTEIGKTLTSSALLHALVKQGVRACGMKPVAAGAELRDGVLHNDDADQLIAAGNVTMLQSLTTPYMLKEPAAPHIAAALEGVTIDPVPILAAYLEIAAATDAVVVEGVGGFRVPLNDSFDTADLAQQLDLPVILVVGLRLGCISHALLTVEAIAARGLTLVGWVANELQDEMAYADENIAALEQRIPAPLLGRVPRLAQPTAAAAAAHLNFTGLPNWPARRNNT

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
104 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
216 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
221 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
222 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2738541280 Massilia sp. GV090 Isolate Unclassified
225 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
226 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
227 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
228 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
229 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
230 2519103095 Burkholderia sp. KJ006 Isolate Nodule
231 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
232 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
233 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
234 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
235 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
236 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
237 2643221638 Duganella sp. Root336D2 Isolate Unclassified
238 2643221645 Massilia sp. Root351 Isolate Unclassified
239 2643221664 Massilia sp. Root418 Isolate Unclassified
240 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
241 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
242 2738541297 Duganella sp. GV083 Isolate Unclassified
243 2738541300 Massilia sp. GV016 Isolate Unclassified
244 2738541357 Duganella sp. GV053 Isolate Unclassified
245 2738543003 Duganella sp. GV066 Isolate Unclassified
246 2738543018 Massilia sp. GV045 Isolate Unclassified
247 2738543026 Duganella sp. GV089 Isolate Unclassified
248 2738543029 Duganella sp. GV039 Isolate Unclassified
249 2738543030 Massilia sp. GV097 Isolate Unclassified
250 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
251 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
252 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
253 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
254 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
255 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
256 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
257 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
258 2818991436 Collimonas arenae 515 Isolate Unclassified
259 2821131069 Duganella sp. 1224 Isolate Unclassified
260 2842711865 Duganella sp. R-73148 Isolate Unclassified
261 2855730933 Achromobacter sp. HZ28 Isolate Nodule
262 2855767633 Achromobacter sp. HZ34 Isolate Nodule
263 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
264 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
265 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
266 2857553236 Duganella sp. R-74557 Isolate Unclassified
267 2857558681 Duganella sp. R-74565 Isolate Unclassified
268 2857564685 Duganella sp. R-74599 Isolate Unclassified
269 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
270 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
271 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
272 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
273 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
274 2904424332 Duganella sp. 1411 Isolate Rhizosphere
275 2919476304 Duganella sp. 3397 Isolate Unclassified
276 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
277 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
278 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
279 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
280 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
281 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
282 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
283 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
284 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.31
Metatranscriptomes 0
Isolates 11.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.16
Nodule 2.49
Rhizoplane 5.56
Rhizosphere 60.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017649 3300001989 Bacteria 2572
2 JGI24735J21928_10003878 3300002067 Bacteria 5060
3 JGI25162J39368_1000023 3300002737 Bacteria 236658
4 JGI25152J39213_1000396 3300002773 Bacteria 26523
5 JGI25150J39212_1004980 3300002774 Bacteria 2881
6 JGI25150J39212_1005218 3300002774 Bacteria 2798
7 JGI25159J45721_1004101 3300002987 Bacteria 4941
8 JGI25165J46597_1000030 3300003214 Bacteria 305254
9 JGI25153J46596_10009292 3300003215 Bacteria 4594
10 rootH1_10066045 3300003316 Bacteria 1820
11 rootL2_10014217 3300003322 Bacteria 2070
12 JGI25160J50197_1002658 3300003354 Bacteria 8232
13 JGI25161J50226_1001649 3300003374 Bacteria 6421
14 Ga0055538_1000017 3300003751 Bacteria 305254
15 Ga0055539_1000022 3300003752 Bacteria 305254
16 Ga0055533_1000030 3300003756 Bacteria 305254
17 Ga0055532_1009742 3300003758 Bacteria 1161
18 Ga0055525_1000034 3300003759 Bacteria 305254
19 Ga0055527_1000456 3300003760 Bacteria 15978
20 Ga0055527_1000737 3300003760 Bacteria 9229
21 Ga0055535_1001300 3300003761 Bacteria 13406
