F458919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 522 | 284 | 1044 | 254 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2738541280|2738738631 |
| Length | 287 |
| Sequence | NSITAPTADAPDIAVAQPDTDLAVGVAVPAGAAAPPATPEAAAAPAPAIAGLPPRFACFVTGTDTEIGKTLTSSALLHALVKQGVRACGMKPVAAGAELRDGVLHNDDADQLIAAGNVTMLQSLTTPYMLKEPAAPHIAAALEGVTIDPVPILAAYLEIAAATDAVVVEGVGGFRVPLNDSFDTADLAQQLDLPVILVVGLRLGCISHALLTVEAIAARGLTLVGWVANELQDEMAYADENIAALEQRIPAPLLGRVPRLAQPTAAAAAAHLNFTGLPNWPARRNNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 37 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 91 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 98 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 102 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 103 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 104 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 105 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 106 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 109 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 110 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 201 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 216 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 219 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 220 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 222 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 223 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 224 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 225 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 226 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 227 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 228 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 229 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 230 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 231 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 232 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 233 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 234 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 235 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 236 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 237 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 238 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 239 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 240 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 241 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 242 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 243 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 244 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 245 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 246 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 247 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 248 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 249 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 250 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 251 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 252 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 253 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 254 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 255 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 256 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 257 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 258 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 259 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 260 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 261 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 262 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 263 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 264 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 265 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 266 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 267 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 268 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 269 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 270 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 271 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 272 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 273 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 274 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 275 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 276 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 277 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 278 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 279 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 280 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 281 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 282 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 283 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 284 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.31 |
| Metatranscriptomes | 0 |
| Isolates | 11.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.16 |
| Nodule | 2.49 |
| Rhizoplane | 5.56 |
| Rhizosphere | 60.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10017649 | 3300001989 | Bacteria | 2572 |
| 2 | JGI24735J21928_10003878 | 3300002067 | Bacteria | 5060 |
| 3 | JGI25162J39368_1000023 | 3300002737 | Bacteria | 236658 |
| 4 | JGI25152J39213_1000396 | 3300002773 | Bacteria | 26523 |
| 5 | JGI25150J39212_1004980 | 3300002774 | Bacteria | 2881 |
| 6 | JGI25150J39212_1005218 | 3300002774 | Bacteria | 2798 |
| 7 | JGI25159J45721_1004101 | 3300002987 | Bacteria | 4941 |
| 8 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 9 | JGI25153J46596_10009292 | 3300003215 | Bacteria | 4594 |
| 10 | rootH1_10066045 | 3300003316 | Bacteria | 1820 |
| 11 | rootL2_10014217 | 3300003322 | Bacteria | 2070 |
| 12 | JGI25160J50197_1002658 | 3300003354 | Bacteria | 8232 |
| 13 | JGI25161J50226_1001649 | 3300003374 | Bacteria | 6421 |
| 14 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 15 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 16 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 17 | Ga0055532_1009742 | 3300003758 | Bacteria | 1161 |
| 18 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 19 | Ga0055527_1000456 | 3300003760 | Bacteria | 15978 |
| 20 | Ga0055527_1000737 | 3300003760 | Bacteria | 9229 |
| 21 | Ga0055535_1001300 | 3300003761 | Bacteria | 13406 |
| 22 | Ga0055535_1001310 | 3300003761 | Bacteria | 13304 |
| 23 | Ga0055542_1001190 | 3300003762 | Bacteria | 14841 |
| 24 | Ga0055542_1005978 | 3300003762 | Bacteria | 2661 |
| 25 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 26 | Ga0055529_1000778 | 3300003763 | Bacteria | 19884 |
| 27 | Ga0055529_1008485 | 3300003763 | Bacteria | 1366 |
