F458926

General Info

Members Datasets Scaffolds Average Seq Length
523 235 1046 266

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1000064|JGI25152J39213_100006410
Length 293
Sequence VNIYGFLSIMAFKNFLFNGVFISSLYQIITFMELLTSAEAWISLFTLTLLEIVLGIDNVIFVSIILNRVQQKSQKTARVIWMLTGIASRCLMLFGLSWLLSQKGKFIIPESWFGKGFDLASLVMLLGGLFLIYKSVMEIHHKLEGEDPTINTNSKKPLGFGQAVFQIMLIDAVFSFDSIITAGGTAKHVEVMIVAVVIAMFIMFTFSPKIAGFIHQHPTLKMLALSFLVMIGLSLVIEGWDSRAAHEMHLKNYIYFGMAFSVAVEVLNMIFRKRQLKNVVKLNEPRMESEEKK

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
206 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
207 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
208 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
209 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
212 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
213 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 0.57
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000064 3300002773 Bacteria 70321
2 JGI25150J39212_1000004 3300002774 Bacteria 417320
3 JGI25151J46595_10000002 3300003187 Bacteria 731381
4 JGI25153J46596_10000037 3300003215 Bacteria 182199
5 Ga0065704_10229283 3300005289 Bacteria 1048
6 Ga0065712_10009488 3300005290 Bacteria 5714
7 Ga0065712_10091879 3300005290 Unclassified 2350
8 Ga0065715_10118640 3300005293 Bacteria 2309
9 Ga0065715_10123516 3300005293 Bacteria 2176
10 Ga0065707_10107814 3300005295 Bacteria 2537
11 Ga0070658_10004224 3300005327 Bacteria 11752
12 Ga0070658_10019089 3300005327 Bacteria 5492
13 Ga0070658_10413121 3300005327 Bacteria 1160
14 Ga0070676_10008581 3300005328 Bacteria 5510
15 Ga0070676_10014369 3300005328 Bacteria 4351
16 Ga0070676_10114959 3300005328 Bacteria 1681
17 Ga0070683_100005747 3300005329 Bacteria 10363
18 Ga0070683_100028295 3300005329 Bacteria 5065
19 Ga0070683_100480960 3300005329 Bacteria 1186
20 Ga0070683_100762382 3300005329 Bacteria 927
21 Ga0070690_100178441 3300005330 Unclassified 1466
22 Ga0070690_100250830 3300005330 Bacteria 1252
23 Ga0070670_100004771 3300005331 Bacteria 11384
24 Ga0070670_100067137 3300005331 Bacteria 3078
25 Ga0070677_10041136 3300005333 Bacteria 1823
26 Ga0070677_10109449 3300005333 Bacteria 1231
27 Ga0068869_100030122 3300005334 Bacteria 3807
28 Ga0068869_100070696 3300005334 Unclassified 2583
29 Ga0070666_10041522 3300005335 Bacteria 3074
30 Ga0070680_100006655 3300005336 Bacteria 8793
31 Ga0070680_100094930 3300005336 Bacteria 2472
32 Ga0070682_100053729 3300005337 Bacteria 2526
33 Ga0068868_100013209 3300005338 Bacteria 6048
34 Ga0068868_100043175 3300005338 Bacteria 3521
35 Ga0068868_100146630 3300005338 Unclassified 1941
36 Ga0070660_100001312 3300005339 Bacteria 16942
37 Ga0070660_100045814 3300005339 Bacteria 3350
38 Ga0070660_100177412 3300005339 Bacteria 1723
39 Ga0070689_100033319 3300005340 Bacteria 3924
40 Ga0070689_100033407 3300005340 Bacteria 3920
41 Ga0070689_100052596 3300005340 Bacteria 3150
42 Ga0070689_100485458 3300005340 Bacteria 1056
43 Ga0070689_100678695 3300005340 Bacteria 898
44 Ga0070687_100019005 3300005343 Bacteria 3190
45 Ga0070687_100069109 3300005343 Bacteria 1890
46 Ga0070661_100015183 3300005344 Bacteria 5434
47 Ga0070661_100093504 3300005344 Bacteria 2228
48 Ga0070661_100351793 3300005344 Bacteria 1156
49 Ga0070692_10351592 3300005345 Bacteria 916
50 Ga0070669_100052838 3300005353 Bacteria 2974
51 Ga0070669_100062427 3300005353 Bacteria 2739
52 Ga0070675_100034713 3300005354 Bacteria 4095
53 Ga0070675_100127278 3300005354 Bacteria 2168
54 Ga0070675_100248073 3300005354 Unclassified 1557
55 Ga0070675_100266444 3300005354 Bacteria 1502
56 Ga0070671_100353865 3300005355 Bacteria 1254
57 Ga0070674_100166248 3300005356 Unclassified 1678
58 Ga0070674_100206359 3300005356 Bacteria 1520
59 Ga0070673_100045673 3300005364 Bacteria 3398
60 Ga0070688_100009106 3300005365 Bacteria 5415
61 Ga0070688_100010539 3300005365 Bacteria 5102
62 Ga0070688_100066760 3300005365 Bacteria 2290
63 Ga0070659_100010918 3300005366 Bacteria 6702
64 Ga0070659_100019979 3300005366 Bacteria 5085
65 Ga0070659_100112331 3300005366 Bacteria 2200
66 Ga0070667_100006213 3300005367 Bacteria 9937
67 Ga0070667_100057636 3300005367 Bacteria 3284
68 Ga0070667_100071590 3300005367 Bacteria 2953
69 Ga0070667_100132993 3300005367 Bacteria 2173
70 Ga0070667_100212103 3300005367 Unclassified 1721
71 Ga0070667_100379326 3300005367 Unclassified 1284
72 Ga0070700_100402097 3300005441 Bacteria 1030
73 Ga0070663_100093549 3300005455 Bacteria 2230
74 Ga0070663_100133782 3300005455 Bacteria 1886
75 Ga0070678_100184839 3300005456 Bacteria 1709
76 Ga0070678_100327079 3300005456 Bacteria 1311
77 Ga0070678_100408189 3300005456 Bacteria 1181
78 Ga0070662_100083910 3300005457 Bacteria 2379
79 Ga0070681_10026327 3300005458 Bacteria 5846
80 Ga0070681_10071007 3300005458 Bacteria 3447
81 Ga0070681_10098241 3300005458 Bacteria 2874
82 Ga0070681_10226177 3300005458 Bacteria 1785
83 Ga0068867_100129219 3300005459 Bacteria 1962
84 Ga0068867_100134412 3300005459 Bacteria 1926