22 Ga0055535_1001310 3300003761 Bacteria 13304
23 Ga0055542_1001190 3300003762 Bacteria 14841
24 Ga0055542_1005978 3300003762 Bacteria 2661
25 Ga0055529_1000015 3300003763 Bacteria 366950
26 Ga0055529_1000778 3300003763 Bacteria 19884
27 Ga0055529_1008485 3300003763 Bacteria 1366
28 Ga0055526_1000007 3300003771 Bacteria 321998
29 Ga0055526_1000519 3300003771 Bacteria 30711
30 Ga0055537_1000005 3300003773 Bacteria 160497
31 Ga0055537_1012988 3300003773 Bacteria 1591
32 Ga0055524_1000038 3300003775 Bacteria 162683
33 Ga0055524_1002567 3300003775 Bacteria 9264
34 Ga0055524_1004571 3300003775 Bacteria 6365
35 Ga0055524_1016588 3300003775 Bacteria 2635
36 Ga0055524_1026048 3300003775 Bacteria 1818
37 Ga0055534_1000144 3300003784 Bacteria 53179
38 Ga0055534_1001556 3300003784 Bacteria 8945
39 Ga0055534_1009034 3300003784 Bacteria 2201
40 Ga0055528_1000082 3300003790 Bacteria 74945
41 Ga0055528_1002252 3300003790 Bacteria 10500
42 Ga0055530_10011013 3300003791 Bacteria 3283
43 Ga0055541_1000015 3300003841 Bacteria 305254
44 Ga0058692_1001488 3300003856 Bacteria 8596
45 Ga0070671_100432941 3300005355 Bacteria 1127
46 Ga0070678_100533153 3300005456 Bacteria 1040
47 Ga0070665_100096814 3300005548 Bacteria 2956
48 Ga0068852_100813593 3300005616 Bacteria 949
49 Ga0070712_100062830 3300006175 Bacteria 2627
50 Ga0079104_1012858 3300006946 Bacteria 2606
51 Ga0099826_10000008 3300006948 Bacteria 380974
52 Ga0099794_10087345 3300007265 Bacteria 1545
53 Ga0105251_10000332 3300009011 Bacteria 47333
54 Ga0105244_10001182 3300009036 Bacteria 21601
55 Ga0105244_10002384 3300009036 Bacteria 14240
56 Ga0105244_10044845 3300009036 Bacteria 2277
57 Ga0105240_11010952 3300009093 Bacteria 889
58 Ga0105248_10060098 3300009177 Bacteria 4267
59 Ga0105248_10314519 3300009177 Bacteria 1764
60 Ga0105238_10081701 3300009551 Bacteria 3221
61 Ga0105246_10053578 3300011119 Bacteria 2776
62 Ga0157369_10618352 3300013105 Bacteria 1118
63 Ga0182008_10000386 3300014497 Bacteria 34116
64 Ga0182006_1000007 3300015261 Bacteria 452190
65 Ga0182006_1000023 3300015261 Bacteria 275031
66 Ga0182006_1046878 3300015261 Bacteria 1678
67 Ga0182007_10000022 3300015262 Bacteria 189018
68 Ga0182007_10003321 3300015262 Bacteria 7615
69 Ga0182007_10003563 3300015262 Bacteria 7323
70 Ga0182005_1000006 3300015265 Bacteria 515188
71 Ga0182005_1000010 3300015265 Bacteria 434103
72 Ga0182005_1000914 3300015265 Bacteria 12926
73 Ga0163161_10030595 3300017792 Bacteria 3833
74 Ga0213872_10000024 3300021361 Bacteria 155437
75 Ga0213872_10000227 3300021361 Bacteria 49306
76 Ga0213872_10001671 3300021361 Bacteria 13963
77 Ga0213872_10063447 3300021361 Bacteria 1669
78 Ga0209760_101371 3300025207 Bacteria 2617
79 Ga0209784_100034 3300025224 Bacteria 305504
80 Ga0209566_100038 3300025225 Bacteria 305504
81 Ga0209674_100056 3300025226 Bacteria 305504
82 Ga0209672_100041 3300025228 Bacteria 278535
83 Ga0209672_100153 3300025228 Bacteria 61197
84 Ga0209147_100202 3300025229 Bacteria 65528
85 Ga0209147_100334 3300025229 Bacteria 35260
86 Ga0209563_100057 3300025230 Bacteria 305604
87 Ga0207427_100288 3300025231 Bacteria 35935
88 Ga0209437_100071 3300025233 Bacteria 305604
89 Ga0209437_101445 3300025233 Bacteria 5797
90 Ga0209437_113866 3300025233 Bacteria 1141
91 Ga0209258_100023 3300025242 Bacteria 547286
92 Ga0209258_100120 3300025242 Bacteria 183488
93 Ga0207425_1000009 3300025245 Bacteria 593135
94 Ga0207425_1000036 3300025245 Bacteria 225783
95 Ga0207425_1001241 3300025245 Bacteria 11194
96 Ga0207425_1039824 3300025245 Bacteria 899
97 Ga0209646_1000042 3300025246 Bacteria 343923
98 Ga0209677_100035 3300025253 Bacteria 305504
99 Ga0209148_1000646 3300025254 Bacteria 30170
100 Ga0209759_1016116 3300025256 Bacteria 1900
101 Ga0209129_1000051 3300025258 Bacteria 267104
102 Ga0209233_1000094 3300025261 Bacteria 305604
103 Ga0209565_1000074 3300025263 Bacteria 164237
104 Ga0209565_1000802 3300025263 Bacteria 18043
105 Ga0209565_1004911 3300025263 Bacteria 3985
106 Ga0209565_1006548 3300025263 Bacteria 3254
107 Ga0209455_1000031 3300025272 Bacteria 519952
108 Ga0209455_1000064 3300025272 Bacteria 332404
109 Ga0209455_1000941 3300025272 Bacteria 14906
110 Ga0209673_1000084 3300025273 Bacteria 215878
111 Ga0209673_1000129 3300025273 Bacteria 164238
112 Ga0209673_1008206 3300025273 Bacteria 4684
113 Ga0209675_1000072 3300025291 Bacteria 164237
114 Ga0209675_1000837 3300025291 Bacteria 20157
115 Ga0209675_1009698 3300025291 Bacteria 3376
116 Ga0209564_1000010 3300025295 Bacteria 885399
117 Ga0209564_1000042 3300025295 Bacteria 392805
118 Ga0209564_1000160 3300025295 Bacteria 164214
119 Ga0209564_1000172 3300025295 Bacteria 155715
120 Ga0209564_1003635 3300025295 Bacteria 10237
121 Ga0209564_1004414 3300025295 Bacteria 8623
122 Ga0209564_1029412 3300025295 Bacteria 1730
123 Ga0209758_1000054 3300025297 Bacteria 337655
124 Ga0209758_1000433 3300025297 Bacteria 70750
125 Ga0209050_1000502 3300025298 Bacteria 66494
126 Ga0209050_1008669 3300025298 Bacteria 5368
127 Ga0209256_1000018 3300025299 Bacteria 568467
128 Ga0209256_1000125 3300025299 Bacteria 165336
129 Ga0209256_1000422 3300025299 Bacteria 66695
130 Ga0209256_1004056 3300025299 Bacteria 9528
131 Ga0209256_1004492 3300025299 Bacteria 8716