| 28 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 29 | Ga0055526_1000519 | 3300003771 | Bacteria | 30711 |
| 30 | Ga0055537_1000005 | 3300003773 | Bacteria | 160497 |
| 31 | Ga0055537_1012988 | 3300003773 | Bacteria | 1591 |
| 32 | Ga0055524_1000038 | 3300003775 | Bacteria | 162683 |
| 33 | Ga0055524_1002567 | 3300003775 | Bacteria | 9264 |
| 34 | Ga0055524_1004571 | 3300003775 | Bacteria | 6365 |
| 35 | Ga0055524_1016588 | 3300003775 | Bacteria | 2635 |
| 36 | Ga0055524_1026048 | 3300003775 | Bacteria | 1818 |
| 37 | Ga0055534_1000144 | 3300003784 | Bacteria | 53179 |
| 38 | Ga0055534_1001556 | 3300003784 | Bacteria | 8945 |
| 39 | Ga0055534_1009034 | 3300003784 | Bacteria | 2201 |
| 40 | Ga0055528_1000082 | 3300003790 | Bacteria | 74945 |
| 41 | Ga0055528_1002252 | 3300003790 | Bacteria | 10500 |
| 42 | Ga0055530_10011013 | 3300003791 | Bacteria | 3283 |
| 43 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 44 | Ga0058692_1001488 | 3300003856 | Bacteria | 8596 |
| 45 | Ga0070671_100432941 | 3300005355 | Bacteria | 1127 |
| 46 | Ga0070678_100533153 | 3300005456 | Bacteria | 1040 |
| 47 | Ga0070665_100096814 | 3300005548 | Bacteria | 2956 |
| 48 | Ga0068852_100813593 | 3300005616 | Bacteria | 949 |
| 49 | Ga0070712_100062830 | 3300006175 | Bacteria | 2627 |
| 50 | Ga0079104_1012858 | 3300006946 | Bacteria | 2606 |
| 51 | Ga0099826_10000008 | 3300006948 | Bacteria | 380974 |
| 52 | Ga0099794_10087345 | 3300007265 | Bacteria | 1545 |
| 53 | Ga0105251_10000332 | 3300009011 | Bacteria | 47333 |
| 54 | Ga0105244_10001182 | 3300009036 | Bacteria | 21601 |
| 55 | Ga0105244_10002384 | 3300009036 | Bacteria | 14240 |
| 56 | Ga0105244_10044845 | 3300009036 | Bacteria | 2277 |
| 57 | Ga0105240_11010952 | 3300009093 | Bacteria | 889 |
| 58 | Ga0105248_10060098 | 3300009177 | Bacteria | 4267 |
| 59 | Ga0105248_10314519 | 3300009177 | Bacteria | 1764 |
| 60 | Ga0105238_10081701 | 3300009551 | Bacteria | 3221 |
| 61 | Ga0105246_10053578 | 3300011119 | Bacteria | 2776 |
| 62 | Ga0157369_10618352 | 3300013105 | Bacteria | 1118 |
| 63 | Ga0182008_10000386 | 3300014497 | Bacteria | 34116 |
| 64 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 65 | Ga0182006_1000023 | 3300015261 | Bacteria | 275031 |
| 66 | Ga0182006_1046878 | 3300015261 | Bacteria | 1678 |
| 67 | Ga0182007_10000022 | 3300015262 | Bacteria | 189018 |
| 68 | Ga0182007_10003321 | 3300015262 | Bacteria | 7615 |
| 69 | Ga0182007_10003563 | 3300015262 | Bacteria | 7323 |
| 70 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 71 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 72 | Ga0182005_1000914 | 3300015265 | Bacteria | 12926 |
| 73 | Ga0163161_10030595 | 3300017792 | Bacteria | 3833 |
| 74 | Ga0213872_10000024 | 3300021361 | Bacteria | 155437 |
| 75 | Ga0213872_10000227 | 3300021361 | Bacteria | 49306 |
| 76 | Ga0213872_10001671 | 3300021361 | Bacteria | 13963 |
| 77 | Ga0213872_10063447 | 3300021361 | Bacteria | 1669 |
| 78 | Ga0209760_101371 | 3300025207 | Bacteria | 2617 |
| 79 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 80 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 81 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 82 | Ga0209672_100041 | 3300025228 | Bacteria | 278535 |
| 83 | Ga0209672_100153 | 3300025228 | Bacteria | 61197 |
| 84 | Ga0209147_100202 | 3300025229 | Bacteria | 65528 |
| 85 | Ga0209147_100334 | 3300025229 | Bacteria | 35260 |
| 86 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 87 | Ga0207427_100288 | 3300025231 | Bacteria | 35935 |
| 88 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 89 | Ga0209437_101445 | 3300025233 | Bacteria | 5797 |
| 90 | Ga0209437_113866 | 3300025233 | Bacteria | 1141 |
| 91 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 92 | Ga0209258_100120 | 3300025242 | Bacteria | 183488 |
| 93 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 94 | Ga0207425_1000036 | 3300025245 | Bacteria | 225783 |
| 95 | Ga0207425_1001241 | 3300025245 | Bacteria | 11194 |
| 96 | Ga0207425_1039824 | 3300025245 | Bacteria | 899 |
| 97 | Ga0209646_1000042 | 3300025246 | Bacteria | 343923 |
| 98 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 99 | Ga0209148_1000646 | 3300025254 | Bacteria | 30170 |
| 100 | Ga0209759_1016116 | 3300025256 | Bacteria | 1900 |
| 101 | Ga0209129_1000051 | 3300025258 | Bacteria | 267104 |
| 102 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 103 | Ga0209565_1000074 | 3300025263 | Bacteria | 164237 |
| 104 | Ga0209565_1000802 | 3300025263 | Bacteria | 18043 |
| 105 | Ga0209565_1004911 | 3300025263 | Bacteria | 3985 |
| 106 | Ga0209565_1006548 | 3300025263 | Bacteria | 3254 |
| 107 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 108 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 109 | Ga0209455_1000941 | 3300025272 | Bacteria | 14906 |
| 110 | Ga0209673_1000084 | 3300025273 | Bacteria | 215878 |
| 111 | Ga0209673_1000129 | 3300025273 | Bacteria | 164238 |
| 112 | Ga0209673_1008206 | 3300025273 | Bacteria | 4684 |
| 113 | Ga0209675_1000072 | 3300025291 | Bacteria | 164237 |
| 114 | Ga0209675_1000837 | 3300025291 | Bacteria | 20157 |
| 115 | Ga0209675_1009698 | 3300025291 | Bacteria | 3376 |
| 116 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 117 | Ga0209564_1000042 | 3300025295 | Bacteria | 392805 |
| 118 | Ga0209564_1000160 | 3300025295 | Bacteria | 164214 |
| 119 | Ga0209564_1000172 | 3300025295 | Bacteria | 155715 |
| 120 | Ga0209564_1003635 | 3300025295 | Bacteria | 10237 |
| 121 | Ga0209564_1004414 | 3300025295 | Bacteria | 8623 |
| 122 | Ga0209564_1029412 | 3300025295 | Bacteria | 1730 |
| 123 | Ga0209758_1000054 | 3300025297 | Bacteria | 337655 |
| 124 | Ga0209758_1000433 | 3300025297 | Bacteria | 70750 |
| 125 | Ga0209050_1000502 | 3300025298 | Bacteria | 66494 |
| 126 | Ga0209050_1008669 | 3300025298 | Bacteria | 5368 |
| 127 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 128 | Ga0209256_1000125 | 3300025299 | Bacteria | 165336 |
| 129 | Ga0209256_1000422 | 3300025299 | Bacteria | 66695 |
| 130 | Ga0209256_1004056 | 3300025299 | Bacteria | 9528 |
| 131 | Ga0209256_1004492 | 3300025299 | Bacteria | 8716 |
| 132 | Ga0207426_1001336 | 3300025302 | Bacteria | 20936 |
| 133 | Ga0207426_1007451 | 3300025302 | Bacteria | 4580 |
| 134 | Ga0209051_1013074 | 3300025303 | Bacteria | 3971 |
| 135 | Ga0209257_1000087 | 3300025304 | Bacteria | 282503 |
| 136 | Ga0207655_1000718 | 3300025728 | Bacteria | 37593 |
| 137 | Ga0207655_1022512 | 3300025728 | Bacteria | 3156 |
| 138 | Ga0207713_1001844 | 3300025735 | Bacteria | 16167 |
| 139 | Ga0207693_10168225 | 3300025915 | Bacteria | 1726 |
| 140 | Ga0207711_10012926 | 3300025941 | Bacteria | 6934 |
| 141 | Ga0207711_10101487 | 3300025941 | Bacteria | 2546 |