85 Ga0068867_100318234 3300005459 Unclassified 1288
86 Ga0068867_100459759 3300005459 Bacteria 1086
87 Ga0068867_100536108 3300005459 Bacteria 1011
88 Ga0068867_100707842 3300005459 Bacteria 889
89 Ga0068867_100748377 3300005459 Bacteria 867
90 Ga0070685_10017187 3300005466 Bacteria 3869
91 Ga0070698_100003794 3300005471 Bacteria 16603
92 Ga0070698_100009599 3300005471 Bacteria 10353
93 Ga0070698_100033708 3300005471 Bacteria 5304
94 Ga0070699_100129401 3300005518 Bacteria 2225
95 Ga0070679_100034898 3300005530 Bacteria 4988
96 Ga0070679_100094210 3300005530 Unclassified 2981
97 Ga0070684_100000465 3300005535 Bacteria 27738
98 Ga0070684_100004469 3300005535 Bacteria 10650
99 Ga0070684_100022349 3300005535 Bacteria 5275
100 Ga0070684_100221718 3300005535 Bacteria 1725
101 Ga0068853_100013989 3300005539 Bacteria 6565
102 Ga0068853_100026629 3300005539 Bacteria 4857
103 Ga0068853_100032392 3300005539 Bacteria 4428
104 Ga0068853_100054770 3300005539 Bacteria 3437
105 Ga0068853_100120986 3300005539 Bacteria 2335
106 Ga0068853_100255336 3300005539 Bacteria 1610
107 Ga0070672_100025529 3300005543 Bacteria 4383
108 Ga0070672_100071703 3300005543 Bacteria 2756
109 Ga0070672_100118766 3300005543 Bacteria 2162
110 Ga0070686_100006502 3300005544 Bacteria 6500
111 Ga0070665_100075917 3300005548 Unclassified 3368
112 Ga0070665_100128733 3300005548 Bacteria 2534
113 Ga0070704_100178602 3300005549 Bacteria 1696
114 Ga0068855_100006466 3300005563 Bacteria 14253
115 Ga0068855_100010988 3300005563 Bacteria 10926
116 Ga0068855_100067413 3300005563 Bacteria 4169
117 Ga0068855_100139137 3300005563 Bacteria 2769
118 Ga0068855_100200409 3300005563 Bacteria 2247
119 Ga0068855_100312553 3300005563 Bacteria 1738
120 Ga0068855_100388802 3300005563 Unclassified 1530
121 Ga0070664_100001035 3300005564 Bacteria 21877
122 Ga0070664_100001670 3300005564 Bacteria 17755
123 Ga0070664_100015359 3300005564 Bacteria 6261
124 Ga0070664_100287531 3300005564 Unclassified 1484
125 Ga0068857_100018971 3300005577 Bacteria 6036
126 Ga0068857_100022098 3300005577 Bacteria 5597
127 Ga0068857_100156423 3300005577 Bacteria 2067
128 Ga0068857_100221633 3300005577 Unclassified 1728
129 Ga0068854_100040234 3300005578 Bacteria 3298
130 Ga0068854_100074697 3300005578 Unclassified 2487
131 Ga0068854_100227708 3300005578 Unclassified 1478
132 Ga0068856_100146444 3300005614 Bacteria 2369
133 Ga0068856_100150396 3300005614 Bacteria 2337
134 Ga0070702_100176494 3300005615 Unclassified 1394
135 Ga0068852_100000346 3300005616 Bacteria 31188
136 Ga0068852_100013623 3300005616 Bacteria 6227
137 Ga0068852_100058759 3300005616 Bacteria 3332
138 Ga0068852_100266099 3300005616 Unclassified 1648
139 Ga0068852_100329604 3300005616 Unclassified 1485
140 Ga0068859_100068123 3300005617 Bacteria 3594
141 Ga0068859_100094887 3300005617 Bacteria 3036
142 Ga0068859_100265516 3300005617 Bacteria 1808
143 Ga0068859_100322166 3300005617 Bacteria 1640
144 Ga0068859_100565566 3300005617 Bacteria 1231
145 Ga0068864_100048426 3300005618 Bacteria 3654
146 Ga0068866_10282671 3300005718 Bacteria 1029
147 Ga0068861_100002986 3300005719 Bacteria 11162
148 Ga0068861_100037888 3300005719 Unclassified 3586
149 Ga0068861_100089678 3300005719 Bacteria 2424
150 Ga0068851_10093526 3300005834 Bacteria 1586
151 Ga0068851_10302387 3300005834 Bacteria 920
152 Ga0068870_10002531 3300005840 Bacteria 7637
153 Ga0068870_10019073 3300005840 Bacteria 3322
154 Ga0068870_10077310 3300005840 Unclassified 1831
155 Ga0068870_10096390 3300005840 Bacteria 1663
156 Ga0068863_100013093 3300005841 Bacteria 8002
157 Ga0068863_100063398 3300005841 Bacteria 3495
158 Ga0068858_100031488 3300005842 Bacteria 4927
159 Ga0068858_100430257 3300005842 Bacteria 1270
160 Ga0068860_100015379 3300005843 Bacteria 7477
161 Ga0068860_100034632 3300005843 Bacteria 4845
162 Ga0068860_100046063 3300005843 Bacteria 4158
163 Ga0068860_100141347 3300005843 Bacteria 2314
164 Ga0068862_100134197 3300005844 Bacteria 2192
165 Ga0068862_100264864 3300005844 Bacteria 1570
166 Ga0097621_100046703 3300006237 Bacteria 3505
167 Ga0097621_100113392 3300006237 Unclassified 2293
168 Ga0097621_100434718 3300006237 Bacteria 1180
169 Ga0068871_100094765 3300006358 Unclassified 2492
170 Ga0068871_100385180 3300006358 Unclassified 1246
171 Ga0075428_100006377 3300006844 Bacteria 13128
172 Ga0075428_100011755 3300006844 Bacteria 9747
173 Ga0075428_100043479 3300006844 Bacteria 4938
174 Ga0075428_100266216 3300006844 Bacteria 1845
175 Ga0075430_100023369 3300006846 Bacteria 5261
176 Ga0075431_100574263 3300006847 Bacteria 1113
177 Ga0075434_100320258 3300006871 Bacteria 1571
178 Ga0075429_100001087 3300006880 Bacteria 21847
179 Ga0075429_100316316 3300006880 Bacteria 1366
180 Ga0097620_100068123 3300006931 Bacteria 3594
181 Ga0097620_100094894 3300006931 Bacteria 3036
182 Ga0097620_100150103 3300006931 Unclassified 2406
183 Ga0097620_100265536 3300006931 Bacteria 1808
184 Ga0097620_100322174 3300006931 Bacteria 1640