132 Ga0207426_1001336 3300025302 Bacteria 20936
133 Ga0207426_1007451 3300025302 Bacteria 4580
134 Ga0209051_1013074 3300025303 Bacteria 3971
135 Ga0209257_1000087 3300025304 Bacteria 282503
136 Ga0207655_1000718 3300025728 Bacteria 37593
137 Ga0207655_1022512 3300025728 Bacteria 3156
138 Ga0207713_1001844 3300025735 Bacteria 16167
139 Ga0207693_10168225 3300025915 Bacteria 1726
140 Ga0207711_10012926 3300025941 Bacteria 6934
141 Ga0207711_10101487 3300025941 Bacteria 2546
142 Ga0207683_10484439 3300026121 Bacteria 1142
143 Ga0207698_10704470 3300026142 Bacteria 1005
144 Ga0209281_1011164 3300027111 Bacteria 2021
145 Ga0209371_1000166 3300027312 Bacteria 100164
146 Ga0209282_1000005 3300027666 Bacteria 380858
147 Ga0268266_10498729 3300028379 Bacteria 1162
148 Ga0268256_1000139 3300030500 Bacteria 100164
149 Ga0316181_1218122 3300030744 Bacteria 1662
150 Ga0265332_10056918 3300031238 Bacteria 1675
151 Ga0265340_10110839 3300031247 Bacteria 1269
152 Ga0307408_100000144 3300031548 Bacteria 79329
153 Ga0307408_100000437 3300031548 Bacteria 37104
154 Ga0307408_100009641 3300031548 Bacteria 6366
155 Ga0307408_100031773 3300031548 Bacteria 3677
156 Ga0307408_100203100 3300031548 Bacteria 1605
157 Ga0265314_10018254 3300031711 Bacteria 5475
158 Ga0307518_10112186 3300031838 Bacteria 1941
159 Ga0307416_100004448 3300032002 Bacteria 8450
160 Ga0307416_100588089 3300032002 Bacteria 1191
161 Ga0307414_10010417 3300032004 Bacteria 5392
162 Ga0307414_10354580 3300032004 Bacteria 1260
163 Ga0307411_10229075 3300032005 Bacteria 1447
164 Ga0395898_0180753 3300037466 Bacteria 2016
165 Ga0395901_0010003 3300038443 Bacteria 9613
166 Ga0436361_0108001 3300039447 Bacteria 112244
167 Ga0436361_0243484 3300039447 Bacteria 26262
168 Ga0436361_0792119 3300039447 Bacteria 4789
169 Ga0466972_0128657 3300044658 Bacteria 1193
170 Ga0466973_0013904 3300044659 Bacteria 7575
171 Ga0466981_0219430 3300044669 Bacteria 1252
172 Ga0466965_0005912 3300044683 Bacteria 5525
173 Ga0466965_0038913 3300044683 Bacteria 2336
174 Ga0466965_0159508 3300044683 Bacteria 1182
175 Ga0466961_0001062 3300044693 Bacteria 16915
176 Ga0466963_0003395 3300044694 Bacteria 9104
177 Ga0466971_0007502 3300044719 Bacteria 4752
178 Ga0466968_0006821 3300044735 Bacteria 4321
179 Ga0466968_0009782 3300044735 Bacteria 3700
180 Ga0466970_0037987 3300044765 Bacteria 2554
181 Ga0466957_0000549 3300044842 Bacteria 18918
182 Ga0466957_0156465 3300044842 Bacteria 1477
183 Ga0466960_0041140 3300044901 Bacteria 2189
184 Ga0466959_0017394 3300045049 Bacteria 5269
185 Ga0495617_000020 3300046452 Bacteria 230257
186 Ga0495617_001275 3300046452 Bacteria 11243
187 Ga0495617_004506 3300046452 Bacteria 5060
188 Ga0495617_089662 3300046452 Bacteria 1004
189 Ga0495627_000004 3300046453 Bacteria 640612
190 Ga0495592_0015528 3300046454 Bacteria 5778
191 Ga0495590_0000012 3300046457 Bacteria 303377
192 Ga0495590_0000977 3300046457 Bacteria 12589
193 Ga0495591_039647 3300046458 Bacteria 1348
194 Ga0495629_0091433 3300046459 Bacteria 2124
195 Ga0495638_0000047 3300046460 Bacteria 216004
196 Ga0495638_0023786 3300046460 Bacteria 4002
197 Ga0495638_0027816 3300046460 Bacteria 3657
198 Ga0495638_0084826 3300046460 Bacteria 1916
199 Ga0495651_0000720 3300046462 Bacteria 25644
200 Ga0495651_0250879 3300046462 Bacteria 1208
201 Ga0495653_0000035 3300046463 Bacteria 129875
202 Ga0495650_0000077 3300046471 Bacteria 245511
203 Ga0495650_0000128 3300046471 Bacteria 177256
204 Ga0495650_0000379 3300046471 Bacteria 77062
205 Ga0495650_0002304 3300046471 Bacteria 15833
206 Ga0495650_0003486 3300046471 Bacteria 11431
207 Ga0495650_0009640 3300046471 Bacteria 5473
208 Ga0495605_0000018 3300046474 Bacteria 270187
209 Ga0495605_0033227 3300046474 Bacteria 2620
210 Ga0495664_0008318 3300046477 Bacteria 5783
211 Ga0495584_0001649 3300046491 Bacteria 13123
212 Ga0495584_0076749 3300046491 Bacteria 1680
213 Ga0495585_0000681 3300046492 Bacteria 30911
214 Ga0495585_0057867 3300046492 Bacteria 2138
215 Ga0495585_0225253 3300046492 Bacteria 944
216 Ga0495596_0069948 3300046500 Bacteria 1364
217 Ga0495607_0002163 3300046501 Bacteria 16369
218 Ga0495607_0002734 3300046501 Bacteria 14073
219 Ga0495607_0006878 3300046501 Bacteria 7932
220 Ga0495607_0070890 3300046501 Bacteria 1945
221 Ga0495607_0092197 3300046501 Bacteria 1639
222 Ga0495583_0000092 3300046506 Bacteria 158865
223 Ga0495583_0000115 3300046506 Bacteria 135762
224 Ga0495583_0000414 3300046506 Bacteria 64875
225 Ga0495583_0033994 3300046506 Bacteria 2447
226 Ga0495606_0000101 3300046507 Bacteria 146752
227 Ga0495606_0000161 3300046507 Bacteria 117607
228 Ga0495606_0000288 3300046507 Bacteria 87389
229 Ga0495606_0000716 3300046507 Bacteria 51314
230 Ga0495606_0000826 3300046507 Bacteria 47010
231 Ga0495606_0003272 3300046507 Bacteria 17361
232 Ga0495606_0006480 3300046507 Bacteria 10773
233 Ga0495606_0010115 3300046507 Bacteria 7875
234 Ga0495606_0029776 3300046507 Bacteria 3826
235 Ga0495606_0045855 3300046507 Bacteria 2893
236 Ga0495606_0060615 3300046507 Bacteria 2423
237 Ga0495606_0063022 3300046507 Bacteria 2364
238 Ga0495608_0011446 3300046511 Bacteria 6174
239 Ga0495608_0063971 3300046511 Bacteria 2412
240 Ga0495610_0000014 3300046512 Bacteria 444708