| 142 | Ga0207683_10484439 | 3300026121 | Bacteria | 1142 |
| 143 | Ga0207698_10704470 | 3300026142 | Bacteria | 1005 |
| 144 | Ga0209281_1011164 | 3300027111 | Bacteria | 2021 |
| 145 | Ga0209371_1000166 | 3300027312 | Bacteria | 100164 |
| 146 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 147 | Ga0268266_10498729 | 3300028379 | Bacteria | 1162 |
| 148 | Ga0268256_1000139 | 3300030500 | Bacteria | 100164 |
| 149 | Ga0316181_1218122 | 3300030744 | Bacteria | 1662 |
| 150 | Ga0265332_10056918 | 3300031238 | Bacteria | 1675 |
| 151 | Ga0265340_10110839 | 3300031247 | Bacteria | 1269 |
| 152 | Ga0307408_100000144 | 3300031548 | Bacteria | 79329 |
| 153 | Ga0307408_100000437 | 3300031548 | Bacteria | 37104 |
| 154 | Ga0307408_100009641 | 3300031548 | Bacteria | 6366 |
| 155 | Ga0307408_100031773 | 3300031548 | Bacteria | 3677 |
| 156 | Ga0307408_100203100 | 3300031548 | Bacteria | 1605 |
| 157 | Ga0265314_10018254 | 3300031711 | Bacteria | 5475 |
| 158 | Ga0307518_10112186 | 3300031838 | Bacteria | 1941 |
| 159 | Ga0307416_100004448 | 3300032002 | Bacteria | 8450 |
| 160 | Ga0307416_100588089 | 3300032002 | Bacteria | 1191 |
| 161 | Ga0307414_10010417 | 3300032004 | Bacteria | 5392 |
| 162 | Ga0307414_10354580 | 3300032004 | Bacteria | 1260 |
| 163 | Ga0307411_10229075 | 3300032005 | Bacteria | 1447 |
| 164 | Ga0395898_0180753 | 3300037466 | Bacteria | 2016 |
| 165 | Ga0395901_0010003 | 3300038443 | Bacteria | 9613 |
| 166 | Ga0436361_0108001 | 3300039447 | Bacteria | 112244 |
| 167 | Ga0436361_0243484 | 3300039447 | Bacteria | 26262 |
| 168 | Ga0436361_0792119 | 3300039447 | Bacteria | 4789 |
| 169 | Ga0466972_0128657 | 3300044658 | Bacteria | 1193 |
| 170 | Ga0466973_0013904 | 3300044659 | Bacteria | 7575 |
| 171 | Ga0466981_0219430 | 3300044669 | Bacteria | 1252 |
| 172 | Ga0466965_0005912 | 3300044683 | Bacteria | 5525 |
| 173 | Ga0466965_0038913 | 3300044683 | Bacteria | 2336 |
| 174 | Ga0466965_0159508 | 3300044683 | Bacteria | 1182 |
| 175 | Ga0466961_0001062 | 3300044693 | Bacteria | 16915 |
| 176 | Ga0466963_0003395 | 3300044694 | Bacteria | 9104 |
| 177 | Ga0466971_0007502 | 3300044719 | Bacteria | 4752 |
| 178 | Ga0466968_0006821 | 3300044735 | Bacteria | 4321 |
| 179 | Ga0466968_0009782 | 3300044735 | Bacteria | 3700 |
| 180 | Ga0466970_0037987 | 3300044765 | Bacteria | 2554 |
| 181 | Ga0466957_0000549 | 3300044842 | Bacteria | 18918 |
| 182 | Ga0466957_0156465 | 3300044842 | Bacteria | 1477 |
| 183 | Ga0466960_0041140 | 3300044901 | Bacteria | 2189 |
| 184 | Ga0466959_0017394 | 3300045049 | Bacteria | 5269 |
| 185 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 186 | Ga0495617_001275 | 3300046452 | Bacteria | 11243 |
| 187 | Ga0495617_004506 | 3300046452 | Bacteria | 5060 |
| 188 | Ga0495617_089662 | 3300046452 | Bacteria | 1004 |
| 189 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 190 | Ga0495592_0015528 | 3300046454 | Bacteria | 5778 |
| 191 | Ga0495590_0000012 | 3300046457 | Bacteria | 303377 |
| 192 | Ga0495590_0000977 | 3300046457 | Bacteria | 12589 |
| 193 | Ga0495591_039647 | 3300046458 | Bacteria | 1348 |
| 194 | Ga0495629_0091433 | 3300046459 | Bacteria | 2124 |
| 195 | Ga0495638_0000047 | 3300046460 | Bacteria | 216004 |
| 196 | Ga0495638_0023786 | 3300046460 | Bacteria | 4002 |
| 197 | Ga0495638_0027816 | 3300046460 | Bacteria | 3657 |
| 198 | Ga0495638_0084826 | 3300046460 | Bacteria | 1916 |
| 199 | Ga0495651_0000720 | 3300046462 | Bacteria | 25644 |
| 200 | Ga0495651_0250879 | 3300046462 | Bacteria | 1208 |
| 201 | Ga0495653_0000035 | 3300046463 | Bacteria | 129875 |
| 202 | Ga0495650_0000077 | 3300046471 | Bacteria | 245511 |
| 203 | Ga0495650_0000128 | 3300046471 | Bacteria | 177256 |
| 204 | Ga0495650_0000379 | 3300046471 | Bacteria | 77062 |
| 205 | Ga0495650_0002304 | 3300046471 | Bacteria | 15833 |
| 206 | Ga0495650_0003486 | 3300046471 | Bacteria | 11431 |
| 207 | Ga0495650_0009640 | 3300046471 | Bacteria | 5473 |
| 208 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 209 | Ga0495605_0033227 | 3300046474 | Bacteria | 2620 |
| 210 | Ga0495664_0008318 | 3300046477 | Bacteria | 5783 |
| 211 | Ga0495584_0001649 | 3300046491 | Bacteria | 13123 |
| 212 | Ga0495584_0076749 | 3300046491 | Bacteria | 1680 |
| 213 | Ga0495585_0000681 | 3300046492 | Bacteria | 30911 |
| 214 | Ga0495585_0057867 | 3300046492 | Bacteria | 2138 |
| 215 | Ga0495585_0225253 | 3300046492 | Bacteria | 944 |
| 216 | Ga0495596_0069948 | 3300046500 | Bacteria | 1364 |
| 217 | Ga0495607_0002163 | 3300046501 | Bacteria | 16369 |
| 218 | Ga0495607_0002734 | 3300046501 | Bacteria | 14073 |
| 219 | Ga0495607_0006878 | 3300046501 | Bacteria | 7932 |
| 220 | Ga0495607_0070890 | 3300046501 | Bacteria | 1945 |
| 221 | Ga0495607_0092197 | 3300046501 | Bacteria | 1639 |
| 222 | Ga0495583_0000092 | 3300046506 | Bacteria | 158865 |
| 223 | Ga0495583_0000115 | 3300046506 | Bacteria | 135762 |
| 224 | Ga0495583_0000414 | 3300046506 | Bacteria | 64875 |
| 225 | Ga0495583_0033994 | 3300046506 | Bacteria | 2447 |
| 226 | Ga0495606_0000101 | 3300046507 | Bacteria | 146752 |
| 227 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 228 | Ga0495606_0000288 | 3300046507 | Bacteria | 87389 |
| 229 | Ga0495606_0000716 | 3300046507 | Bacteria | 51314 |
| 230 | Ga0495606_0000826 | 3300046507 | Bacteria | 47010 |
| 231 | Ga0495606_0003272 | 3300046507 | Bacteria | 17361 |
| 232 | Ga0495606_0006480 | 3300046507 | Bacteria | 10773 |
| 233 | Ga0495606_0010115 | 3300046507 | Bacteria | 7875 |
| 234 | Ga0495606_0029776 | 3300046507 | Bacteria | 3826 |
| 235 | Ga0495606_0045855 | 3300046507 | Bacteria | 2893 |
| 236 | Ga0495606_0060615 | 3300046507 | Bacteria | 2423 |
| 237 | Ga0495606_0063022 | 3300046507 | Bacteria | 2364 |
| 238 | Ga0495608_0011446 | 3300046511 | Bacteria | 6174 |
| 239 | Ga0495608_0063971 | 3300046511 | Bacteria | 2412 |
| 240 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 241 | Ga0495610_0003813 | 3300046512 | Bacteria | 11496 |
| 242 | Ga0495610_0008160 | 3300046512 | Bacteria | 6836 |
| 243 | Ga0495610_0010629 | 3300046512 | Bacteria | 5702 |
| 244 | Ga0495610_0031286 | 3300046512 | Bacteria | 2777 |
| 245 | Ga0495610_0040250 | 3300046512 | Bacteria | 2357 |
| 246 | Ga0495616_0000033 | 3300046513 | Bacteria | 130486 |
| 247 | Ga0495616_0029248 | 3300046513 | Bacteria | 2910 |
| 248 | Ga0495616_0063507 | 3300046513 | Bacteria | 1804 |
| 249 | Ga0495618_0143741 | 3300046514 | Bacteria | 1525 |
| 250 | Ga0495620_0029576 | 3300046515 | Bacteria | 2533 |
| 251 | Ga0495628_0001257 | 3300046516 | Bacteria | 23206 |
| 252 | Ga0495628_0002811 | 3300046516 | Bacteria | 15632 |
| 253 | Ga0495628_0058496 | 3300046516 | Bacteria | 3028 |
| 254 | Ga0495630_0114045 | 3300046517 | Bacteria | 2048 |
| 255 | Ga0495637_0000719 | 3300046520 | Bacteria | 22655 |