185 Ga0097620_100565560 3300006931 Bacteria 1231
186 Ga0105240_10017744 3300009093 Bacteria 9580
187 Ga0111539_10039549 3300009094 Bacteria 5683
188 Ga0114129_10206190 3300009147 Bacteria 2660
189 Ga0105243_10273616 3300009148 Bacteria 1518
190 Ga0105243_10368528 3300009148 Bacteria 1324
191 Ga0105241_10007003 3300009174 Bacteria 8295
192 Ga0105242_10008177 3300009176 Bacteria 8036
193 Ga0105242_10058530 3300009176 Bacteria 3159
194 Ga0105248_10156977 3300009177 Bacteria 2567
195 Ga0105248_10725935 3300009177 Unclassified 1121
196 Ga0105237_10079889 3300009545 Bacteria 3261
197 Ga0105249_10006541 3300009553 Bacteria 10137
198 Ga0105249_10008926 3300009553 Bacteria 8757
199 Ga0105249_10192968 3300009553 Unclassified 1989
200 Ga0105249_10347528 3300009553 Bacteria 1502
201 Ga0105239_10642565 3300010375 Bacteria 1212
202 Ga0157373_10018059 3300013100 Bacteria 5137
203 Ga0157373_10023446 3300013100 Bacteria 4474
204 Ga0157373_10027586 3300013100 Bacteria 4097
205 Ga0157373_10037411 3300013100 Bacteria 3478
206 Ga0157373_10063728 3300013100 Bacteria 2609
207 Ga0157373_10134238 3300013100 Bacteria 1740
208 Ga0157371_10001134 3300013102 Bacteria 28717
209 Ga0157371_10002769 3300013102 Bacteria 16467
210 Ga0157371_10003497 3300013102 Bacteria 14205
211 Ga0157371_10019924 3300013102 Bacteria 4942
212 Ga0157371_10028693 3300013102 Bacteria 4028
213 Ga0157371_10044245 3300013102 Bacteria 3170
214 Ga0157371_10087762 3300013102 Bacteria 2202
215 Ga0157371_10139078 3300013102 Bacteria 1730
216 Ga0157371_10241035 3300013102 Unclassified 1301
217 Ga0157370_10000473 3300013104 Bacteria 50187
218 Ga0157370_10001371 3300013104 Bacteria 30157
219 Ga0157370_10004859 3300013104 Bacteria 15261
220 Ga0157370_10152402 3300013104 Bacteria 2151
221 Ga0157370_10250762 3300013104 Unclassified 1637
222 Ga0157370_10301841 3300013104 Unclassified 1478
223 Ga0157369_10028123 3300013105 Bacteria 6224
224 Ga0157369_10052694 3300013105 Bacteria 4401
225 Ga0157369_10067274 3300013105 Bacteria 3852
226 Ga0157369_10169118 3300013105 Bacteria 2304
227 Ga0157369_10450990 3300013105 Bacteria 1332
228 Ga0157374_10000260 3300013296 Bacteria 48732
229 Ga0157374_10242503 3300013296 Unclassified 1772
230 Ga0157374_10644396 3300013296 Bacteria 1071
231 Ga0157378_10013101 3300013297 Bacteria 7254
232 Ga0157378_10040577 3300013297 Bacteria 4128
233 Ga0157378_10329509 3300013297 Bacteria 1486
234 Ga0157378_10360189 3300013297 Bacteria 1423
235 Ga0163162_10001051 3300013306 Bacteria 25638
236 Ga0163162_10007331 3300013306 Bacteria 10716
237 Ga0163162_10066982 3300013306 Bacteria 3641
238 Ga0163162_10110017 3300013306 Bacteria 2853
239 Ga0163162_10135968 3300013306 Bacteria 2569
240 Ga0163162_10676013 3300013306 Bacteria 1155
241 Ga0157372_10018515 3300013307 Bacteria 7488
242 Ga0157372_10029760 3300013307 Bacteria 5967
243 Ga0157372_10035972 3300013307 Bacteria 5454
244 Ga0157372_10162876 3300013307 Bacteria 2578
245 Ga0157372_10163319 3300013307 Bacteria 2574
246 Ga0157372_10183987 3300013307 Bacteria 2419
247 Ga0157372_10201445 3300013307 Bacteria 2306
248 Ga0157372_10259631 3300013307 Bacteria 2017
249 Ga0157372_10508537 3300013307 Unclassified 1404
250 Ga0157372_10674438 3300013307 Bacteria 1203
251 Ga0157375_10064780 3300013308 Bacteria 3640
252 Ga0157375_10256504 3300013308 Unclassified 1910
253 Ga0157375_10921959 3300013308 Bacteria 1017
254 Ga0163163_10000279 3300014325 Bacteria 50882
255 Ga0163163_10032149 3300014325 Bacteria 5068
256 Ga0163163_10156573 3300014325 Unclassified 2323
257 Ga0163163_10158595 3300014325 Unclassified 2307
258 Ga0163163_10230700 3300014325 Bacteria 1900
259 Ga0163163_10632356 3300014325 Bacteria 1134
260 Ga0163163_10810756 3300014325 Bacteria 999
261 Ga0157380_10000947 3300014326 Bacteria 18382
262 Ga0157380_10091927 3300014326 Bacteria 2506
263 Ga0157380_10109653 3300014326 Bacteria 2316
264 Ga0157380_10250719 3300014326 Bacteria 1602
265 Ga0157380_10701076 3300014326 Bacteria 1017
266 Ga0157377_10004609 3300014745 Bacteria 6372
267 Ga0157377_10053520 3300014745 Bacteria 2282
268 Ga0157377_10206928 3300014745 Bacteria 1249
269 Ga0157379_10059902 3300014968 Bacteria 3404
270 Ga0157379_10196432 3300014968 Bacteria 1824
271 Ga0157376_10145571 3300014969 Bacteria 2131
272 Ga0157376_10159995 3300014969 Bacteria 2040
273 Ga0163161_10289921 3300017792 Unclassified 1286
274 Ga0207425_1000003 3300025245 Bacteria 1145342
275 Ga0209129_1000022 3300025258 Bacteria 440876
276 Ga0209025_1000007 3300025294 Bacteria 1145109
277 Ga0209758_1000012 3300025297 Bacteria 949866
278 Ga0207697_10045649 3300025315 Bacteria 1804
279 Ga0207656_10048245 3300025321 Bacteria 1833
280 Ga0207682_10101197 3300025893 Bacteria 1260
281 Ga0207688_10001577 3300025901 Bacteria 12027
282 Ga0207680_10082596 3300025903 Bacteria 2022
283 Ga0207680_10128895 3300025903 Bacteria 1665
284 Ga0207647_10000017 3300025904 Bacteria 129999
285 Ga0207647_10324127 3300025904 Unclassified 874
286 Ga0207645_10003668 3300025907 Bacteria 11592