241 Ga0495610_0003813 3300046512 Bacteria 11496
242 Ga0495610_0008160 3300046512 Bacteria 6836
243 Ga0495610_0010629 3300046512 Bacteria 5702
244 Ga0495610_0031286 3300046512 Bacteria 2777
245 Ga0495610_0040250 3300046512 Bacteria 2357
246 Ga0495616_0000033 3300046513 Bacteria 130486
247 Ga0495616_0029248 3300046513 Bacteria 2910
248 Ga0495616_0063507 3300046513 Bacteria 1804
249 Ga0495618_0143741 3300046514 Bacteria 1525
250 Ga0495620_0029576 3300046515 Bacteria 2533
251 Ga0495628_0001257 3300046516 Bacteria 23206
252 Ga0495628_0002811 3300046516 Bacteria 15632
253 Ga0495628_0058496 3300046516 Bacteria 3028
254 Ga0495630_0114045 3300046517 Bacteria 2048
255 Ga0495637_0000719 3300046520 Bacteria 22655
256 Ga0495637_0001962 3300046520 Bacteria 11624
257 Ga0495637_0031029 3300046520 Bacteria 2366
258 Ga0495637_0058627 3300046520 Bacteria 1587
259 Ga0495643_0000237 3300046522 Bacteria 82853
260 Ga0495643_0000846 3300046522 Bacteria 33222
261 Ga0495643_0057930 3300046522 Bacteria 2063
262 Ga0495643_0058984 3300046522 Bacteria 2041
263 Ga0495644_0002703 3300046523 Bacteria 7035
264 Ga0495644_0009879 3300046523 Bacteria 3673
265 Ga0495644_0016266 3300046523 Bacteria 2848
266 Ga0495648_0000019 3300046524 Bacteria 276407
267 Ga0495648_0000213 3300046524 Bacteria 67606
268 Ga0495648_0007656 3300046524 Bacteria 8611
269 Ga0495648_0008841 3300046524 Bacteria 7882
270 Ga0495648_0021888 3300046524 Bacteria 4415
271 Ga0495648_0033147 3300046524 Bacteria 3378
272 Ga0495648_0110439 3300046524 Bacteria 1497
273 Ga0495666_0038717 3300046526 Bacteria 2318
274 Ga0495642_0000436 3300046528 Bacteria 22058
275 Ga0495642_0024004 3300046528 Bacteria 2411
276 Ga0495642_0029347 3300046528 Bacteria 2195
277 Ga0495642_0042017 3300046528 Bacteria 1861
278 Ga0495642_0219370 3300046528 Bacteria 830
279 Ga0495652_0004705 3300046529 Bacteria 13005
280 Ga0495652_0016007 3300046529 Bacteria 6709
281 Ga0495652_0096236 3300046529 Bacteria 2411
282 Ga0495652_0314582 3300046529 Bacteria 1133
283 Ga0495654_0000014 3300046530 Bacteria 312126
284 Ga0495654_0002526 3300046530 Bacteria 11760
285 Ga0495654_0011705 3300046530 Bacteria 4740
286 Ga0495654_0038156 3300046530 Bacteria 2404
287 Ga0495654_0049762 3300046530 Bacteria 2051
288 Ga0495665_0023700 3300046531 Bacteria 3297
289 Ga0495609_0000824 3300046538 Bacteria 23076
290 Ga0495609_0004410 3300046538 Bacteria 7705
291 Ga0495609_0007201 3300046538 Bacteria 5583
292 Ga0495609_0052246 3300046538 Bacteria 1818
293 Ga0495609_0141273 3300046538 Bacteria 1027
294 Ga0495597_0000081 3300046542 Bacteria 84083
295 Ga0495597_0000152 3300046542 Bacteria 61422
296 Ga0495597_0037556 3300046542 Bacteria 2174
297 Ga0495597_0068604 3300046542 Bacteria 1532
298 Ga0495645_0001268 3300046543 Bacteria 17192
299 Ga0495645_0019366 3300046543 Bacteria 4899
300 Ga0495645_0223428 3300046543 Bacteria 1265
301 Ga0495622_0000019 3300046557 Bacteria 169931
302 Ga0495622_0000037 3300046557 Bacteria 119690
303 Ga0495622_0078231 3300046557 Bacteria 1523
304 Ga0495633_0000086 3300046558 Bacteria 124357
305 Ga0495633_0000091 3300046558 Bacteria 122383
306 Ga0495633_0000280 3300046558 Bacteria 58801
307 Ga0495633_0010253 3300046558 Bacteria 5126
308 Ga0495633_0022970 3300046558 Bacteria 3093
309 Ga0495633_0034218 3300046558 Bacteria 2444
310 Ga0495633_0036244 3300046558 Bacteria 2364
311 Ga0495656_0022899 3300046615 Bacteria 2452
312 Ga0495656_0064656 3300046615 Bacteria 1607
313 Ga0495656_0123524 3300046615 Bacteria 1224
314 Ga0495668_0000575 3300046616 Bacteria 44931
315 Ga0495668_0000582 3300046616 Bacteria 44454
316 Ga0495668_0001497 3300046616 Bacteria 22337
317 Ga0495634_0254507 3300046642 Bacteria 1073
318 Ga0495625_0000208 3300046660 Bacteria 93861
319 Ga0495625_0000675 3300046660 Bacteria 48697
320 Ga0495625_0010694 3300046660 Bacteria 7559
321 Ga0495625_0012234 3300046660 Bacteria 6960
322 Ga0495625_0013339 3300046660 Bacteria 6606
323 Ga0495625_0015779 3300046660 Bacteria 5964
324 Ga0495625_0038790 3300046660 Bacteria 3483
325 Ga0495625_0160527 3300046660 Bacteria 1506
326 Ga0495635_0144382 3300046663 Bacteria 1621
327 Ga0495659_0002236 3300046664 Bacteria 6293
328 Ga0495659_0002768 3300046664 Bacteria 5643
329 Ga0495661_0012776 3300046665 Bacteria 5667
330 Ga0495661_0147069 3300046665 Bacteria 1276
331 Ga0495588_0107893 3300046674 Bacteria 1466
332 Ga0495623_0005164 3300046679 Bacteria 8567
333 Ga0495646_0003863 3300046680 Bacteria 9363
334 Ga0495658_0044679 3300046683 Bacteria 2483
335 Ga0495624_0011977 3300046690 Bacteria 5945
336 Ga0495624_0013981 3300046690 Bacteria 5463
337 Ga0495624_0055990 3300046690 Bacteria 2483
338 Ga0495671_0000005 3300046692 Bacteria 509397
339 Ga0495671_0001012 3300046692 Bacteria 19562
340 Ga0495671_0180769 3300046692 Bacteria 1024
341 Ga0495649_0005693 3300046694 Bacteria 7865
342 Ga0495649_0032350 3300046694 Bacteria 2881
343 Ga0495649_0036597 3300046694 Bacteria 2696
344 Ga0495649_0048140 3300046694 Bacteria 2317
345 Ga0495649_0048915 3300046694 Bacteria 2297
346 Ga0495649_0106349 3300046694 Bacteria 1489
347 Ga0495600_0004213 3300046809 Bacteria 8584
348 Ga0495660_0005205 3300046810 Bacteria 7804
349 Ga0495660_0005939 3300046810 Bacteria 7272
350 Ga0495660_0034206 3300046810 Bacteria 2845