| 256 | Ga0495637_0001962 | 3300046520 | Bacteria | 11624 |
| 257 | Ga0495637_0031029 | 3300046520 | Bacteria | 2366 |
| 258 | Ga0495637_0058627 | 3300046520 | Bacteria | 1587 |
| 259 | Ga0495643_0000237 | 3300046522 | Bacteria | 82853 |
| 260 | Ga0495643_0000846 | 3300046522 | Bacteria | 33222 |
| 261 | Ga0495643_0057930 | 3300046522 | Bacteria | 2063 |
| 262 | Ga0495643_0058984 | 3300046522 | Bacteria | 2041 |
| 263 | Ga0495644_0002703 | 3300046523 | Bacteria | 7035 |
| 264 | Ga0495644_0009879 | 3300046523 | Bacteria | 3673 |
| 265 | Ga0495644_0016266 | 3300046523 | Bacteria | 2848 |
| 266 | Ga0495648_0000019 | 3300046524 | Bacteria | 276407 |
| 267 | Ga0495648_0000213 | 3300046524 | Bacteria | 67606 |
| 268 | Ga0495648_0007656 | 3300046524 | Bacteria | 8611 |
| 269 | Ga0495648_0008841 | 3300046524 | Bacteria | 7882 |
| 270 | Ga0495648_0021888 | 3300046524 | Bacteria | 4415 |
| 271 | Ga0495648_0033147 | 3300046524 | Bacteria | 3378 |
| 272 | Ga0495648_0110439 | 3300046524 | Bacteria | 1497 |
| 273 | Ga0495666_0038717 | 3300046526 | Bacteria | 2318 |
| 274 | Ga0495642_0000436 | 3300046528 | Bacteria | 22058 |
| 275 | Ga0495642_0024004 | 3300046528 | Bacteria | 2411 |
| 276 | Ga0495642_0029347 | 3300046528 | Bacteria | 2195 |
| 277 | Ga0495642_0042017 | 3300046528 | Bacteria | 1861 |
| 278 | Ga0495642_0219370 | 3300046528 | Bacteria | 830 |
| 279 | Ga0495652_0004705 | 3300046529 | Bacteria | 13005 |
| 280 | Ga0495652_0016007 | 3300046529 | Bacteria | 6709 |
| 281 | Ga0495652_0096236 | 3300046529 | Bacteria | 2411 |
| 282 | Ga0495652_0314582 | 3300046529 | Bacteria | 1133 |
| 283 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 284 | Ga0495654_0002526 | 3300046530 | Bacteria | 11760 |
| 285 | Ga0495654_0011705 | 3300046530 | Bacteria | 4740 |
| 286 | Ga0495654_0038156 | 3300046530 | Bacteria | 2404 |
| 287 | Ga0495654_0049762 | 3300046530 | Bacteria | 2051 |
| 288 | Ga0495665_0023700 | 3300046531 | Bacteria | 3297 |
| 289 | Ga0495609_0000824 | 3300046538 | Bacteria | 23076 |
| 290 | Ga0495609_0004410 | 3300046538 | Bacteria | 7705 |
| 291 | Ga0495609_0007201 | 3300046538 | Bacteria | 5583 |
| 292 | Ga0495609_0052246 | 3300046538 | Bacteria | 1818 |
| 293 | Ga0495609_0141273 | 3300046538 | Bacteria | 1027 |
| 294 | Ga0495597_0000081 | 3300046542 | Bacteria | 84083 |
| 295 | Ga0495597_0000152 | 3300046542 | Bacteria | 61422 |
| 296 | Ga0495597_0037556 | 3300046542 | Bacteria | 2174 |
| 297 | Ga0495597_0068604 | 3300046542 | Bacteria | 1532 |
| 298 | Ga0495645_0001268 | 3300046543 | Bacteria | 17192 |
| 299 | Ga0495645_0019366 | 3300046543 | Bacteria | 4899 |
| 300 | Ga0495645_0223428 | 3300046543 | Bacteria | 1265 |
| 301 | Ga0495622_0000019 | 3300046557 | Bacteria | 169931 |
| 302 | Ga0495622_0000037 | 3300046557 | Bacteria | 119690 |
| 303 | Ga0495622_0078231 | 3300046557 | Bacteria | 1523 |
| 304 | Ga0495633_0000086 | 3300046558 | Bacteria | 124357 |
| 305 | Ga0495633_0000091 | 3300046558 | Bacteria | 122383 |
| 306 | Ga0495633_0000280 | 3300046558 | Bacteria | 58801 |
| 307 | Ga0495633_0010253 | 3300046558 | Bacteria | 5126 |
| 308 | Ga0495633_0022970 | 3300046558 | Bacteria | 3093 |
| 309 | Ga0495633_0034218 | 3300046558 | Bacteria | 2444 |
| 310 | Ga0495633_0036244 | 3300046558 | Bacteria | 2364 |
| 311 | Ga0495656_0022899 | 3300046615 | Bacteria | 2452 |
| 312 | Ga0495656_0064656 | 3300046615 | Bacteria | 1607 |
| 313 | Ga0495656_0123524 | 3300046615 | Bacteria | 1224 |
| 314 | Ga0495668_0000575 | 3300046616 | Bacteria | 44931 |
| 315 | Ga0495668_0000582 | 3300046616 | Bacteria | 44454 |
| 316 | Ga0495668_0001497 | 3300046616 | Bacteria | 22337 |
| 317 | Ga0495634_0254507 | 3300046642 | Bacteria | 1073 |
| 318 | Ga0495625_0000208 | 3300046660 | Bacteria | 93861 |
| 319 | Ga0495625_0000675 | 3300046660 | Bacteria | 48697 |
| 320 | Ga0495625_0010694 | 3300046660 | Bacteria | 7559 |
| 321 | Ga0495625_0012234 | 3300046660 | Bacteria | 6960 |
| 322 | Ga0495625_0013339 | 3300046660 | Bacteria | 6606 |
| 323 | Ga0495625_0015779 | 3300046660 | Bacteria | 5964 |
| 324 | Ga0495625_0038790 | 3300046660 | Bacteria | 3483 |
| 325 | Ga0495625_0160527 | 3300046660 | Bacteria | 1506 |
| 326 | Ga0495635_0144382 | 3300046663 | Bacteria | 1621 |
| 327 | Ga0495659_0002236 | 3300046664 | Bacteria | 6293 |
| 328 | Ga0495659_0002768 | 3300046664 | Bacteria | 5643 |
| 329 | Ga0495661_0012776 | 3300046665 | Bacteria | 5667 |
| 330 | Ga0495661_0147069 | 3300046665 | Bacteria | 1276 |
| 331 | Ga0495588_0107893 | 3300046674 | Bacteria | 1466 |
| 332 | Ga0495623_0005164 | 3300046679 | Bacteria | 8567 |
| 333 | Ga0495646_0003863 | 3300046680 | Bacteria | 9363 |
| 334 | Ga0495658_0044679 | 3300046683 | Bacteria | 2483 |
| 335 | Ga0495624_0011977 | 3300046690 | Bacteria | 5945 |
| 336 | Ga0495624_0013981 | 3300046690 | Bacteria | 5463 |
| 337 | Ga0495624_0055990 | 3300046690 | Bacteria | 2483 |
| 338 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 339 | Ga0495671_0001012 | 3300046692 | Bacteria | 19562 |
| 340 | Ga0495671_0180769 | 3300046692 | Bacteria | 1024 |
| 341 | Ga0495649_0005693 | 3300046694 | Bacteria | 7865 |
| 342 | Ga0495649_0032350 | 3300046694 | Bacteria | 2881 |
| 343 | Ga0495649_0036597 | 3300046694 | Bacteria | 2696 |
| 344 | Ga0495649_0048140 | 3300046694 | Bacteria | 2317 |
| 345 | Ga0495649_0048915 | 3300046694 | Bacteria | 2297 |
| 346 | Ga0495649_0106349 | 3300046694 | Bacteria | 1489 |
| 347 | Ga0495600_0004213 | 3300046809 | Bacteria | 8584 |
| 348 | Ga0495660_0005205 | 3300046810 | Bacteria | 7804 |
| 349 | Ga0495660_0005939 | 3300046810 | Bacteria | 7272 |
| 350 | Ga0495660_0034206 | 3300046810 | Bacteria | 2845 |
| 351 | Ga0495660_0100855 | 3300046810 | Bacteria | 1486 |
| 352 | Ga0495660_0158238 | 3300046810 | Bacteria | 1113 |
| 353 | Ga0495636_0012008 | 3300047318 | Bacteria | 3433 |
| 354 | Ga0495674_0025855 | 3300047319 | Bacteria | 5374 |
| 355 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 356 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 357 | Ga0495672_0000226 | 3300047320 | Bacteria | 80307 |
| 358 | Ga0495672_0145822 | 3300047320 | Bacteria | 1232 |
| 359 | Ga0495676_0119746 | 3300047321 | Bacteria | 1917 |
| 360 | Ga0495680_0304448 | 3300047322 | Bacteria | 1118 |
| 361 | Ga0495683_0004403 | 3300047323 | Bacteria | 8004 |
| 362 | Ga0495683_0008614 | 3300047323 | Bacteria | 5450 |
| 363 | Ga0495683_0018108 | 3300047323 | Bacteria | 3645 |
| 364 | Ga0495683_0022765 | 3300047323 | Bacteria | 3221 |
| 365 | Ga0495683_0056278 | 3300047323 | Bacteria | 1957 |
| 366 | Ga0495687_000213 | 3300047443 | Bacteria | 83235 |
| 367 | Ga0495687_000627 | 3300047443 | Bacteria | 40736 |
| 368 | Ga0495687_001996 | 3300047443 | Bacteria | 17310 |
| 369 | Ga0495687_002415 | 3300047443 | Bacteria | 15044 |
| 370 | Ga0495687_009945 | 3300047443 | Bacteria | 5262 |