287 Ga0207645_10034704 3300025907 Bacteria 3241
288 Ga0207643_10005651 3300025908 Bacteria 6687
289 Ga0207705_10002621 3300025909 Bacteria 13792
290 Ga0207705_10027556 3300025909 Bacteria 4052
291 Ga0207705_10046523 3300025909 Bacteria 3118
292 Ga0207654_10059280 3300025911 Bacteria 2232
293 Ga0207707_10078398 3300025912 Bacteria 2885
294 Ga0207695_10013243 3300025913 Bacteria 9841
295 Ga0207671_10053910 3300025914 Bacteria 2980
296 Ga0207660_10009405 3300025917 Bacteria 6326
297 Ga0207660_10213824 3300025917 Bacteria 1511
298 Ga0207662_10085549 3300025918 Unclassified 1931
299 Ga0207657_10001601 3300025919 Bacteria 24346
300 Ga0207657_10049561 3300025919 Bacteria 3658
301 Ga0207657_10055990 3300025919 Bacteria 3404
302 Ga0207657_10227557 3300025919 Bacteria 1492
303 Ga0207649_10009081 3300025920 Bacteria 5434
304 Ga0207652_10000611 3300025921 Bacteria 35594
305 Ga0207652_10012377 3300025921 Bacteria 6893
306 Ga0207652_10013296 3300025921 Bacteria 6666
307 Ga0207652_10045818 3300025921 Bacteria 3729
308 Ga0207681_10041681 3300025923 Unclassified 3062
309 Ga0207681_10074594 3300025923 Bacteria 2377
310 Ga0207681_10118563 3300025923 Bacteria 1937
311 Ga0207650_10001801 3300025925 Bacteria 15148
312 Ga0207650_10104653 3300025925 Bacteria 2184
313 Ga0207659_10205528 3300025926 Bacteria 1575
314 Ga0207644_10227341 3300025931 Unclassified 1481
315 Ga0207644_10230021 3300025931 Bacteria 1473
316 Ga0207690_10011949 3300025932 Bacteria 5191
317 Ga0207690_10422864 3300025932 Bacteria 1066
318 Ga0207686_10003456 3300025934 Bacteria 8481
319 Ga0207686_10034775 3300025934 Bacteria 3018
320 Ga0207686_10081082 3300025934 Bacteria 2117
321 Ga0207709_10204344 3300025935 Bacteria 1413
322 Ga0207670_10002984 3300025936 Bacteria 8939
323 Ga0207670_10063835 3300025936 Bacteria 2522
324 Ga0207670_10150298 3300025936 Bacteria 1727
325 Ga0207670_10439754 3300025936 Bacteria 1050
326 Ga0207669_10114196 3300025937 Bacteria 1817
327 Ga0207704_10577594 3300025938 Bacteria 917
328 Ga0207691_10022469 3300025940 Bacteria 5948
329 Ga0207691_10077800 3300025940 Bacteria 2987
330 Ga0207691_10080144 3300025940 Bacteria 2937
331 Ga0207691_10109729 3300025940 Bacteria 2455
332 Ga0207691_10230149 3300025940 Bacteria 1605
333 Ga0207691_10298966 3300025940 Bacteria 1383
334 Ga0207689_10017201 3300025942 Bacteria 6120
335 Ga0207689_10075725 3300025942 Bacteria 2766
336 Ga0207689_10106344 3300025942 Bacteria 2305
337 Ga0207661_10003599 3300025944 Bacteria 10777
338 Ga0207661_10027441 3300025944 Bacteria 4349
339 Ga0207661_10180938 3300025944 Bacteria 1841
340 Ga0207661_10311697 3300025944 Bacteria 1413
341 Ga0207679_10003865 3300025945 Bacteria 9285
342 Ga0207679_10013534 3300025945 Bacteria 5347
343 Ga0207679_10469573 3300025945 Unclassified 1118
344 Ga0207679_10714688 3300025945 Unclassified 910
345 Ga0207667_10008192 3300025949 Bacteria 12438
346 Ga0207667_10019824 3300025949 Bacteria 7496
347 Ga0207667_10061274 3300025949 Bacteria 3936
348 Ga0207667_10074628 3300025949 Bacteria 3522
349 Ga0207651_10046140 3300025960 Bacteria 2928
350 Ga0207651_10097800 3300025960 Bacteria 2168
351 Ga0207712_10020602 3300025961 Bacteria 4321
352 Ga0207712_10409289 3300025961 Bacteria 1142
353 Ga0207668_10148953 3300025972 Unclassified 1809
354 Ga0207640_10096929 3300025981 Bacteria 2057
355 Ga0207640_10228730 3300025981 Unclassified 1429
356 Ga0207658_10144488 3300025986 Unclassified 1930
357 Ga0207658_10210245 3300025986 Bacteria 1630
358 Ga0207658_10405389 3300025986 Bacteria 1199
359 Ga0207677_10050133 3300026023 Bacteria 2822
360 Ga0207677_10117285 3300026023 Unclassified 1995
361 Ga0207703_10058537 3300026035 Unclassified 3145
362 Ga0207703_10187349 3300026035 Bacteria 1830
363 Ga0207703_10225216 3300026035 Bacteria 1679
364 Ga0207639_10022974 3300026041 Bacteria 4498
365 Ga0207639_10044182 3300026041 Bacteria 3349
366 Ga0207639_10204362 3300026041 Bacteria 1696
367 Ga0207639_10297088 3300026041 Bacteria 1426
368 Ga0207678_10024803 3300026067 Bacteria 5235
369 Ga0207678_10289852 3300026067 Bacteria 1406
370 Ga0207678_10385159 3300026067 Bacteria 1212
371 Ga0207708_10092872 3300026075 Bacteria 2329
372 Ga0207708_10127009 3300026075 Bacteria 1991
373 Ga0207708_10415591 3300026075 Bacteria 1115
374 Ga0207702_10232510 3300026078 Bacteria 1723
375 Ga0207641_10002920 3300026088 Bacteria 15480
376 Ga0207641_10021557 3300026088 Bacteria 5295
377 Ga0207641_10320694 3300026088 Unclassified 1469
378 Ga0207641_10464306 3300026088 Bacteria 1225
379 Ga0207648_10004806 3300026089 Bacteria 13786
380 Ga0207648_10022369 3300026089 Bacteria 5679
381 Ga0207648_10023604 3300026089 Bacteria 5506
382 Ga0207648_10061650 3300026089 Bacteria 3270
383 Ga0207648_10061825 3300026089 Bacteria 3265
384 Ga0207648_10163150 3300026089 Unclassified 1969
385 Ga0207648_10170527 3300026089 Bacteria 1923
386 Ga0207648_10512379 3300026089 Unclassified 1099
387 Ga0207648_10819044 3300026089 Bacteria 867
388 Ga0207676_10018404 3300026095 Bacteria 5077