351 Ga0495660_0100855 3300046810 Bacteria 1486
352 Ga0495660_0158238 3300046810 Bacteria 1113
353 Ga0495636_0012008 3300047318 Bacteria 3433
354 Ga0495674_0025855 3300047319 Bacteria 5374
355 Ga0495672_0000019 3300047320 Bacteria 448153
356 Ga0495672_0000026 3300047320 Bacteria 340319
357 Ga0495672_0000226 3300047320 Bacteria 80307
358 Ga0495672_0145822 3300047320 Bacteria 1232
359 Ga0495676_0119746 3300047321 Bacteria 1917
360 Ga0495680_0304448 3300047322 Bacteria 1118
361 Ga0495683_0004403 3300047323 Bacteria 8004
362 Ga0495683_0008614 3300047323 Bacteria 5450
363 Ga0495683_0018108 3300047323 Bacteria 3645
364 Ga0495683_0022765 3300047323 Bacteria 3221
365 Ga0495683_0056278 3300047323 Bacteria 1957
366 Ga0495687_000213 3300047443 Bacteria 83235
367 Ga0495687_000627 3300047443 Bacteria 40736
368 Ga0495687_001996 3300047443 Bacteria 17310
369 Ga0495687_002415 3300047443 Bacteria 15044
370 Ga0495687_009945 3300047443 Bacteria 5262
371 Ga0495675_0170691 3300047444 Bacteria 1336
372 Ga0495679_012841 3300047446 Bacteria 3169
373 Ga0495685_000068 3300047447 Bacteria 39515
374 Ga0495673_0000008 3300047469 Bacteria 752462
375 Ga0495673_0000009 3300047469 Bacteria 731993
376 Ga0495673_0000012 3300047469 Bacteria 656908
377 Ga0495673_0006741 3300047469 Bacteria 6711
378 Ga0495681_0000922 3300047470 Bacteria 22658
379 Ga0495686_0000472 3300047472 Bacteria 60008
380 Ga0495686_0011467 3300047472 Bacteria 6240
381 Ga0495686_0042269 3300047472 Bacteria 2899
382 Ga0495686_0211292 3300047472 Bacteria 1108
383 Ga0495593_0053893 3300047673 Bacteria 2121
384 Ga0495602_0020085 3300048088 Bacteria 6608
385 Ga0495602_0031529 3300048088 Bacteria 5010
386 Ga0495602_0067174 3300048088 Bacteria 3086
387 Ga0495602_0087216 3300048088 Bacteria 2602
388 Ga0495615_0001567 3300048090 Bacteria 3441
389 Ga0495615_0015972 3300048090 Bacteria 1612
390 Ga0495626_0053238 3300048091 Bacteria 1863
391 Ga0496100_0105063 3300048903 Bacteria 1952
392 Ga0496100_0496272 3300048903 Bacteria 940
393 Ga0496101_0013665 3300048904 Bacteria 5445
394 Ga0496101_0574796 3300048904 Bacteria 891
395 Ga0496102_0020524 3300048905 Bacteria 5838
396 Ga0496102_0033996 3300048905 Bacteria 4584
397 Ga0496102_0330431 3300048905 Bacteria 1436
398 Ga0496103_0003963 3300048906 Bacteria 8996
399 Ga0496103_0003976 3300048906 Bacteria 8974
400 Ga0496104_0087773 3300048907 Bacteria 2971
401 Ga0496104_0570959 3300048907 Bacteria 1041
402 Ga0496105_0099937 3300048908 Bacteria 2396
403 Ga0496106_0169539 3300048909 Bacteria 1729
404 Ga0496107_0027333 3300048910 Bacteria 4051
405 Ga0496109_0232069 3300048912 Bacteria 1736
406 Ga0496110_0023168 3300048913 Bacteria 5280
407 Ga0496110_0458286 3300048913 Bacteria 1162
408 Ga0496111_0025352 3300048914 Bacteria 4184
409 Ga0496111_0069071 3300048914 Bacteria 2569
410 Ga0496112_0005904 3300048915 Bacteria 10674
411 Ga0496113_0005524 3300048916 Bacteria 7893
412 Ga0496114_0105796 3300048917 Bacteria 2407
413 Ga0496115_0028856 3300048918 Bacteria 4352
414 Ga0496115_0036843 3300048918 Bacteria 3874
415 Ga0496115_0496274 3300048918 Bacteria 981
416 Ga0496116_0017859 3300048919 Bacteria 5491
417 Ga0496116_0054354 3300048919 Bacteria 2639
418 Ga0496116_0067489 3300048919 Bacteria 2284
419 Ga0496116_0075985 3300048919 Bacteria 2106
420 Ga0496116_0085817 3300048919 Bacteria 1933
421 Ga0496117_0000005 3300048920 Bacteria 777468
422 Ga0496117_0025626 3300048920 Bacteria 4632
423 Ga0496118_0000022 3300048921 Bacteria 438602
424 Ga0496118_0036046 3300048921 Bacteria 4005
425 Ga0496119_0132251 3300048922 Bacteria 1358
426 Ga0496121_0008322 3300048924 Bacteria 12253
427 Ga0496121_0013676 3300048924 Bacteria 8700
428 Ga0496121_0092863 3300048924 Bacteria 2351
429 Ga0496121_0114541 3300048924 Bacteria 2049
430 Ga0496122_0002165 3300048925 Bacteria 28789
431 Ga0496122_0013282 3300048925 Bacteria 8072
432 Ga0496122_0019069 3300048925 Bacteria 6290
433 Ga0496122_0095498 3300048925 Bacteria 2009
434 Ga0496123_0014312 3300048926 Bacteria 6585
435 Ga0496124_0002789 3300048927 Bacteria 22161
436 Ga0496124_0046842 3300048927 Bacteria 3701
437 Ga0496124_0064740 3300048927 Bacteria 3051
438 Ga0496124_0325575 3300048927 Bacteria 1098
439 Ga0496125_0009278 3300048928 Bacteria 10149
440 Ga0496125_0092399 3300048928 Bacteria 2263
441 Ga0496125_0143624 3300048928 Bacteria 1654
442 Ga0496126_0004689 3300048929 Bacteria 16149
443 Ga0496126_0035356 3300048929 Bacteria 4684
444 Ga0495678_000027 3300049459 Bacteria 222075
445 Ga0495678_000307 3300049459 Bacteria 52855
446 Ga0495678_002583 3300049459 Bacteria 12121
447 Ga0495678_003095 3300049459 Bacteria 10540
448 Ga0495678_015631 3300049459 Bacteria 3487
449 Ga0495682_0001114 3300049460 Bacteria 15635
450 Ga0495682_0003146 3300049460 Bacteria 7452
451 Ga0501227_047262 3300049665 Bacteria 1078
452 Ga0501238_017201 3300049671 Bacteria 1006
453 Ga0501269_000482 3300049766 Bacteria 8487
454 Ga0501279_000705 3300049775 Bacteria 4377
455 Ga0495601_0001611 3300053077 Bacteria 12435
456 Ga0500595_000447 3300053119 Bacteria 25711
457 Ga0500618_000088 3300053125 Bacteria 74892
458 Ga0500574_027725 3300053141 Bacteria 1496
459 Ga0500586_000662 3300053145 Bacteria 7034
460 Ga0500619_000395 3300053154 Bacteria 7956
461 Ga0466962_0008310 3300061719 Bacteria 4973
462 2738738631 2738541280 Bacteria 6630198
463 2510253087 2510065045 Bacteria 7761063
464 2512347256 2512047030 Bacteria 9031815
465 2513554054 2513237082 Bacteria 8640282
466 2513561518 2513237083 Bacteria 8410967
467 2516020666 2515154189 Bacteria 9629850
468 2519459975 2519103095 Bacteria 6629912
469 2585290518 2582581311 Bacteria 6763856
470 2599744248 2599185240 Bacteria 7968121
471 2600206285 2599185355 Bacteria 7968906
472 2600810224 2600255067 Bacteria 6795583
473 2601671574 2600255292 Bacteria 6300551
474 2643792496 2643221554 Bacteria 6603920
475 2644216988 2643221638 Bacteria 6579467
476 2644250607 2643221645 Bacteria 7207331
477 2644358922 2643221664 Bacteria 7272945
478 2676743400 2675903129 Bacteria 7964495
479 2719638878 2718217991 Bacteria 7829542
480 2738826274 2738541297 Bacteria 6549566
481 2738842555 2738541300 Bacteria 6675882
482 2739150071 2738541357 Bacteria 6549408
483 2739191990 2738543003 Bacteria 6549560
484 2739273302 2738543018 Bacteria 6718814
485 2739318467 2738543026 Bacteria 6549408
486 2739336708 2738543029 Bacteria 6549249
487 2739342346 2738543030 Bacteria 6719714
488 2739612538 2739367655 Bacteria 4051151
489 2792834798 2791355137 Bacteria 9654227
490 2808968435 2808606384 Bacteria 8474373
491 2809003266 2808606390 Bacteria 8476311
492 2809010543 2808606391 Bacteria 8308166
493 2817262251 2816332253 Bacteria 6764532
494 2817279969 2816332256 Bacteria 6891714
495 2817455443 2816332286 Bacteria 6853759
496 2819542092 2818991436 Bacteria 5376622
497 2821134921 2821131069 Bacteria 6108407
498 2842715774 2842711865 Bacteria 7155354
499 2855736533 2855730933 Bacteria 7047938
500 2855773470 2855767633 Bacteria 7049357
501 2856292147 2856287931 Bacteria 7223934
502 2857361169 2857357740 Bacteria 9937880
503 2857548592 2857547612 Bacteria 6179999
504 2857558165 2857553236 Bacteria 6166726
505 2857558826 2857558681 Bacteria 6617694
506 2857569697 2857564685 Bacteria 6290584
507 2863427623 2863421361 Bacteria 7300805
508 2870069976 2870068957 Bacteria 8925310
509 2883091029 2883087390 Bacteria 9532701
510 2885085645 2885080285 Bacteria 6355622
511 2885274118 2885270888 Bacteria 9831543
512 2904428292 2904424332 Bacteria 7633521
513 2919476474 2919476304 Bacteria 5888696
514 2932416069 2932410948 Bacteria 6312192
515 2932421918 2932416698 Bacteria 6315112
516 8003957665 8003955200 Bacteria 8601927
517 8020813424 8020807995 Bacteria 6801506
518 8020943899 8020938398 Bacteria 7472757
519 8020946890 8020945358 Bacteria 8467355
520 8020959017 8020953355 Bacteria 7439080
521 8040170222 8040167225 Bacteria 6542727
522 8040176578 8040173305 Bacteria 6827067
523 JGI24739J22299_10017649
524 JGI24735J21928_10003878
525 JGI25162J39368_1000023
526 JGI25152J39213_1000396
527 JGI25150J39212_1004980
528 JGI25150J39212_1005218
529 JGI25159J45721_1004101
530 JGI25165J46597_1000030
531 JGI25153J46596_10009292
532 rootH1_10066045
533 rootL2_10014217
534 JGI25160J50197_1002658
535 JGI25161J50226_1001649
536 Ga0055538_1000017
537 Ga0055539_1000022
538 Ga0055533_1000030
539 Ga0055532_1009742
540 Ga0055525_1000034
541 Ga0055527_1000456
542 Ga0055527_1000737
543 Ga0055535_1001300
544 Ga0055535_1001310
545 Ga0055542_1001190
546 Ga0055542_1005978
547 Ga0055529_1000015
548 Ga0055529_1000778
549 Ga0055529_1008485
550 Ga0055526_1000007
551 Ga0055526_1000519
552 Ga0055537_1000005
553 Ga0055537_1012988
554 Ga0055524_1000038
555 Ga0055524_1002567
556 Ga0055524_1004571
557 Ga0055524_1016588
558 Ga0055524_1026048
559 Ga0055534_1000144
560 Ga0055534_1001556
561 Ga0055534_1009034
562 Ga0055528_1000082
563 Ga0055528_1002252
564 Ga0055530_10011013
565 Ga0055541_1000015
566 Ga0058692_1001488
567 Ga0070671_100432941
568 Ga0070678_100533153
569 Ga0070665_100096814
570 Ga0068852_100813593
571 Ga0070712_100062830
572 Ga0079104_1012858
573 Ga0099826_10000008
574 Ga0099794_10087345
575 Ga0105251_10000332
576 Ga0105244_10001182
577 Ga0105244_10002384
578 Ga0105244_10044845
579 Ga0105240_11010952
580 Ga0105248_10060098
581 Ga0105248_10314519
582 Ga0105238_10081701
583 Ga0105246_10053578
584 Ga0157369_10618352
585 Ga0182008_10000386
586 Ga0182006_1000007
587 Ga0182006_1000023
588 Ga0182006_1046878
589 Ga0182007_10000022
590 Ga0182007_10003321
591 Ga0182007_10003563
592 Ga0182005_1000006
593 Ga0182005_1000010
594 Ga0182005_1000914
595 Ga0163161_10030595
596 Ga0213872_10000024
597 Ga0213872_10000227
598 Ga0213872_10001671
599 Ga0213872_10063447
600 Ga0209760_101371
601 Ga0209784_100034
602 Ga0209566_100038
603 Ga0209674_100056
604 Ga0209672_100041
605 Ga0209672_100153
606 Ga0209147_100202
607 Ga0209147_100334
608 Ga0209563_100057
609 Ga0207427_100288
610 Ga0209437_100071
611 Ga0209437_101445
612 Ga0209437_113866
613 Ga0209258_100023
614 Ga0209258_100120
615 Ga0207425_1000009
616 Ga0207425_1000036
617 Ga0207425_1001241
618 Ga0207425_1039824
619 Ga0209646_1000042
620 Ga0209677_100035
621 Ga0209148_1000646
622 Ga0209759_1016116
623 Ga0209129_1000051
624 Ga0209233_1000094
625 Ga0209565_1000074
626 Ga0209565_1000802
627 Ga0209565_1004911
628 Ga0209565_1006548
629 Ga0209455_1000031
630 Ga0209455_1000064
631 Ga0209455_1000941
632 Ga0209673_1000084
633 Ga0209673_1000129
634 Ga0209673_1008206
635 Ga0209675_1000072
636 Ga0209675_1000837