| 371 | Ga0495675_0170691 | 3300047444 | Bacteria | 1336 |
| 372 | Ga0495679_012841 | 3300047446 | Bacteria | 3169 |
| 373 | Ga0495685_000068 | 3300047447 | Bacteria | 39515 |
| 374 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 375 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 376 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 377 | Ga0495673_0006741 | 3300047469 | Bacteria | 6711 |
| 378 | Ga0495681_0000922 | 3300047470 | Bacteria | 22658 |
| 379 | Ga0495686_0000472 | 3300047472 | Bacteria | 60008 |
| 380 | Ga0495686_0011467 | 3300047472 | Bacteria | 6240 |
| 381 | Ga0495686_0042269 | 3300047472 | Bacteria | 2899 |
| 382 | Ga0495686_0211292 | 3300047472 | Bacteria | 1108 |
| 383 | Ga0495593_0053893 | 3300047673 | Bacteria | 2121 |
| 384 | Ga0495602_0020085 | 3300048088 | Bacteria | 6608 |
| 385 | Ga0495602_0031529 | 3300048088 | Bacteria | 5010 |
| 386 | Ga0495602_0067174 | 3300048088 | Bacteria | 3086 |
| 387 | Ga0495602_0087216 | 3300048088 | Bacteria | 2602 |
| 388 | Ga0495615_0001567 | 3300048090 | Bacteria | 3441 |
| 389 | Ga0495615_0015972 | 3300048090 | Bacteria | 1612 |
| 390 | Ga0495626_0053238 | 3300048091 | Bacteria | 1863 |
| 391 | Ga0496100_0105063 | 3300048903 | Bacteria | 1952 |
| 392 | Ga0496100_0496272 | 3300048903 | Bacteria | 940 |
| 393 | Ga0496101_0013665 | 3300048904 | Bacteria | 5445 |
| 394 | Ga0496101_0574796 | 3300048904 | Bacteria | 891 |
| 395 | Ga0496102_0020524 | 3300048905 | Bacteria | 5838 |
| 396 | Ga0496102_0033996 | 3300048905 | Bacteria | 4584 |
| 397 | Ga0496102_0330431 | 3300048905 | Bacteria | 1436 |
| 398 | Ga0496103_0003963 | 3300048906 | Bacteria | 8996 |
| 399 | Ga0496103_0003976 | 3300048906 | Bacteria | 8974 |
| 400 | Ga0496104_0087773 | 3300048907 | Bacteria | 2971 |
| 401 | Ga0496104_0570959 | 3300048907 | Bacteria | 1041 |
| 402 | Ga0496105_0099937 | 3300048908 | Bacteria | 2396 |
| 403 | Ga0496106_0169539 | 3300048909 | Bacteria | 1729 |
| 404 | Ga0496107_0027333 | 3300048910 | Bacteria | 4051 |
| 405 | Ga0496109_0232069 | 3300048912 | Bacteria | 1736 |
| 406 | Ga0496110_0023168 | 3300048913 | Bacteria | 5280 |
| 407 | Ga0496110_0458286 | 3300048913 | Bacteria | 1162 |
| 408 | Ga0496111_0025352 | 3300048914 | Bacteria | 4184 |
| 409 | Ga0496111_0069071 | 3300048914 | Bacteria | 2569 |
| 410 | Ga0496112_0005904 | 3300048915 | Bacteria | 10674 |
| 411 | Ga0496113_0005524 | 3300048916 | Bacteria | 7893 |
| 412 | Ga0496114_0105796 | 3300048917 | Bacteria | 2407 |
| 413 | Ga0496115_0028856 | 3300048918 | Bacteria | 4352 |
| 414 | Ga0496115_0036843 | 3300048918 | Bacteria | 3874 |
| 415 | Ga0496115_0496274 | 3300048918 | Bacteria | 981 |
| 416 | Ga0496116_0017859 | 3300048919 | Bacteria | 5491 |
| 417 | Ga0496116_0054354 | 3300048919 | Bacteria | 2639 |
| 418 | Ga0496116_0067489 | 3300048919 | Bacteria | 2284 |
| 419 | Ga0496116_0075985 | 3300048919 | Bacteria | 2106 |
| 420 | Ga0496116_0085817 | 3300048919 | Bacteria | 1933 |
| 421 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 422 | Ga0496117_0025626 | 3300048920 | Bacteria | 4632 |
| 423 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 424 | Ga0496118_0036046 | 3300048921 | Bacteria | 4005 |
| 425 | Ga0496119_0132251 | 3300048922 | Bacteria | 1358 |
| 426 | Ga0496121_0008322 | 3300048924 | Bacteria | 12253 |
| 427 | Ga0496121_0013676 | 3300048924 | Bacteria | 8700 |
| 428 | Ga0496121_0092863 | 3300048924 | Bacteria | 2351 |
| 429 | Ga0496121_0114541 | 3300048924 | Bacteria | 2049 |
| 430 | Ga0496122_0002165 | 3300048925 | Bacteria | 28789 |
| 431 | Ga0496122_0013282 | 3300048925 | Bacteria | 8072 |
| 432 | Ga0496122_0019069 | 3300048925 | Bacteria | 6290 |
| 433 | Ga0496122_0095498 | 3300048925 | Bacteria | 2009 |
| 434 | Ga0496123_0014312 | 3300048926 | Bacteria | 6585 |
| 435 | Ga0496124_0002789 | 3300048927 | Bacteria | 22161 |
| 436 | Ga0496124_0046842 | 3300048927 | Bacteria | 3701 |
| 437 | Ga0496124_0064740 | 3300048927 | Bacteria | 3051 |
| 438 | Ga0496124_0325575 | 3300048927 | Bacteria | 1098 |
| 439 | Ga0496125_0009278 | 3300048928 | Bacteria | 10149 |
| 440 | Ga0496125_0092399 | 3300048928 | Bacteria | 2263 |
| 441 | Ga0496125_0143624 | 3300048928 | Bacteria | 1654 |
| 442 | Ga0496126_0004689 | 3300048929 | Bacteria | 16149 |
| 443 | Ga0496126_0035356 | 3300048929 | Bacteria | 4684 |
| 444 | Ga0495678_000027 | 3300049459 | Bacteria | 222075 |
| 445 | Ga0495678_000307 | 3300049459 | Bacteria | 52855 |
| 446 | Ga0495678_002583 | 3300049459 | Bacteria | 12121 |
| 447 | Ga0495678_003095 | 3300049459 | Bacteria | 10540 |
| 448 | Ga0495678_015631 | 3300049459 | Bacteria | 3487 |
| 449 | Ga0495682_0001114 | 3300049460 | Bacteria | 15635 |
| 450 | Ga0495682_0003146 | 3300049460 | Bacteria | 7452 |
| 451 | Ga0501227_047262 | 3300049665 | Bacteria | 1078 |
| 452 | Ga0501238_017201 | 3300049671 | Bacteria | 1006 |
| 453 | Ga0501269_000482 | 3300049766 | Bacteria | 8487 |
| 454 | Ga0501279_000705 | 3300049775 | Bacteria | 4377 |
| 455 | Ga0495601_0001611 | 3300053077 | Bacteria | 12435 |
| 456 | Ga0500595_000447 | 3300053119 | Bacteria | 25711 |
| 457 | Ga0500618_000088 | 3300053125 | Bacteria | 74892 |
| 458 | Ga0500574_027725 | 3300053141 | Bacteria | 1496 |
| 459 | Ga0500586_000662 | 3300053145 | Bacteria | 7034 |
| 460 | Ga0500619_000395 | 3300053154 | Bacteria | 7956 |
| 461 | Ga0466962_0008310 | 3300061719 | Bacteria | 4973 |
| 462 | 2738738631 | 2738541280 | Bacteria | 6630198 |
| 463 | 2510253087 | 2510065045 | Bacteria | 7761063 |
| 464 | 2512347256 | 2512047030 | Bacteria | 9031815 |
| 465 | 2513554054 | 2513237082 | Bacteria | 8640282 |
| 466 | 2513561518 | 2513237083 | Bacteria | 8410967 |
| 467 | 2516020666 | 2515154189 | Bacteria | 9629850 |
| 468 | 2519459975 | 2519103095 | Bacteria | 6629912 |
| 469 | 2585290518 | 2582581311 | Bacteria | 6763856 |
| 470 | 2599744248 | 2599185240 | Bacteria | 7968121 |
| 471 | 2600206285 | 2599185355 | Bacteria | 7968906 |
| 472 | 2600810224 | 2600255067 | Bacteria | 6795583 |
| 473 | 2601671574 | 2600255292 | Bacteria | 6300551 |
| 474 | 2643792496 | 2643221554 | Bacteria | 6603920 |
| 475 | 2644216988 | 2643221638 | Bacteria | 6579467 |
| 476 | 2644250607 | 2643221645 | Bacteria | 7207331 |
| 477 | 2644358922 | 2643221664 | Bacteria | 7272945 |
| 478 | 2676743400 | 2675903129 | Bacteria | 7964495 |
| 479 | 2719638878 | 2718217991 | Bacteria | 7829542 |
| 480 | 2738826274 | 2738541297 | Bacteria | 6549566 |
| 481 | 2738842555 | 2738541300 | Bacteria | 6675882 |
| 482 | 2739150071 | 2738541357 | Bacteria | 6549408 |
| 483 | 2739191990 | 2738543003 | Bacteria | 6549560 |
| 484 | 2739273302 | 2738543018 | Bacteria | 6718814 |
| 485 | 2739318467 | 2738543026 | Bacteria | 6549408 |
| 486 | 2739336708 | 2738543029 | Bacteria | 6549249 |
| 487 | 2739342346 | 2738543030 | Bacteria | 6719714 |