389 Ga0207676_10136738 3300026095 Bacteria 2092
390 Ga0207674_10005344 3300026116 Bacteria 15272
391 Ga0207674_10016531 3300026116 Bacteria 8072
392 Ga0207674_10034469 3300026116 Bacteria 5290
393 Ga0207674_10038081 3300026116 Bacteria 4997
394 Ga0207674_10179244 3300026116 Bacteria 2070
395 Ga0207675_100009593 3300026118 Bacteria 9055
396 Ga0207675_100026873 3300026118 Bacteria 5357
397 Ga0207675_100044562 3300026118 Bacteria 4146
398 Ga0207675_100151711 3300026118 Bacteria 2206
399 Ga0207675_100217955 3300026118 Bacteria 1838
400 Ga0207683_10003170 3300026121 Bacteria 14356
401 Ga0207698_10032411 3300026142 Bacteria 3785
402 Ga0207698_10111397 3300026142 Bacteria 2294
403 Ga0207698_10293410 3300026142 Bacteria 1510
404 Ga0207698_10345684 3300026142 Bacteria 1403
405 Ga0207698_10362117 3300026142 Unclassified 1374
406 Ga0207698_10511463 3300026142 Bacteria 1170
407 Ga0209968_1016343 3300027526 Bacteria 1179
408 Ga0207428_10120042 3300027907 Unclassified 2016
409 Ga0268266_10082436 3300028379 Bacteria 2806
410 Ga0268266_10086241 3300028379 Unclassified 2745
411 Ga0268266_10309163 3300028379 Bacteria 1476
412 Ga0268266_10502234 3300028379 Bacteria 1158
413 Ga0268265_10163329 3300028380 Bacteria 1895
414 Ga0268264_10025339 3300028381 Bacteria 4846
415 Ga0268264_10035319 3300028381 Bacteria 4115
416 Ga0268264_10127202 3300028381 Bacteria 2254
417 Ga0268264_10162897 3300028381 Bacteria 2011
418 Ga0268264_10255947 3300028381 Bacteria 1628
419 Ga0268264_10436220 3300028381 Bacteria 1266
420 Ga0265334_10000048 3300028573 Bacteria 90958
421 Ga0307410_10290061 3300031852 Unclassified 1287
422 Ga0307414_10498216 3300032004 Bacteria 1077
423 Ga0307411_10052480 3300032005 Bacteria 2666
424 Ga0373955_0097782 3300035172 Bacteria 1681
425 Ga0373935_0098835 3300035692 Bacteria 1921
426 Ga0373933_0105474 3300035724 Bacteria 1753
427 Ga0373937_0005507 3300036401 Bacteria 10852
428 Ga0395899_0026414 3300037312 Bacteria 4382
429 Ga0395899_0092819 3300037312 Bacteria 2185
430 Ga0395899_0136334 3300037312 Bacteria 1749
431 Ga0395899_0141762 3300037312 Unclassified 1709
432 Ga0395900_0111945 3300037418 Bacteria 2803
433 Ga0395900_0135783 3300037418 Bacteria 2520
434 Ga0395900_0166048 3300037418 Bacteria 2249
435 Ga0395898_0009166 3300037466 Bacteria 10424
436 Ga0395898_0035959 3300037466 Bacteria 4922
437 Ga0395898_0052946 3300037466 Bacteria 3964
438 Ga0395905_0000227 3300037471 Bacteria 85540
439 Ga0395905_0014814 3300037471 Bacteria 7434
440 Ga0395905_0046101 3300037471 Bacteria 4088
441 Ga0395901_0004587 3300038443 Bacteria 13950
442 Ga0395901_0025750 3300038443 Bacteria 6039
443 Ga0395901_0027407 3300038443 Bacteria 5854
444 Ga0395901_0459416 3300038443 Bacteria 1301
445 Ga0439445_0037131 3300042004 Bacteria 1284
446 Ga0451577_0007735 3300042876 Bacteria 10535
447 Ga0453684_0098268 3300044712 Bacteria 3590
448 Ga0495592_0095908 3300046454 Bacteria 2120
449 Ga0495653_0159712 3300046463 Bacteria 1566
450 Ga0495650_0031645 3300046471 Bacteria 2377
451 Ga0495580_0061210 3300046472 Bacteria 2644
452 Ga0495594_0193529 3300046499 Bacteria 1159
453 Ga0495628_0104298 3300046516 Bacteria 2185
454 Ga0495586_0040963 3300046535 Bacteria 2494
455 Ga0495621_0026333 3300046539 Bacteria 1961
456 Ga0495668_0000242 3300046616 Bacteria 78022
457 Ga0495668_0000685 3300046616 Bacteria 40831
458 Ga0495634_0069216 3300046642 Bacteria 2329
459 Ga0495675_0122135 3300047444 Bacteria 1622
460 Ga0495686_0031982 3300047472 Unclassified 3408
461 Ga0496104_0341595 3300048907 Bacteria 1410
462 Ga0496104_0589675 3300048907 Bacteria 1022
463 Ga0496108_0118155 3300048911 Unclassified 2273
464 Ga0501296_012174 3300049519 Bacteria 1035
465 Ga0501032_0512309 3300049569 Bacteria 766
466 Ga0501034_0044253 3300049571 Bacteria 4503
467 Ga0501034_0155267 3300049571 Bacteria 2263
468 Ga0501034_0199069 3300049571 Bacteria 1962
469 Ga0501034_0232479 3300049571 Bacteria 1792
470 Ga0501036_0055758 3300049572 Bacteria 3348
471 Ga0501037_0014409 3300049573 Bacteria 5820
472 Ga0501038_0006563 3300049574 Bacteria 10762
473 Ga0501039_0111993 3300049575 Unclassified 2133
474 Ga0501039_0252340 3300049575 Bacteria 1387
475 Ga0501046_0109408 3300049580 Bacteria 2113
476 Ga0501047_0003724 3300049581 Bacteria 14356
477 Ga0501206_001139 3300049653 Bacteria 3308
478 Ga0501217_071112 3300049661 Unclassified 947
479 Ga0501222_000646 3300049662 Bacteria 5102
480 Ga0501223_000935 3300049663 Bacteria 6901
481 Ga0501228_003838 3300049666 Bacteria 1261
482 Ga0501233_010396 3300049668 Bacteria 1832
483 Ga0501235_016063 3300049669 Bacteria 1652
484 Ga0501240_008256 3300049673 Bacteria 1331
485 Ga0501242_007587 3300049674 Bacteria 1254
486 Ga0501250_016633 3300049680 Bacteria 915
487 Ga0501251_006530 3300049681 Bacteria 1272
488 Ga0501252_001171 3300049682 Bacteria 2346
489 Ga0501257_009505 3300049686 Bacteria 2197
490 Ga0501257_014788 3300049686 Bacteria 1800
491 Ga0501259_007118 3300049688 Bacteria 1789
492 Ga0501261_000271 3300049690 Bacteria 7121
493 Ga0501221_001058 3300049704 Bacteria 4526