637 Ga0209675_1009698
638 Ga0209564_1000010
639 Ga0209564_1000042
640 Ga0209564_1000160
641 Ga0209564_1000172
642 Ga0209564_1003635
643 Ga0209564_1004414
644 Ga0209564_1029412
645 Ga0209758_1000054
646 Ga0209758_1000433
647 Ga0209050_1000502
648 Ga0209050_1008669
649 Ga0209256_1000018
650 Ga0209256_1000125
651 Ga0209256_1000422
652 Ga0209256_1004056
653 Ga0209256_1004492
654 Ga0207426_1001336
655 Ga0207426_1007451
656 Ga0209051_1013074
657 Ga0209257_1000087
658 Ga0207655_1000718
659 Ga0207655_1022512
660 Ga0207713_1001844
661 Ga0207693_10168225
662 Ga0207711_10012926
663 Ga0207711_10101487
664 Ga0207683_10484439
665 Ga0207698_10704470
666 Ga0209281_1011164
667 Ga0209371_1000166
668 Ga0209282_1000005
669 Ga0268266_10498729
670 Ga0268256_1000139
671 Ga0316181_1218122
672 Ga0265332_10056918
673 Ga0265340_10110839
674 Ga0307408_100000144
675 Ga0307408_100000437
676 Ga0307408_100009641
677 Ga0307408_100031773
678 Ga0307408_100203100
679 Ga0265314_10018254
680 Ga0307518_10112186
681 Ga0307416_100004448
682 Ga0307416_100588089
683 Ga0307414_10010417
684 Ga0307414_10354580
685 Ga0307411_10229075
686 Ga0395898_0180753
687 Ga0395901_0010003
688 Ga0436361_0108001
689 Ga0436361_0243484
690 Ga0436361_0792119
691 Ga0466972_0128657
692 Ga0466973_0013904
693 Ga0466981_0219430
694 Ga0466965_0005912
695 Ga0466965_0038913
696 Ga0466965_0159508
697 Ga0466961_0001062
698 Ga0466963_0003395
699 Ga0466971_0007502
700 Ga0466968_0006821
701 Ga0466968_0009782
702 Ga0466970_0037987
703 Ga0466957_0000549
704 Ga0466957_0156465
705 Ga0466960_0041140
706 Ga0466959_0017394
707 Ga0495617_000020
708 Ga0495617_001275
709 Ga0495617_004506
710 Ga0495617_089662
711 Ga0495627_000004
712 Ga0495592_0015528
713 Ga0495590_0000012
714 Ga0495590_0000977
715 Ga0495591_039647
716 Ga0495629_0091433
717 Ga0495638_0000047
718 Ga0495638_0023786
719 Ga0495638_0027816
720 Ga0495638_0084826
721 Ga0495651_0000720
722 Ga0495651_0250879
723 Ga0495653_0000035
724 Ga0495650_0000077
725 Ga0495650_0000128
726 Ga0495650_0000379
727 Ga0495650_0002304
728 Ga0495650_0003486
729 Ga0495650_0009640
730 Ga0495605_0000018
731 Ga0495605_0033227
732 Ga0495664_0008318
733 Ga0495584_0001649
734 Ga0495584_0076749
735 Ga0495585_0000681
736 Ga0495585_0057867
737 Ga0495585_0225253
738 Ga0495596_0069948
739 Ga0495607_0002163
740 Ga0495607_0002734
741 Ga0495607_0006878
742 Ga0495607_0070890
743 Ga0495607_0092197
744 Ga0495583_0000092
745 Ga0495583_0000115
746 Ga0495583_0000414
747 Ga0495583_0033994
748 Ga0495606_0000101
749 Ga0495606_0000161
750 Ga0495606_0000288
751 Ga0495606_0000716
752 Ga0495606_0000826
753 Ga0495606_0003272
754 Ga0495606_0006480
755 Ga0495606_0010115
756 Ga0495606_0029776
757 Ga0495606_0045855
758 Ga0495606_0060615
759 Ga0495606_0063022
760 Ga0495608_0011446
761 Ga0495608_0063971
762 Ga0495610_0000014
763 Ga0495610_0003813
764 Ga0495610_0008160
765 Ga0495610_0010629
766 Ga0495610_0031286
767 Ga0495610_0040250
768 Ga0495616_0000033
769 Ga0495616_0029248
770 Ga0495616_0063507
771 Ga0495618_0143741
772 Ga0495620_0029576
773 Ga0495628_0001257
774 Ga0495628_0002811
775 Ga0495628_0058496
776 Ga0495630_0114045
777 Ga0495637_0000719
778 Ga0495637_0001962
779 Ga0495637_0031029
780 Ga0495637_0058627
781 Ga0495643_0000237
782 Ga0495643_0000846
783 Ga0495643_0057930
784 Ga0495643_0058984
785 Ga0495644_0002703
786 Ga0495644_0009879
787 Ga0495644_0016266
788 Ga0495648_0000019
789 Ga0495648_0000213
790 Ga0495648_0007656
791 Ga0495648_0008841
792 Ga0495648_0021888
793 Ga0495648_0033147
794 Ga0495648_0110439
795 Ga0495666_0038717
796 Ga0495642_0000436
797 Ga0495642_0024004
798 Ga0495642_0029347
799 Ga0495642_0042017
800 Ga0495642_0219370
801 Ga0495652_0004705
802 Ga0495652_0016007
803 Ga0495652_0096236
804 Ga0495652_0314582
805 Ga0495654_0000014
806 Ga0495654_0002526
807 Ga0495654_0011705
808 Ga0495654_0038156
809 Ga0495654_0049762
810 Ga0495665_0023700
811 Ga0495609_0000824
812 Ga0495609_0004410
813 Ga0495609_0007201
814 Ga0495609_0052246
815 Ga0495609_0141273
816 Ga0495597_0000081
817 Ga0495597_0000152
818 Ga0495597_0037556
819 Ga0495597_0068604
820 Ga0495645_0001268
821 Ga0495645_0019366
822 Ga0495645_0223428
823 Ga0495622_0000019
824 Ga0495622_0000037
825 Ga0495622_0078231
826 Ga0495633_0000086
827 Ga0495633_0000091
828 Ga0495633_0000280
829 Ga0495633_0010253
830 Ga0495633_0022970
831 Ga0495633_0034218
832 Ga0495633_0036244
833 Ga0495656_0022899
834 Ga0495656_0064656
835 Ga0495656_0123524
836 Ga0495668_0000575
837 Ga0495668_0000582
838 Ga0495668_0001497
839 Ga0495634_0254507
840 Ga0495625_0000208
841 Ga0495625_0000675
842 Ga0495625_0010694
843 Ga0495625_0012234
844 Ga0495625_0013339
845 Ga0495625_0015779
846 Ga0495625_0038790
847 Ga0495625_0160527
848 Ga0495635_0144382
849 Ga0495659_0002236
850 Ga0495659_0002768
851 Ga0495661_0012776
852 Ga0495661_0147069
853 Ga0495588_0107893
854 Ga0495623_0005164
855 Ga0495646_0003863
856 Ga0495658_0044679
857 Ga0495624_0011977
858 Ga0495624_0013981
859 Ga0495624_0055990
860 Ga0495671_0000005
861 Ga0495671_0001012
862 Ga0495671_0180769
863 Ga0495649_0005693
864 Ga0495649_0032350
865 Ga0495649_0036597
866 Ga0495649_0048140
867 Ga0495649_0048915
868 Ga0495649_0106349
869 Ga0495600_0004213
870 Ga0495660_0005205
871 Ga0495660_0005939
872 Ga0495660_0034206
873 Ga0495660_0100855
874 Ga0495660_0158238
875 Ga0495636_0012008
876 Ga0495674_0025855
877 Ga0495672_0000019
878 Ga0495672_0000026
879 Ga0495672_0000226
880 Ga0495672_0145822
881 Ga0495676_0119746
882 Ga0495680_0304448
883 Ga0495683_0004403
884 Ga0495683_0008614
885 Ga0495683_0018108
886 Ga0495683_0022765
887 Ga0495683_0056278
888 Ga0495687_000213
889 Ga0495687_000627
890 Ga0495687_001996
891 Ga0495687_002415
892 Ga0495687_009945
893 Ga0495675_0170691
894 Ga0495679_012841
895 Ga0495685_000068
896 Ga0495673_0000008
897 Ga0495673_0000009
898 Ga0495673_0000012
899 Ga0495673_0006741
900 Ga0495681_0000922
901 Ga0495686_0000472
902 Ga0495686_0011467
903 Ga0495686_0042269
904 Ga0495686_0211292
905 Ga0495593_0053893
906 Ga0495602_0020085
907 Ga0495602_0031529
908 Ga0495602_0067174
909 Ga0495602_0087216
910 Ga0495615_0001567
911 Ga0495615_0015972
912 Ga0495626_0053238
913 Ga0496100_0105063
914 Ga0496100_0496272
915 Ga0496101_0013665
916 Ga0496101_0574796
917 Ga0496102_0020524
918 Ga0496102_0033996
919 Ga0496102_0330431
920 Ga0496103_0003963
921 Ga0496103_0003976
922 Ga0496104_0087773
923 Ga0496104_0570959
924 Ga0496105_0099937
925 Ga0496106_0169539
926 Ga0496107_0027333
927 Ga0496109_0232069
928 Ga0496110_0023168
929 Ga0496110_0458286
930 Ga0496111_0025352
931 Ga0496111_0069071
932 Ga0496112_0005904
933 Ga0496113_0005524
934 Ga0496114_0105796
935 Ga0496115_0028856
936 Ga0496115_0036843
937 Ga0496115_0496274
938 Ga0496116_0017859
939 Ga0496116_0054354
940 Ga0496116_0067489
941 Ga0496116_0075985
942 Ga0496116_0085817
943 Ga0496117_0000005
944 Ga0496117_0025626
945 Ga0496118_0000022
946 Ga0496118_0036046
947 Ga0496119_0132251
948 Ga0496121_0008322
949 Ga0496121_0013676
950 Ga0496121_0092863
951 Ga0496121_0114541
952 Ga0496122_0002165
953 Ga0496122_0013282
954 Ga0496122_0019069
955 Ga0496122_0095498
956 Ga0496123_0014312
957 Ga0496124_0002789
958 Ga0496124_0046842
959 Ga0496124_0064740
960 Ga0496124_0325575
961 Ga0496125_0009278
962 Ga0496125_0092399
963 Ga0496125_0143624
964 Ga0496126_0004689
965 Ga0496126_0035356
966 Ga0495678_000027
967 Ga0495678_000307
968 Ga0495678_002583
969 Ga0495678_003095
970 Ga0495678_015631
971 Ga0495682_0001114
972 Ga0495682_0003146
973 Ga0501227_047262
974 Ga0501238_017201
975 Ga0501269_000482
976 Ga0501279_000705
977 Ga0495601_0001611
978 Ga0500595_000447
979 Ga0500618_000088
980 Ga0500574_027725
981 Ga0500586_000662
982 Ga0500619_000395
983 Ga0466962_0008310
984 2738738631
985 2510253087
986 2512347256
987 2513554054
988 2513561518
989 2516020666
990 2519459975
991 2585290518
992 2599744248
993 2600206285
994 2600810224
995 2601671574
996 2643792496
997 2644216988
998 2644250607
999 2644358922
1000 2676743400
1001 2719638878
1002 2738826274
1003 2738842555
1004 2739150071
1005 2739191990
1006 2739273302
1007 2739318467
1008 2739336708
1009 2739342346
1010 2739612538
1011 2792834798
1012 2808968435
1013 2809003266
1014 2809010543
1015 2817262251
1016 2817279969
1017 2817455443
1018 2819542092
1019 2821134921
1020 2842715774
1021 2855736533
1022 2855773470
1023 2856292147
1024 2857361169
1025 2857548592
1026 2857558165
1027 2857558826
1028 2857569697
1029 2863427623
1030 2870069976
1031 2883091029
1032 2885085645
1033 2885274118
1034 2904428292
1035 2919476474
1036 2932416069
1037 2932421918
1038 8003957665
1039 8020813424
1040 8020943899
1041 8020946890
1042 8020959017
1043 8040170222
1044 8040176578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

57

267

0.92

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

58

272

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.9544 5 229
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.95 5 228
1dts-assembly1.cif.gz_A-2 crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution 0.9485 5 229
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.9417 5 229
1dts-assembly1.cif.gz_A-2 crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution 0.936 5 229
ID Description Score Start End Superfamily
af_P0A6E9_2_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9207 6 229 3.40.50.300
af_P0A6E9_2_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9047 6 229 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9017 7 210 3.40.50.300
3of5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8928 5 234 3.40.50.300
3of5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.881 5 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A9AE45-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 1.001 1 239 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A6P2NRK3-F1-model_v4 Multifunctional fusion protein [Includes: 8-amino-7-oxononanoate synthase (AONS) (EC 2.3.1.47) (7-keto-8-amino-pelargonic acid synthase) (8-amino-7-ketopelargonate synthase) (7-KAP synthase) (KAPA synthase); ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (Dethiobiotin synthase) (DTBS)] 1 1 239 GO:0000287
GO:0004141
GO:0005524
GO:0005737
GO:0008710
GO:0009102
GO:0030170
AF-A2VUZ1-F1-model_v4 deleted 0.9999 2 239
AF-K0DHY0-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9996 8 239 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A1G7P1E6-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9991 1 239 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Map