| 488 | 2739612538 | 2739367655 | Bacteria | 4051151 |
| 489 | 2792834798 | 2791355137 | Bacteria | 9654227 |
| 490 | 2808968435 | 2808606384 | Bacteria | 8474373 |
| 491 | 2809003266 | 2808606390 | Bacteria | 8476311 |
| 492 | 2809010543 | 2808606391 | Bacteria | 8308166 |
| 493 | 2817262251 | 2816332253 | Bacteria | 6764532 |
| 494 | 2817279969 | 2816332256 | Bacteria | 6891714 |
| 495 | 2817455443 | 2816332286 | Bacteria | 6853759 |
| 496 | 2819542092 | 2818991436 | Bacteria | 5376622 |
| 497 | 2821134921 | 2821131069 | Bacteria | 6108407 |
| 498 | 2842715774 | 2842711865 | Bacteria | 7155354 |
| 499 | 2855736533 | 2855730933 | Bacteria | 7047938 |
| 500 | 2855773470 | 2855767633 | Bacteria | 7049357 |
| 501 | 2856292147 | 2856287931 | Bacteria | 7223934 |
| 502 | 2857361169 | 2857357740 | Bacteria | 9937880 |
| 503 | 2857548592 | 2857547612 | Bacteria | 6179999 |
| 504 | 2857558165 | 2857553236 | Bacteria | 6166726 |
| 505 | 2857558826 | 2857558681 | Bacteria | 6617694 |
| 506 | 2857569697 | 2857564685 | Bacteria | 6290584 |
| 507 | 2863427623 | 2863421361 | Bacteria | 7300805 |
| 508 | 2870069976 | 2870068957 | Bacteria | 8925310 |
| 509 | 2883091029 | 2883087390 | Bacteria | 9532701 |
| 510 | 2885085645 | 2885080285 | Bacteria | 6355622 |
| 511 | 2885274118 | 2885270888 | Bacteria | 9831543 |
| 512 | 2904428292 | 2904424332 | Bacteria | 7633521 |
| 513 | 2919476474 | 2919476304 | Bacteria | 5888696 |
| 514 | 2932416069 | 2932410948 | Bacteria | 6312192 |
| 515 | 2932421918 | 2932416698 | Bacteria | 6315112 |
| 516 | 8003957665 | 8003955200 | Bacteria | 8601927 |
| 517 | 8020813424 | 8020807995 | Bacteria | 6801506 |
| 518 | 8020943899 | 8020938398 | Bacteria | 7472757 |
| 519 | 8020946890 | 8020945358 | Bacteria | 8467355 |
| 520 | 8020959017 | 8020953355 | Bacteria | 7439080 |
| 521 | 8040170222 | 8040167225 | Bacteria | 6542727 |
| 522 | 8040176578 | 8040173305 | Bacteria | 6827067 |
| 523 | JGI24739J22299_10017649 | |||
| 524 | JGI24735J21928_10003878 | |||
| 525 | JGI25162J39368_1000023 | |||
| 526 | JGI25152J39213_1000396 | |||
| 527 | JGI25150J39212_1004980 | |||
| 528 | JGI25150J39212_1005218 | |||
| 529 | JGI25159J45721_1004101 | |||
| 530 | JGI25165J46597_1000030 | |||
| 531 | JGI25153J46596_10009292 | |||
| 532 | rootH1_10066045 | |||
| 533 | rootL2_10014217 | |||
| 534 | JGI25160J50197_1002658 | |||
| 535 | JGI25161J50226_1001649 | |||
| 536 | Ga0055538_1000017 | |||
| 537 | Ga0055539_1000022 | |||
| 538 | Ga0055533_1000030 | |||
| 539 | Ga0055532_1009742 | |||
| 540 | Ga0055525_1000034 | |||
| 541 | Ga0055527_1000456 | |||
| 542 | Ga0055527_1000737 | |||
| 543 | Ga0055535_1001300 | |||
| 544 | Ga0055535_1001310 | |||
| 545 | Ga0055542_1001190 | |||
| 546 | Ga0055542_1005978 | |||
| 547 | Ga0055529_1000015 | |||
| 548 | Ga0055529_1000778 | |||
| 549 | Ga0055529_1008485 | |||
| 550 | Ga0055526_1000007 | |||
| 551 | Ga0055526_1000519 | |||
| 552 | Ga0055537_1000005 | |||
| 553 | Ga0055537_1012988 | |||
| 554 | Ga0055524_1000038 | |||
| 555 | Ga0055524_1002567 | |||
| 556 | Ga0055524_1004571 | |||
| 557 | Ga0055524_1016588 | |||
| 558 | Ga0055524_1026048 | |||
| 559 | Ga0055534_1000144 | |||
| 560 | Ga0055534_1001556 | |||
| 561 | Ga0055534_1009034 | |||
| 562 | Ga0055528_1000082 | |||
| 563 | Ga0055528_1002252 | |||
| 564 | Ga0055530_10011013 | |||
| 565 | Ga0055541_1000015 | |||
| 566 | Ga0058692_1001488 | |||
| 567 | Ga0070671_100432941 | |||
| 568 | Ga0070678_100533153 | |||
| 569 | Ga0070665_100096814 | |||
| 570 | Ga0068852_100813593 | |||
| 571 | Ga0070712_100062830 | |||
| 572 | Ga0079104_1012858 | |||
| 573 | Ga0099826_10000008 | |||
| 574 | Ga0099794_10087345 | |||
| 575 | Ga0105251_10000332 | |||
| 576 | Ga0105244_10001182 | |||
| 577 | Ga0105244_10002384 | |||
| 578 | Ga0105244_10044845 | |||
| 579 | Ga0105240_11010952 | |||
| 580 | Ga0105248_10060098 | |||
| 581 | Ga0105248_10314519 | |||
| 582 | Ga0105238_10081701 | |||
| 583 | Ga0105246_10053578 | |||
| 584 | Ga0157369_10618352 | |||
| 585 | Ga0182008_10000386 | |||
| 586 | Ga0182006_1000007 | |||
| 587 | Ga0182006_1000023 | |||
| 588 | Ga0182006_1046878 | |||
| 589 | Ga0182007_10000022 | |||
| 590 | Ga0182007_10003321 | |||
| 591 | Ga0182007_10003563 | |||
| 592 | Ga0182005_1000006 | |||
| 593 | Ga0182005_1000010 | |||
| 594 | Ga0182005_1000914 | |||
| 595 | Ga0163161_10030595 | |||
| 596 | Ga0213872_10000024 | |||
| 597 | Ga0213872_10000227 | |||
| 598 | Ga0213872_10001671 | |||
| 599 | Ga0213872_10063447 | |||
| 600 | Ga0209760_101371 | |||
| 601 | Ga0209784_100034 | |||
| 602 | Ga0209566_100038 | |||
| 603 | Ga0209674_100056 | |||
| 604 | Ga0209672_100041 | |||
| 605 | Ga0209672_100153 | |||
| 606 | Ga0209147_100202 | |||
| 607 | Ga0209147_100334 | |||
| 608 | Ga0209563_100057 | |||
| 609 | Ga0207427_100288 | |||
| 610 | Ga0209437_100071 | |||
| 611 | Ga0209437_101445 | |||
| 612 | Ga0209437_113866 | |||
| 613 | Ga0209258_100023 | |||
| 614 | Ga0209258_100120 | |||
| 615 | Ga0207425_1000009 | |||
| 616 | Ga0207425_1000036 | |||
| 617 | Ga0207425_1001241 | |||
| 618 | Ga0207425_1039824 | |||
| 619 | Ga0209646_1000042 | |||
| 620 | Ga0209677_100035 | |||
| 621 | Ga0209148_1000646 | |||
| 622 | Ga0209759_1016116 | |||
| 623 | Ga0209129_1000051 | |||
| 624 | Ga0209233_1000094 | |||
| 625 | Ga0209565_1000074 | |||
| 626 | Ga0209565_1000802 | |||
| 627 | Ga0209565_1004911 | |||
| 628 | Ga0209565_1006548 | |||
| 629 | Ga0209455_1000031 | |||
| 630 | Ga0209455_1000064 | |||
| 631 | Ga0209455_1000941 | |||
| 632 | Ga0209673_1000084 | |||
| 633 | Ga0209673_1000129 | |||
| 634 | Ga0209673_1008206 | |||
| 635 | Ga0209675_1000072 | |||
| 636 | Ga0209675_1000837 | |||
| 637 | Ga0209675_1009698 | |||
| 638 | Ga0209564_1000010 | |||
| 639 | Ga0209564_1000042 | |||
| 640 | Ga0209564_1000160 | |||
| 641 | Ga0209564_1000172 | |||
| 642 | Ga0209564_1003635 | |||
| 643 | Ga0209564_1004414 | |||
| 644 | Ga0209564_1029412 | |||
| 645 | Ga0209758_1000054 | |||
| 646 | Ga0209758_1000433 | |||
| 647 | Ga0209050_1000502 | |||
| 648 | Ga0209050_1008669 | |||
| 649 | Ga0209256_1000018 | |||
| 650 | Ga0209256_1000125 | |||
| 651 | Ga0209256_1000422 | |||
| 652 | Ga0209256_1004056 | |||
| 653 | Ga0209256_1004492 | |||
| 654 | Ga0207426_1001336 | |||
| 655 | Ga0207426_1007451 | |||
| 656 | Ga0209051_1013074 | |||
| 657 | Ga0209257_1000087 | |||
| 658 | Ga0207655_1000718 | |||
| 659 | Ga0207655_1022512 | |||
| 660 | Ga0207713_1001844 | |||
| 661 | Ga0207693_10168225 | |||
| 662 | Ga0207711_10012926 | |||
| 663 | Ga0207711_10101487 | |||
| 664 | Ga0207683_10484439 | |||
| 665 | Ga0207698_10704470 | |||
| 666 | Ga0209281_1011164 | |||
| 667 | Ga0209371_1000166 | |||
| 668 | Ga0209282_1000005 | |||
| 669 | Ga0268266_10498729 | |||
| 670 | Ga0268256_1000139 | |||