494 Ga0501225_0002649 3300049705 Bacteria 5500
495 Ga0501225_0019457 3300049705 Bacteria 1879
496 Ga0501234_005374 3300049707 Bacteria 2006
497 Ga0501245_006541 3300049708 Bacteria 1632
498 Ga0501245_017813 3300049708 Bacteria 1087
499 Ga0501079_0399332 3300049741 Bacteria 1078
500 Ga0501080_0038355 3300049742 Bacteria 4473
501 Ga0501266_004442 3300049763 Bacteria 1735
502 Ga0501274_009569 3300049771 Bacteria 883
503 Ga0501035_0016649 3300049822 Bacteria 6778
504 Ga0501035_0052872 3300049822 Bacteria 3634
505 Ga0501044_0004978 3300049823 Bacteria 14860
506 Ga0501044_0080670 3300049823 Unclassified 3295
507 Ga0501044_0145521 3300049823 Bacteria 2356
508 Ga0501212_007447 3300049851 Bacteria 1500
509 nmdc:mga0k408_258459_c1 3300050493 Unclassified 1040
510 nmdc:mga05p37_88318_c1 3300050507 Bacteria 3821
511 nmdc:mga09592_176700_c1 3300050508 Bacteria 1847
512 nmdc:mga09592_65995_c1 3300050508 Bacteria 3067
513 nmdc:mga0qj67_106017_c1 3300050509 Bacteria 2268
514 nmdc:mga06r32_184296_c1 3300050510 Bacteria 2074
515 nmdc:mga08y16_110142_c1 3300050511 Bacteria 2867
516 nmdc:mga08y16_163561_c1 3300050511 Bacteria 2312
517 nmdc:mga08y16_197670_c1 3300050511 Unclassified 2084
518 nmdc:mga0n895_309135_c1 3300050512 Bacteria 1602
519 Ga0495619_0071450 3300053085 Bacteria 2323
520 Ga0500559_0056313 3300053136 Bacteria 1745
521 Ga0500568_0001221 3300053139 Bacteria 17154
522 Ga0501082_0177370 3300060353 Bacteria 1853
523 2883070663 2883068021 Bacteria 6192739
524 JGI25152J39213_1000064
525 JGI25150J39212_1000004
526 JGI25151J46595_10000002
527 JGI25153J46596_10000037
528 Ga0065704_10229283
529 Ga0065712_10009488
530 Ga0065712_10091879
531 Ga0065715_10118640
532 Ga0065715_10123516
533 Ga0065707_10107814
534 Ga0070658_10004224
535 Ga0070658_10019089
536 Ga0070658_10413121
537 Ga0070676_10008581
538 Ga0070676_10014369
539 Ga0070676_10114959
540 Ga0070683_100005747
541 Ga0070683_100028295
542 Ga0070683_100480960
543 Ga0070683_100762382
544 Ga0070690_100178441
545 Ga0070690_100250830
546 Ga0070670_100004771
547 Ga0070670_100067137
548 Ga0070677_10041136
549 Ga0070677_10109449
550 Ga0068869_100030122
551 Ga0068869_100070696
552 Ga0070666_10041522
553 Ga0070680_100006655
554 Ga0070680_100094930
555 Ga0070682_100053729
556 Ga0068868_100013209
557 Ga0068868_100043175
558 Ga0068868_100146630
559 Ga0070660_100001312
560 Ga0070660_100045814
561 Ga0070660_100177412
562 Ga0070689_100033319
563 Ga0070689_100033407
564 Ga0070689_100052596
565 Ga0070689_100485458
566 Ga0070689_100678695
567 Ga0070687_100019005
568 Ga0070687_100069109
569 Ga0070661_100015183
570 Ga0070661_100093504
571 Ga0070661_100351793
572 Ga0070692_10351592
573 Ga0070669_100052838
574 Ga0070669_100062427
575 Ga0070675_100034713
576 Ga0070675_100127278
577 Ga0070675_100248073
578 Ga0070675_100266444
579 Ga0070671_100353865
580 Ga0070674_100166248
581 Ga0070674_100206359
582 Ga0070673_100045673
583 Ga0070688_100009106
584 Ga0070688_100010539
585 Ga0070688_100066760
586 Ga0070659_100010918
587 Ga0070659_100019979
588 Ga0070659_100112331
589 Ga0070667_100006213
590 Ga0070667_100057636
591 Ga0070667_100071590
592 Ga0070667_100132993
593 Ga0070667_100212103
594 Ga0070667_100379326
595 Ga0070700_100402097
596 Ga0070663_100093549
597 Ga0070663_100133782
598 Ga0070678_100184839
599 Ga0070678_100327079
600 Ga0070678_100408189
601 Ga0070662_100083910
602 Ga0070681_10026327
603 Ga0070681_10071007
604 Ga0070681_10098241
605 Ga0070681_10226177
606 Ga0068867_100129219
607 Ga0068867_100134412
608 Ga0068867_100318234
609 Ga0068867_100459759
610 Ga0068867_100536108
611 Ga0068867_100707842
612 Ga0068867_100748377
613 Ga0070685_10017187
614 Ga0070698_100003794
615 Ga0070698_100009599
616 Ga0070698_100033708
617 Ga0070699_100129401
618 Ga0070679_100034898
619 Ga0070679_100094210
620 Ga0070684_100000465
621 Ga0070684_100004469
622 Ga0070684_100022349
623 Ga0070684_100221718
624 Ga0068853_100013989
625 Ga0068853_100026629
626 Ga0068853_100032392
627 Ga0068853_100054770
628 Ga0068853_100120986
629 Ga0068853_100255336
630 Ga0070672_100025529
631 Ga0070672_100071703
632 Ga0070672_100118766
633 Ga0070686_100006502
634 Ga0070665_100075917
635 Ga0070665_100128733
636 Ga0070704_100178602
637 Ga0068855_100006466
638 Ga0068855_100010988
639 Ga0068855_100067413
640 Ga0068855_100139137
641 Ga0068855_100200409
642 Ga0068855_100312553
643 Ga0068855_100388802
644 Ga0070664_100001035
645 Ga0070664_100001670
646 Ga0070664_100015359
647 Ga0070664_100287531
648 Ga0068857_100018971
649 Ga0068857_100022098
650 Ga0068857_100156423
651 Ga0068857_100221633
652 Ga0068854_100040234
653 Ga0068854_100074697
654 Ga0068854_100227708
655 Ga0068856_100146444
656 Ga0068856_100150396
657 Ga0070702_100176494
658 Ga0068852_100000346
659 Ga0068852_100013623
660 Ga0068852_100058759
661 Ga0068852_100266099
662 Ga0068852_100329604
663 Ga0068859_100068123
664 Ga0068859_100094887
665 Ga0068859_100265516
666 Ga0068859_100322166
667 Ga0068859_100565566
668 Ga0068864_100048426
669 Ga0068866_10282671
670 Ga0068861_100002986
671 Ga0068861_100037888
672 Ga0068861_100089678
673 Ga0068851_10093526
674 Ga0068851_10302387
675 Ga0068870_10002531
676 Ga0068870_10019073
677 Ga0068870_10077310
678 Ga0068870_10096390
679 Ga0068863_100013093
680 Ga0068863_100063398
681 Ga0068858_100031488
682 Ga0068858_100430257
683 Ga0068860_100015379
684 Ga0068860_100034632
685 Ga0068860_100046063
686 Ga0068860_100141347
687 Ga0068862_100134197
688 Ga0068862_100264864
689 Ga0097621_100046703
690 Ga0097621_100113392
691 Ga0097621_100434718
692 Ga0068871_100094765
693 Ga0068871_100385180
694 Ga0075428_100006377
695 Ga0075428_100011755
696 Ga0075428_100043479
697 Ga0075428_100266216
698 Ga0075430_100023369
699 Ga0075431_100574263
700 Ga0075434_100320258
701 Ga0075429_100001087
702 Ga0075429_100316316
703 Ga0097620_100068123
704 Ga0097620_100094894
705 Ga0097620_100150103
706 Ga0097620_100265536
707 Ga0097620_100322174
708 Ga0097620_100565560
709 Ga0105240_10017744
710 Ga0111539_10039549
711 Ga0114129_10206190
712 Ga0105243_10273616
713 Ga0105243_10368528
714 Ga0105241_10007003
715 Ga0105242_10008177
716 Ga0105242_10058530
717 Ga0105248_10156977
718 Ga0105248_10725935
719 Ga0105237_10079889
720 Ga0105249_10006541
721 Ga0105249_10008926
722 Ga0105249_10192968
723 Ga0105249_10347528
724 Ga0105239_10642565
725 Ga0157373_10018059
726 Ga0157373_10023446
727 Ga0157373_10027586
728 Ga0157373_10037411
729 Ga0157373_10063728
730 Ga0157373_10134238
731 Ga0157371_10001134
732 Ga0157371_10002769
733 Ga0157371_10003497
734 Ga0157371_10019924
735 Ga0157371_10028693
736 Ga0157371_10044245
737 Ga0157371_10087762
738 Ga0157371_10139078
739 Ga0157371_10241035
740 Ga0157370_10000473
741 Ga0157370_10001371
742 Ga0157370_10004859
743 Ga0157370_10152402
744 Ga0157370_10250762
745 Ga0157370_10301841
746 Ga0157369_10028123
747 Ga0157369_10052694
748 Ga0157369_10067274
749 Ga0157369_10169118
750 Ga0157369_10450990
751 Ga0157374_10000260
752 Ga0157374_10242503
753 Ga0157374_10644396
754 Ga0157378_10013101
755 Ga0157378_10040577
756 Ga0157378_10329509
757 Ga0157378_10360189
758 Ga0163162_10001051
759 Ga0163162_10007331
760 Ga0163162_10066982
761 Ga0163162_10110017
762 Ga0163162_10135968
763 Ga0163162_10676013
764 Ga0157372_10018515
765 Ga0157372_10029760
766 Ga0157372_10035972
767 Ga0157372_10162876
768 Ga0157372_10163319
769 Ga0157372_10183987
770 Ga0157372_10201445
771 Ga0157372_10259631
772 Ga0157372_10508537
773 Ga0157372_10674438
774 Ga0157375_10064780
775 Ga0157375_10256504
776 Ga0157375_10921959
777 Ga0163163_10000279
778 Ga0163163_10032149
779 Ga0163163_10156573
780 Ga0163163_10158595
781 Ga0163163_10230700
782 Ga0163163_10632356
783 Ga0163163_10810756
784 Ga0157380_10000947
785 Ga0157380_10091927
786 Ga0157380_10109653
787 Ga0157380_10250719
788 Ga0157380_10701076
789 Ga0157377_10004609
790 Ga0157377_10053520
791 Ga0157377_10206928
792 Ga0157379_10059902
793 Ga0157379_10196432
794 Ga0157376_10145571
795 Ga0157376_10159995
796 Ga0163161_10289921
797 Ga0207425_1000003
798 Ga0209129_1000022
799 Ga0209025_1000007
800 Ga0209758_1000012
801 Ga0207697_10045649
802 Ga0207656_10048245
803 Ga0207682_10101197
804 Ga0207688_10001577
805 Ga0207680_10082596
806 Ga0207680_10128895
807 Ga0207647_10000017
808 Ga0207647_10324127
809 Ga0207645_10003668
810 Ga0207645_10034704
811 Ga0207643_10005651
812 Ga0207705_10002621
813 Ga0207705_10027556
814 Ga0207705_10046523
815 Ga0207654_10059280
816 Ga0207707_10078398
817 Ga0207695_10013243
818 Ga0207671_10053910
819 Ga0207660_10009405
820 Ga0207660_10213824
821 Ga0207662_10085549
822 Ga0207657_10001601
823 Ga0207657_10049561
824 Ga0207657_10055990
825 Ga0207657_10227557
826 Ga0207649_10009081
827 Ga0207652_10000611
828 Ga0207652_10012377
829 Ga0207652_10013296
830 Ga0207652_10045818
831 Ga0207681_10041681
832 Ga0207681_10074594
833 Ga0207681_10118563
834 Ga0207650_10001801
835 Ga0207650_10104653
836 Ga0207659_10205528
837 Ga0207644_10227341
838 Ga0207644_10230021
839 Ga0207690_10011949
840 Ga0207690_10422864
841 Ga0207686_10003456
842 Ga0207686_10034775
843 Ga0207686_10081082
844 Ga0207709_10204344
845 Ga0207670_10002984
846 Ga0207670_10063835
847 Ga0207670_10150298
848 Ga0207670_10439754
849 Ga0207669_10114196
850 Ga0207704_10577594
851 Ga0207691_10022469
852 Ga0207691_10077800
853 Ga0207691_10080144
854 Ga0207691_10109729
855 Ga0207691_10230149
856 Ga0207691_10298966
857 Ga0207689_10017201
858 Ga0207689_10075725
859 Ga0207689_10106344
860 Ga0207661_10003599
861 Ga0207661_10027441
862 Ga0207661_10180938
863 Ga0207661_10311697
864 Ga0207679_10003865
865 Ga0207679_10013534
866 Ga0207679_10469573
867 Ga0207679_10714688
868 Ga0207667_10008192
869 Ga0207667_10019824
870 Ga0207667_10061274
871 Ga0207667_10074628
872 Ga0207651_10046140
873 Ga0207651_10097800
874 Ga0207712_10020602
875 Ga0207712_10409289
876 Ga0207668_10148953
877 Ga0207640_10096929
878 Ga0207640_10228730
879 Ga0207658_10144488
880 Ga0207658_10210245
881 Ga0207658_10405389
882 Ga0207677_10050133
883 Ga0207677_10117285
884 Ga0207703_10058537
885 Ga0207703_10187349
886 Ga0207703_10225216
887 Ga0207639_10022974
888 Ga0207639_10044182
889 Ga0207639_10204362
890 Ga0207639_10297088
891 Ga0207678_10024803
892 Ga0207678_10289852
893 Ga0207678_10385159
894 Ga0207708_10092872
895 Ga0207708_10127009
896 Ga0207708_10415591
897 Ga0207702_10232510
898 Ga0207641_10002920
899 Ga0207641_10021557
900 Ga0207641_10320694
901 Ga0207641_10464306
902 Ga0207648_10004806
903 Ga0207648_10022369
904 Ga0207648_10023604
905 Ga0207648_10061650
906 Ga0207648_10061825
907 Ga0207648_10163150
908 Ga0207648_10170527
909 Ga0207648_10512379
910 Ga0207648_10819044
911 Ga0207676_10018404
912 Ga0207676_10136738
913 Ga0207674_10005344
914 Ga0207674_10016531
915 Ga0207674_10034469
916 Ga0207674_10038081
917 Ga0207674_10179244
918 Ga0207675_100009593
919 Ga0207675_100026873
920 Ga0207675_100044562
921 Ga0207675_100151711
922 Ga0207675_100217955
923 Ga0207683_10003170
924 Ga0207698_10032411
925 Ga0207698_10111397
926 Ga0207698_10293410
927 Ga0207698_10345684
928 Ga0207698_10362117
929 Ga0207698_10511463
930 Ga0209968_1016343
931 Ga0207428_10120042
932 Ga0268266_10082436
933 Ga0268266_10086241
934 Ga0268266_10309163
935 Ga0268266_10502234
936 Ga0268265_10163329
937 Ga0268264_10025339
938 Ga0268264_10035319
939 Ga0268264_10127202
940 Ga0268264_10162897
941 Ga0268264_10255947
942 Ga0268264_10436220
943 Ga0265334_10000048
944 Ga0307410_10290061
945 Ga0307414_10498216
946 Ga0307411_10052480
947 Ga0373955_0097782
948 Ga0373935_0098835
949 Ga0373933_0105474
950 Ga0373937_0005507
951 Ga0395899_0026414
952 Ga0395899_0092819
953 Ga0395899_0136334
954 Ga0395899_0141762
955 Ga0395900_0111945
956 Ga0395900_0135783
957 Ga0395900_0166048
958 Ga0395898_0009166
959 Ga0395898_0035959
960 Ga0395898_0052946
961 Ga0395905_0000227
962 Ga0395905_0014814
963 Ga0395905_0046101
964 Ga0395901_0004587
965 Ga0395901_0025750
966 Ga0395901_0027407
967 Ga0395901_0459416
968 Ga0439445_0037131
969 Ga0451577_0007735
970 Ga0453684_0098268
971 Ga0495592_0095908
972 Ga0495653_0159712
973 Ga0495650_0031645
974 Ga0495580_0061210
975 Ga0495594_0193529
976 Ga0495628_0104298
977 Ga0495586_0040963
978 Ga0495621_0026333
979 Ga0495668_0000242
980 Ga0495668_0000685
981 Ga0495634_0069216
982 Ga0495675_0122135
983 Ga0495686_0031982
984 Ga0496104_0341595
985 Ga0496104_0589675
986 Ga0496108_0118155
987 Ga0501296_012174
988 Ga0501032_0512309
989 Ga0501034_0044253
990 Ga0501034_0155267
991 Ga0501034_0199069
992 Ga0501034_0232479
993 Ga0501036_0055758
994 Ga0501037_0014409
995 Ga0501038_0006563
996 Ga0501039_0111993
997 Ga0501039_0252340
998 Ga0501046_0109408
999 Ga0501047_0003724
1000 Ga0501206_001139
1001 Ga0501217_071112
1002 Ga0501222_000646
1003 Ga0501223_000935
1004 Ga0501228_003838
1005 Ga0501233_010396
1006 Ga0501235_016063
1007 Ga0501240_008256
1008 Ga0501242_007587
1009 Ga0501250_016633
1010 Ga0501251_006530
1011 Ga0501252_001171
1012 Ga0501257_009505
1013 Ga0501257_014788
1014 Ga0501259_007118
1015 Ga0501261_000271
1016 Ga0501221_001058
1017 Ga0501225_0002649
1018 Ga0501225_0019457
1019 Ga0501234_005374
1020 Ga0501245_006541
1021 Ga0501245_017813
1022 Ga0501079_0399332
1023 Ga0501080_0038355
1024 Ga0501266_004442
1025 Ga0501274_009569
1026 Ga0501035_0016649
1027 Ga0501035_0052872
1028 Ga0501044_0004978
1029 Ga0501044_0080670
1030 Ga0501044_0145521
1031 Ga0501212_007447
1032 nmdc:mga0k408_258459_c1
1033 nmdc:mga05p37_88318_c1
1034 nmdc:mga09592_176700_c1
1035 nmdc:mga09592_65995_c1
1036 nmdc:mga0qj67_106017_c1
1037 nmdc:mga06r32_184296_c1
1038 nmdc:mga08y16_110142_c1
1039 nmdc:mga08y16_163561_c1
1040 nmdc:mga08y16_197670_c1
1041 nmdc:mga0n895_309135_c1
1042 Ga0495619_0071450
1043 Ga0500559_0056313
1044 Ga0500568_0001221
1045 Ga0501082_0177370
1046 2883070663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

45

239

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.4447 50 237
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.4301 43 237
4pyp-assembly1.cif.gz_A crystal structure of the human glucose transporter glut1 0.3977 32 233
7bc7-assembly1.cif.gz_A cryo-em structure of the proton coupled folate transporter at ph 6.0 bound to pemetrexed 0.3953 25 242
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.3893 37 244
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8547 46 238 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8425 46 238 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.709 46 237 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6681 46 237 1.20.1250.20
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5068 45 241 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4V1SLE6-F1-model_v4 TerC family protein 0.9617 33 270 GO:0016020
AF-A0A4V1SLE6-F1-model_v4 TerC family protein 0.9499 33 270 GO:0016020
AF-A0A1A9I5N4-F1-model_v4 Tellurium resistance protein TerC 0.9478 33 293 GO:0016020
AF-A0A1V2F090-F1-model_v4 deleted 0.9281 33 278
AF-A0A378BUS0-F1-model_v4 Magnesium and cobalt efflux protein CorC 0.9271 33 278 GO:0005886

Map