| 671 | Ga0316181_1218122 | |||
| 672 | Ga0265332_10056918 | |||
| 673 | Ga0265340_10110839 | |||
| 674 | Ga0307408_100000144 | |||
| 675 | Ga0307408_100000437 | |||
| 676 | Ga0307408_100009641 | |||
| 677 | Ga0307408_100031773 | |||
| 678 | Ga0307408_100203100 | |||
| 679 | Ga0265314_10018254 | |||
| 680 | Ga0307518_10112186 | |||
| 681 | Ga0307416_100004448 | |||
| 682 | Ga0307416_100588089 | |||
| 683 | Ga0307414_10010417 | |||
| 684 | Ga0307414_10354580 | |||
| 685 | Ga0307411_10229075 | |||
| 686 | Ga0395898_0180753 | |||
| 687 | Ga0395901_0010003 | |||
| 688 | Ga0436361_0108001 | |||
| 689 | Ga0436361_0243484 | |||
| 690 | Ga0436361_0792119 | |||
| 691 | Ga0466972_0128657 | |||
| 692 | Ga0466973_0013904 | |||
| 693 | Ga0466981_0219430 | |||
| 694 | Ga0466965_0005912 | |||
| 695 | Ga0466965_0038913 | |||
| 696 | Ga0466965_0159508 | |||
| 697 | Ga0466961_0001062 | |||
| 698 | Ga0466963_0003395 | |||
| 699 | Ga0466971_0007502 | |||
| 700 | Ga0466968_0006821 | |||
| 701 | Ga0466968_0009782 | |||
| 702 | Ga0466970_0037987 | |||
| 703 | Ga0466957_0000549 | |||
| 704 | Ga0466957_0156465 | |||
| 705 | Ga0466960_0041140 | |||
| 706 | Ga0466959_0017394 | |||
| 707 | Ga0495617_000020 | |||
| 708 | Ga0495617_001275 | |||
| 709 | Ga0495617_004506 | |||
| 710 | Ga0495617_089662 | |||
| 711 | Ga0495627_000004 | |||
| 712 | Ga0495592_0015528 | |||
| 713 | Ga0495590_0000012 | |||
| 714 | Ga0495590_0000977 | |||
| 715 | Ga0495591_039647 | |||
| 716 | Ga0495629_0091433 | |||
| 717 | Ga0495638_0000047 | |||
| 718 | Ga0495638_0023786 | |||
| 719 | Ga0495638_0027816 | |||
| 720 | Ga0495638_0084826 | |||
| 721 | Ga0495651_0000720 | |||
| 722 | Ga0495651_0250879 | |||
| 723 | Ga0495653_0000035 | |||
| 724 | Ga0495650_0000077 | |||
| 725 | Ga0495650_0000128 | |||
| 726 | Ga0495650_0000379 | |||
| 727 | Ga0495650_0002304 | |||
| 728 | Ga0495650_0003486 | |||
| 729 | Ga0495650_0009640 | |||
| 730 | Ga0495605_0000018 | |||
| 731 | Ga0495605_0033227 | |||
| 732 | Ga0495664_0008318 | |||
| 733 | Ga0495584_0001649 | |||
| 734 | Ga0495584_0076749 | |||
| 735 | Ga0495585_0000681 | |||
| 736 | Ga0495585_0057867 | |||
| 737 | Ga0495585_0225253 | |||
| 738 | Ga0495596_0069948 | |||
| 739 | Ga0495607_0002163 | |||
| 740 | Ga0495607_0002734 | |||
| 741 | Ga0495607_0006878 | |||
| 742 | Ga0495607_0070890 | |||
| 743 | Ga0495607_0092197 | |||
| 744 | Ga0495583_0000092 | |||
| 745 | Ga0495583_0000115 | |||
| 746 | Ga0495583_0000414 | |||
| 747 | Ga0495583_0033994 | |||
| 748 | Ga0495606_0000101 | |||
| 749 | Ga0495606_0000161 | |||
| 750 | Ga0495606_0000288 | |||
| 751 | Ga0495606_0000716 | |||
| 752 | Ga0495606_0000826 | |||
| 753 | Ga0495606_0003272 | |||
| 754 | Ga0495606_0006480 | |||
| 755 | Ga0495606_0010115 | |||
| 756 | Ga0495606_0029776 | |||
| 757 | Ga0495606_0045855 | |||
| 758 | Ga0495606_0060615 | |||
| 759 | Ga0495606_0063022 | |||
| 760 | Ga0495608_0011446 | |||
| 761 | Ga0495608_0063971 | |||
| 762 | Ga0495610_0000014 | |||
| 763 | Ga0495610_0003813 | |||
| 764 | Ga0495610_0008160 | |||
| 765 | Ga0495610_0010629 | |||
| 766 | Ga0495610_0031286 | |||
| 767 | Ga0495610_0040250 | |||
| 768 | Ga0495616_0000033 | |||
| 769 | Ga0495616_0029248 | |||
| 770 | Ga0495616_0063507 | |||
| 771 | Ga0495618_0143741 | |||
| 772 | Ga0495620_0029576 | |||
| 773 | Ga0495628_0001257 | |||
| 774 | Ga0495628_0002811 | |||
| 775 | Ga0495628_0058496 | |||
| 776 | Ga0495630_0114045 | |||
| 777 | Ga0495637_0000719 | |||
| 778 | Ga0495637_0001962 | |||
| 779 | Ga0495637_0031029 | |||
| 780 | Ga0495637_0058627 | |||
| 781 | Ga0495643_0000237 | |||
| 782 | Ga0495643_0000846 | |||
| 783 | Ga0495643_0057930 | |||
| 784 | Ga0495643_0058984 | |||
| 785 | Ga0495644_0002703 | |||
| 786 | Ga0495644_0009879 | |||
| 787 | Ga0495644_0016266 | |||
| 788 | Ga0495648_0000019 | |||
| 789 | Ga0495648_0000213 | |||
| 790 | Ga0495648_0007656 | |||
| 791 | Ga0495648_0008841 | |||
| 792 | Ga0495648_0021888 | |||
| 793 | Ga0495648_0033147 | |||
| 794 | Ga0495648_0110439 | |||
| 795 | Ga0495666_0038717 | |||
| 796 | Ga0495642_0000436 | |||
| 797 | Ga0495642_0024004 | |||
| 798 | Ga0495642_0029347 | |||
| 799 | Ga0495642_0042017 | |||
| 800 | Ga0495642_0219370 | |||
| 801 | Ga0495652_0004705 | |||
| 802 | Ga0495652_0016007 | |||
| 803 | Ga0495652_0096236 | |||
| 804 | Ga0495652_0314582 | |||
| 805 | Ga0495654_0000014 | |||
| 806 | Ga0495654_0002526 | |||
| 807 | Ga0495654_0011705 | |||
| 808 | Ga0495654_0038156 | |||
| 809 | Ga0495654_0049762 | |||
| 810 | Ga0495665_0023700 | |||
| 811 | Ga0495609_0000824 | |||
| 812 | Ga0495609_0004410 | |||
| 813 | Ga0495609_0007201 | |||
| 814 | Ga0495609_0052246 | |||
| 815 | Ga0495609_0141273 | |||
| 816 | Ga0495597_0000081 | |||
| 817 | Ga0495597_0000152 | |||
| 818 | Ga0495597_0037556 | |||
| 819 | Ga0495597_0068604 | |||
| 820 | Ga0495645_0001268 | |||
| 821 | Ga0495645_0019366 | |||
| 822 | Ga0495645_0223428 | |||
| 823 | Ga0495622_0000019 | |||
| 824 | Ga0495622_0000037 | |||
| 825 | Ga0495622_0078231 | |||
| 826 | Ga0495633_0000086 | |||
| 827 | Ga0495633_0000091 | |||
| 828 | Ga0495633_0000280 | |||
| 829 | Ga0495633_0010253 | |||
| 830 | Ga0495633_0022970 | |||
| 831 | Ga0495633_0034218 | |||
| 832 | Ga0495633_0036244 | |||
| 833 | Ga0495656_0022899 | |||
| 834 | Ga0495656_0064656 | |||
| 835 | Ga0495656_0123524 | |||
| 836 | Ga0495668_0000575 | |||
| 837 | Ga0495668_0000582 | |||
| 838 | Ga0495668_0001497 | |||
| 839 | Ga0495634_0254507 | |||
| 840 | Ga0495625_0000208 | |||
| 841 | Ga0495625_0000675 | |||
| 842 | Ga0495625_0010694 | |||
| 843 | Ga0495625_0012234 | |||
| 844 | Ga0495625_0013339 | |||
| 845 | Ga0495625_0015779 | |||
| 846 | Ga0495625_0038790 | |||
| 847 | Ga0495625_0160527 | |||
| 848 | Ga0495635_0144382 | |||
| 849 | Ga0495659_0002236 | |||
| 850 | Ga0495659_0002768 | |||
| 851 | Ga0495661_0012776 | |||
| 852 | Ga0495661_0147069 | |||
| 853 | Ga0495588_0107893 | |||
| 854 | Ga0495623_0005164 | |||
| 855 | Ga0495646_0003863 | |||
| 856 | Ga0495658_0044679 | |||
| 857 | Ga0495624_0011977 | |||
| 858 | Ga0495624_0013981 | |||
| 859 | Ga0495624_0055990 | |||
| 860 | Ga0495671_0000005 | |||
| 861 | Ga0495671_0001012 | |||
| 862 | Ga0495671_0180769 | |||
| 863 | Ga0495649_0005693 | |||
| 864 | Ga0495649_0032350 | |||
| 865 | Ga0495649_0036597 | |||
| 866 | Ga0495649_0048140 | |||
| 867 | Ga0495649_0048915 | |||
| 868 | Ga0495649_0106349 | |||
| 869 | Ga0495600_0004213 | |||
| 870 | Ga0495660_0005205 | |||
| 871 | Ga0495660_0005939 | |||
| 872 | Ga0495660_0034206 | |||
| 873 | Ga0495660_0100855 | |||
| 874 | Ga0495660_0158238 | |||
| 875 | Ga0495636_0012008 | |||
| 876 | Ga0495674_0025855 | |||
| 877 | Ga0495672_0000019 | |||
| 878 | Ga0495672_0000026 | |||
| 879 | Ga0495672_0000226 | |||
| 880 | Ga0495672_0145822 | |||
| 881 | Ga0495676_0119746 | |||
| 882 | Ga0495680_0304448 | |||
| 883 | Ga0495683_0004403 | |||
| 884 | Ga0495683_0008614 | |||
| 885 | Ga0495683_0018108 | |||
| 886 | Ga0495683_0022765 | |||
| 887 | Ga0495683_0056278 | |||
| 888 | Ga0495687_000213 | |||
| 889 | Ga0495687_000627 | |||
| 890 | Ga0495687_001996 | |||
| 891 | Ga0495687_002415 | |||
| 892 | Ga0495687_009945 | |||
| 893 | Ga0495675_0170691 | |||
| 894 | Ga0495679_012841 | |||
| 895 | Ga0495685_000068 | |||
| 896 | Ga0495673_0000008 | |||
| 897 | Ga0495673_0000009 | |||
| 898 | Ga0495673_0000012 | |||
| 899 | Ga0495673_0006741 | |||
| 900 | Ga0495681_0000922 | |||
| 901 | Ga0495686_0000472 | |||
| 902 | Ga0495686_0011467 | |||
| 903 | Ga0495686_0042269 | |||
| 904 | Ga0495686_0211292 | |||
| 905 | Ga0495593_0053893 | |||
| 906 | Ga0495602_0020085 | |||
| 907 | Ga0495602_0031529 | |||
| 908 | Ga0495602_0067174 | |||
| 909 | Ga0495602_0087216 | |||
| 910 | Ga0495615_0001567 | |||
| 911 | Ga0495615_0015972 | |||
| 912 | Ga0495626_0053238 | |||
| 913 | Ga0496100_0105063 | |||
| 914 | Ga0496100_0496272 | |||
| 915 | Ga0496101_0013665 | |||
| 916 | Ga0496101_0574796 | |||
| 917 | Ga0496102_0020524 | |||
| 918 | Ga0496102_0033996 | |||
| 919 | Ga0496102_0330431 | |||
| 920 | Ga0496103_0003963 | |||
| 921 | Ga0496103_0003976 | |||
| 922 | Ga0496104_0087773 | |||
| 923 | Ga0496104_0570959 | |||
| 924 | Ga0496105_0099937 | |||
| 925 | Ga0496106_0169539 | |||
| 926 | Ga0496107_0027333 | |||
| 927 | Ga0496109_0232069 | |||
| 928 | Ga0496110_0023168 | |||
| 929 | Ga0496110_0458286 | |||
| 930 | Ga0496111_0025352 | |||
| 931 | Ga0496111_0069071 | |||
| 932 | Ga0496112_0005904 | |||
| 933 | Ga0496113_0005524 | |||
| 934 | Ga0496114_0105796 | |||
| 935 | Ga0496115_0028856 | |||
| 936 | Ga0496115_0036843 | |||
| 937 | Ga0496115_0496274 | |||
| 938 | Ga0496116_0017859 | |||
| 939 | Ga0496116_0054354 | |||
| 940 | Ga0496116_0067489 | |||
| 941 | Ga0496116_0075985 | |||
| 942 | Ga0496116_0085817 | |||
| 943 | Ga0496117_0000005 | |||
| 944 | Ga0496117_0025626 | |||
| 945 | Ga0496118_0000022 | |||
| 946 | Ga0496118_0036046 | |||
| 947 | Ga0496119_0132251 | |||
| 948 | Ga0496121_0008322 | |||
| 949 | Ga0496121_0013676 | |||
| 950 | Ga0496121_0092863 | |||
| 951 | Ga0496121_0114541 | |||
| 952 | Ga0496122_0002165 | |||
| 953 | Ga0496122_0013282 | |||
| 954 | Ga0496122_0019069 | |||
| 955 | Ga0496122_0095498 | |||
| 956 | Ga0496123_0014312 | |||
| 957 | Ga0496124_0002789 | |||
| 958 | Ga0496124_0046842 | |||
| 959 | Ga0496124_0064740 | |||
| 960 | Ga0496124_0325575 | |||
| 961 | Ga0496125_0009278 | |||
| 962 | Ga0496125_0092399 | |||
| 963 | Ga0496125_0143624 | |||
| 964 | Ga0496126_0004689 | |||
| 965 | Ga0496126_0035356 | |||
| 966 | Ga0495678_000027 | |||
| 967 | Ga0495678_000307 | |||
| 968 | Ga0495678_002583 | |||
| 969 | Ga0495678_003095 | |||
| 970 | Ga0495678_015631 | |||
| 971 | Ga0495682_0001114 | |||
| 972 | Ga0495682_0003146 | |||
| 973 | Ga0501227_047262 | |||
| 974 | Ga0501238_017201 | |||
| 975 | Ga0501269_000482 | |||
| 976 | Ga0501279_000705 | |||
| 977 | Ga0495601_0001611 | |||
| 978 | Ga0500595_000447 | |||
| 979 | Ga0500618_000088 | |||
| 980 | Ga0500574_027725 | |||
| 981 | Ga0500586_000662 | |||
| 982 | Ga0500619_000395 | |||
| 983 | Ga0466962_0008310 | |||
| 984 | 2738738631 | |||
| 985 | 2510253087 | |||
| 986 | 2512347256 | |||
| 987 | 2513554054 | |||
| 988 | 2513561518 | |||
| 989 | 2516020666 | |||
| 990 | 2519459975 | |||
| 991 | 2585290518 | |||
| 992 | 2599744248 | |||
| 993 | 2600206285 | |||
| 994 | 2600810224 | |||
| 995 | 2601671574 | |||
| 996 | 2643792496 | |||
| 997 | 2644216988 | |||
| 998 | 2644250607 | |||
| 999 | 2644358922 | |||
| 1000 | 2676743400 | |||
| 1001 | 2719638878 | |||
| 1002 | 2738826274 | |||
| 1003 | 2738842555 | |||
| 1004 | 2739150071 | |||
| 1005 | 2739191990 | |||
| 1006 | 2739273302 | |||
| 1007 | 2739318467 | |||
| 1008 | 2739336708 | |||
| 1009 | 2739342346 | |||
| 1010 | 2739612538 | |||
| 1011 | 2792834798 | |||
| 1012 | 2808968435 | |||
| 1013 | 2809003266 | |||
| 1014 | 2809010543 | |||
| 1015 | 2817262251 | |||
| 1016 | 2817279969 | |||
| 1017 | 2817455443 | |||
| 1018 | 2819542092 | |||
| 1019 | 2821134921 | |||
| 1020 | 2842715774 | |||
| 1021 | 2855736533 | |||
| 1022 | 2855773470 | |||
| 1023 | 2856292147 | |||
| 1024 | 2857361169 | |||
| 1025 | 2857548592 | |||
| 1026 | 2857558165 | |||
| 1027 | 2857558826 | |||
| 1028 | 2857569697 | |||
| 1029 | 2863427623 | |||
| 1030 | 2870069976 | |||
| 1031 | 2883091029 | |||
| 1032 | 2885085645 | |||
| 1033 | 2885274118 | |||
| 1034 | 2904428292 | |||
| 1035 | 2919476474 | |||
| 1036 | 2932416069 | |||
| 1037 | 2932421918 | |||
| 1038 | 8003957665 | |||
| 1039 | 8020813424 | |||
| 1040 | 8020943899 | |||
| 1041 | 8020946890 | |||
| 1042 | 8020959017 | |||
| 1043 | 8040170222 | |||
| 1044 | 8040176578 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dae-assembly1.cif.gz_A | dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid | 0.9544 | 5 | 229 |
| 1a82-assembly1.cif.gz_A | dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid | 0.95 | 5 | 228 |
| 1dts-assembly1.cif.gz_A-2 | crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution | 0.9485 | 5 | 229 |
| 1dae-assembly1.cif.gz_A | dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid | 0.9417 | 5 | 229 |
| 1dts-assembly1.cif.gz_A-2 | crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution | 0.936 | 5 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6E9_2_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9207 | 6 | 229 | 3.40.50.300 |
| af_P0A6E9_2_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9047 | 6 | 229 | 3.40.50.300 |
| af_Q58695_1_213_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9017 | 7 | 210 | 3.40.50.300 |
| 3of5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8928 | 5 | 234 | 3.40.50.300 |
| 3of5B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.881 | 5 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A9AE45-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 1.001 | 1 | 239 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A6P2NRK3-F1-model_v4 | Multifunctional fusion protein [Includes: 8-amino-7-oxononanoate synthase (AONS) (EC 2.3.1.47) (7-keto-8-amino-pelargonic acid synthase) (8-amino-7-ketopelargonate synthase) (7-KAP synthase) (KAPA synthase); ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (Dethiobiotin synthase) (DTBS)] | 1 | 1 | 239 |
GO:0000287
GO:0004141 GO:0005524 GO:0005737 GO:0008710 GO:0009102 GO:0030170 |
| AF-A2VUZ1-F1-model_v4 | deleted | 0.9999 | 2 | 239 |
|
| AF-K0DHY0-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9996 | 8 | 239 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A1G7P1E6-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9991 | 1 | 239 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |