F458931

General Info

Members Datasets Scaffolds Average Seq Length
523 252 506 223

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10068728|Ga0065712_100687283
Length 259
Sequence MCGCADLQMCRCADEGILMGRFLFRGVKFVNKMAVNTEKYREIIEELSATNTTLVAVSKTKPVADIKEMYELGQKDFGENYVQELVEKQAQLPTDIRWHFIGHLQSNKVKYIAPFISLIQGVDSLKLLYEINKQAIKNNRIIDCLLQVHIAQEETKFGMDETELTDAIIRSFQMANVRICGLMGMASFTENMSKVRSEFRYLKALFDKHCQHPTANVQPETLKLKLQTLSIGMSSDYKIAIEEGSTMVRIGSLLFGERN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
11 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
12 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
13 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
14 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
15 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
24 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
234 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
252 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 0
Rhizoplane 0.38
Rhizosphere 90.06
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_595418 2162886007 Bacteria 1684
2 JGI24740J21852_10018636 3300001979 Bacteria 2456
3 JGI24739J22299_10038584 3300001989 Bacteria 1604
4 JGI24737J22298_10000123 3300001990 Bacteria 23564
5 JGI24735J21928_10000006 3300002067 Bacteria 339303
6 JGI25162J39368_1001073 3300002737 Bacteria 16670
7 JGI25162J39368_1001400 3300002737 Bacteria 13179
8 JGI25158J39367_1011228 3300002739 Bacteria 1198
9 JGI25164J39214_1001966 3300002772 Bacteria 3726
10 JGI25165J46597_1000620 3300003214 Bacteria 29837
11 JGI25165J46597_1003427 3300003214 Bacteria 3969
12 rootH1_10192503 3300003316 Bacteria 2298
13 rootH2_10035781 3300003320 Bacteria 10221
14 rootH2_10176895 3300003320 Bacteria 2929
15 rootL2_10028993 3300003322 Bacteria 3630
16 rootL2_10341821 3300003322 Bacteria 2710
17 rootH1_10002605 3300003323 Bacteria 51064
18 rootH1_10015816 3300003323 Bacteria 5415
19 rootH1_10202097 3300003323 Bacteria 1162
20 Ga0065714_10067074 3300005288 Bacteria 5922
21 Ga0065714_10072859 3300005288 Bacteria 3286
22 Ga0065714_10104315 3300005288 Bacteria 1579
23 Ga0065714_10224926 3300005288 Bacteria 806
24 Ga0065704_10105250 3300005289 Bacteria 2116
25 Ga0065712_10068728 3300005290 Bacteria 9217
26 Ga0070658_10000026 3300005327 Bacteria 171716
27 Ga0070658_10054094 3300005327 Bacteria 3259
28 Ga0070658_10062211 3300005327 Bacteria 3042
29 Ga0070658_10124755 3300005327 Bacteria 2142
30 Ga0070658_10396033 3300005327 Bacteria 1186
31 Ga0070658_10535684 3300005327 Bacteria 1013
32 Ga0070658_10581084 3300005327 Unclassified 970
33 Ga0070676_10000687 3300005328 Bacteria 16592
34 Ga0070683_100224332 3300005329 Bacteria 1786
35 Ga0070683_100389908 3300005329 Bacteria 1328
36 Ga0070690_100203439 3300005330 Bacteria 1379
37 Ga0070670_100825088 3300005331 Bacteria 838
38 Ga0068869_100004743 3300005334 Bacteria 8483
39 Ga0068869_100163380 3300005334 Bacteria 1735
40 Ga0070680_100002202 3300005336 Bacteria 14365
41 Ga0070680_100022839 3300005336 Bacteria 4984
42 Ga0070682_100031038 3300005337 Bacteria 3230
43 Ga0070660_100012635 3300005339 Bacteria 6034
44 Ga0070660_100057129 3300005339 Bacteria 3022
45 Ga0070660_100196616 3300005339 Bacteria 1635
46 Ga0070689_100008355 3300005340 Bacteria 7291
47 Ga0070689_100412753 3300005340 Bacteria 1143
48 Ga0070691_10120352 3300005341 Bacteria 1321
49 Ga0070661_100006279 3300005344 Bacteria 8199
50 Ga0070661_100418863 3300005344 Bacteria 1061
51 Ga0070669_100008945 3300005353 Bacteria 7146
52 Ga0070675_100001853 3300005354 Bacteria 15590
53 Ga0070675_100177896 3300005354 Bacteria 1838
54 Ga0070675_100635356 3300005354 Bacteria 970
55 Ga0070671_100036857 3300005355 Bacteria 4054
56 Ga0070674_100013447 3300005356 Bacteria 5062
57 Ga0070673_100001450 3300005364 Bacteria 13884
58 Ga0070673_100065022 3300005364 Bacteria 2908
59 Ga0070673_100270138 3300005364 Bacteria 1488
60 Ga0070673_100562588 3300005364 Bacteria 1037
61 Ga0070688_100000797 3300005365 Bacteria 15547
62 Ga0070688_100030137 3300005365 Bacteria 3254
63 Ga0070659_100000578 3300005366 Bacteria 26773
64 Ga0070659_100053194 3300005366 Bacteria 3186
65 Ga0070659_100077714 3300005366 Bacteria 2648
66 Ga0070663_100475021 3300005455 Bacteria 1034
67 Ga0070678_100002206 3300005456 Bacteria 10588
68 Ga0070662_100000093 3300005457 Bacteria 49418
69 Ga0070662_100220464 3300005457 Bacteria 1513
70 Ga0070662_100440141 3300005457 Bacteria 1080
71 Ga0070681_10017261 3300005458 Bacteria 7213
72 Ga0070681_10023221 3300005458 Bacteria 6236
73 Ga0070681_10026241 3300005458 Bacteria 5856
74 Ga0070681_10187476 3300005458 Bacteria 1988
75 Ga0070681_10450183 3300005458 Bacteria 1199
76 Ga0068867_100000834 3300005459 Bacteria 20744
77 Ga0068867_100109441 3300005459 Bacteria 2121
78 Ga0068867_100119942 3300005459 Bacteria 2031
79 Ga0070685_10144121 3300005466 Bacteria 1503
80 Ga0070698_100001497 3300005471 Bacteria 25950
81 Ga0070679_100000386 3300005530 Bacteria 37602
82 Ga0070679_100005217 3300005530 Bacteria 12025
83 Ga0070679_100021938 3300005530 Bacteria 6237
84 Ga0070679_100076729 3300005530 Bacteria 3330
85 Ga0070684_100022440 3300005535 Bacteria 5264
86 Ga0068853_100029614 3300005539 Bacteria 4618
87 Ga0068853_100038970 3300005539 Bacteria 4051
88 Ga0068853_100080128 3300005539 Bacteria 2856
89 Ga0068855_100004855 3300005563 Bacteria 16414
90 Ga0068855_100007506 3300005563 Bacteria 13203
91 Ga0068855_100060751 3300005563 Bacteria 4418
92 Ga0070664_100039136 3300005564 Bacteria 3994
93 Ga0068857_100019836 3300005577 Bacteria 5907
94 Ga0068857_100053867 3300005577 Bacteria 3569
95 Ga0068857_100101746 3300005577 Bacteria 2578
96 Ga0068854_100168813 3300005578 Bacteria 1701
97 Ga0068854_100208337 3300005578 Bacteria 1541
98 Ga0068856_100000259 3300005614 Bacteria 57810
99 Ga0068856_100012101 3300005614 Bacteria 8355
100 Ga0068856_100034465 3300005614 Bacteria 4958
101 Ga0068852_100000515 3300005616 Bacteria 25446
102 Ga0068852_100264611 3300005616 Bacteria 1652
103 Ga0068852_100678449 3300005616 Bacteria 1039
104 Ga0068859_100012546 3300005617 Bacteria 8527
105 Ga0068859_100023042 3300005617 Bacteria 6244
106 Ga0068859_100377283 3300005617 Bacteria 1514
107 Ga0068864_100005896 3300005618 Bacteria 10042
108 Ga0068864_100507956 3300005618 Bacteria 1160
109 Ga0068866_10038112 3300005718 Bacteria 2365
110 Ga0068861_100009935 3300005719 Bacteria 6588
111 Ga0068861_100755118 3300005719 Bacteria 909
112 Ga0068851_10122216 3300005834 Bacteria 1400
113 Ga0068870_10010458 3300005840 Bacteria 4267
114 Ga0068870_10226174 3300005840 Bacteria 1148
115 Ga0068863_100097472 3300005841 Bacteria 2792
116 Ga0068863_100307682 3300005841 Bacteria 1538
117 Ga0068863_100590923 3300005841 Bacteria 1098
118 Ga0068858_100073141 3300005842 Bacteria 3182
119 Ga0068860_100044363 3300005843 Bacteria 4238
120 Ga0068860_100149394 3300005843 Bacteria 2249
121 Ga0068862_100014732 3300005844 Bacteria 6493
122 Ga0081539_10000603 3300005985 Bacteria 73114
123 Ga0075366_10003171 3300006195 Bacteria 8611
124 Ga0075366_10049493 3300006195 Bacteria 2494
125 Ga0097621_100002096 3300006237 Bacteria 13664
126 Ga0097621_100409111 3300006237 Bacteria 1216
127 Ga0097621_100573704 3300006237 Bacteria 1029
128 Ga0068871_100000196 3300006358 Bacteria 41550
129 Ga0068865_100000022 3300006881 Bacteria 102976
130 Ga0097620_100012546 3300006931 Bacteria 8527
131 Ga0097620_100023042 3300006931 Bacteria 6244
132 Ga0097620_100377294 3300006931 Bacteria 1514
133 Ga0105240_10000126 3300009093 Bacteria 157403
134 Ga0105240_10000483 3300009093 Bacteria 73606
135 Ga0105240_10013857 3300009093 Bacteria 11041
136 Ga0105240_10102848 3300009093 Bacteria 3471
137 Ga0105240_10108246 3300009093 Bacteria 3368
138 Ga0105240_10177825 3300009093 Bacteria 2514
139 Ga0105240_10422967 3300009093 Bacteria 1496
140 Ga0105240_10429739 3300009093 Bacteria 1482
141 Ga0105240_10605842 3300009093 Bacteria 1205
142 Ga0111539_10001795 3300009094 Bacteria 28548
143 Ga0105245_11165753 3300009098 Bacteria 818
144 Ga0105241_10000238 3300009174 Bacteria 41677
145 Ga0105241_10002650 3300009174 Bacteria 13403
146 Ga0105241_10012901 3300009174 Bacteria 6131
147 Ga0105242_10090238 3300009176 Bacteria 2577
148 Ga0105237_10000233 3300009545 Bacteria 79346
149 Ga0105237_10001823 3300009545 Bacteria 27486
150 Ga0105237_10001999 3300009545 Bacteria 25943
151 Ga0105237_10015729 3300009545 Bacteria 7866
152 Ga0105237_10024963 3300009545 Bacteria 6114
153 Ga0105237_10034237 3300009545 Bacteria 5144
154 Ga0105237_10304891 3300009545 Bacteria 1596
155 Ga0105238_10019326 3300009551 Bacteria 6939
156 Ga0105249_10004091 3300009553 Bacteria 12592
157 Ga0105249_10004874 3300009553 Bacteria 11579
158 Ga0105249_10052674 3300009553 Bacteria 3717
159 Ga0105239_10000005 3300010375 Bacteria 496066
160 Ga0105239_10000255 3300010375 Bacteria 79421
161 Ga0105239_10002186 3300010375 Bacteria 25152
162 Ga0105239_10004534 3300010375 Bacteria 16549
163 Ga0105239_10004850 3300010375 Bacteria 15914
164 Ga0105239_10008725 3300010375 Bacteria 11477
165 Ga0105239_10156860 3300010375 Bacteria 2542
166 Ga0105239_10217779 3300010375 Bacteria 2141
167 Ga0157373_10000484 3300013100 Bacteria 31505
168 Ga0157373_10047722 3300013100 Bacteria 3054
169 Ga0157373_10120570 3300013100 Bacteria 1843
170 Ga0157373_10206628 3300013100 Unclassified 1384
171 Ga0157373_10252046 3300013100 Bacteria 1249
172 Ga0157371_10000618 3300013102 Bacteria 42299
173 Ga0157371_10007069 3300013102 Bacteria 9130
174 Ga0157371_10007112 3300013102 Bacteria 9092
175 Ga0157371_10009843 3300013102 Bacteria 7491
176 Ga0157371_10013529 3300013102 Bacteria 6193
177 Ga0157371_10035047 3300013102 Bacteria 3598
178 Ga0157371_10035586 3300013102 Bacteria 3568
179 Ga0157371_10099263 3300013102 Bacteria 2065
180 Ga0157371_10165855 3300013102 Bacteria 1577
181 Ga0157371_10182863 3300013102 Bacteria 1499
182 Ga0157371_10339658 3300013102 Bacteria 1092
183 Ga0157370_10000242 3300013104 Bacteria 69678
184 Ga0157370_10000457 3300013104 Bacteria 51070
185 Ga0157370_10059458 3300013104 Bacteria 3632
186 Ga0157370_10087309 3300013104 Bacteria 2930
187 Ga0157370_10115092 3300013104 Bacteria 2512
188 Ga0157370_10161242 3300013104 Bacteria 2086
189 Ga0157370_10734677 3300013104 Unclassified 900
190 Ga0157369_10000039 3300013105 Bacteria 188947
191 Ga0157369_10057755 3300013105 Bacteria 4185
192 Ga0157369_10069734 3300013105 Bacteria 3776
193 Ga0157369_10365262 3300013105 Unclassified 1498
194 Ga0157369_10387491 3300013105 Bacteria 1450
195 Ga0157369_10597295 3300013105 Bacteria 1139
196 Ga0157369_10946683 3300013105 Unclassified 883
197 Ga0157374_10001622 3300013296 Bacteria 18852
198 Ga0157374_10003352 3300013296 Bacteria 13449
199 Ga0157374_10013339 3300013296 Bacteria 7173
200 Ga0157374_10393131 3300013296 Bacteria 1382
201 Ga0157378_10020109 3300013297 Bacteria 5871
202 Ga0157378_10031040 3300013297 Bacteria 4719
203 Ga0157378_10054038 3300013297 Bacteria 3576
204 Ga0157378_10158974 3300013297 Bacteria 2112
205 Ga0157378_10206030 3300013297 Bacteria 1863
206 Ga0157378_10216213 3300013297 Bacteria 1820
207 Ga0163162_10000882 3300013306 Bacteria 27892
208 Ga0163162_10011306 3300013306 Bacteria 8703
209 Ga0163162_10012984 3300013306 Bacteria 8127
210 Ga0163162_10056892 3300013306 Bacteria 3938
211 Ga0163162_10167330 3300013306 Bacteria 2322
212 Ga0163162_10280345 3300013306 Bacteria 1799
213 Ga0163162_10820200 3300013306 Bacteria 1047
214 Ga0157372_10000001 3300013307 Bacteria 791349
215 Ga0157372_10000193 3300013307 Bacteria 67258
216 Ga0157372_10015691 3300013307 Bacteria 8123
217 Ga0157372_10032123 3300013307 Bacteria 5753
218 Ga0157372_10105059 3300013307 Bacteria 3230
219 Ga0157372_10320419 3300013307 Bacteria 1805
220 Ga0157372_10477417 3300013307 Bacteria 1453
221 Ga0157372_11045731 3300013307 Eukaryota 945
222 Ga0157375_10044099 3300013308 Bacteria 4329
223 Ga0157375_10048887 3300013308 Bacteria 4141
224 Ga0157375_10129178 3300013308 Bacteria 2645
225 Ga0157375_10972928 3300013308 Bacteria 989
226 Ga0163163_10000577 3300014325 Bacteria 32360
227 Ga0163163_10048321 3300014325 Bacteria 4184
228 Ga0163163_10157767 3300014325 Bacteria 2314
229 Ga0157380_10004288 3300014326 Bacteria 9876
230 Ga0157380_10191010 3300014326 Bacteria 1808
231 Ga0157380_10526524 3300014326 Bacteria 1154
232 Ga0157377_10000903 3300014745 Bacteria 12391
233 Ga0157377_10023077 3300014745 Bacteria 3294
234 Ga0157376_10091000 3300014969 Bacteria 2642
235 Ga0157376_10312718 3300014969 Bacteria 1491
236 Ga0163161_10245568 3300017792 Bacteria 1394
237 Ga0163161_10508955 3300017792 Bacteria 982
238 Ga0213872_10013188 3300021361 Bacteria 3876
239 Ga0209563_113051 3300025230 Bacteria 1110
240 Ga0207427_100106 3300025231 Bacteria 117041
241 Ga0209437_100077 3300025233 Bacteria 286656
242 Ga0209437_100226 3300025233 Bacteria 100303
243 Ga0209026_1006228 3300025250 Bacteria 2981
244 Ga0209129_1009811 3300025258 Bacteria 2467
245 Ga0209233_1000089 3300025261 Bacteria 316381
246 Ga0209233_1024405 3300025261 Bacteria 1513
247 Ga0209455_1002616 3300025272 Bacteria 6840
248 Ga0207656_10032320 3300025321 Bacteria 2173
249 Ga0207688_10049292 3300025901 Bacteria 2354
250 Ga0207647_10000354 3300025904 Bacteria 37206
251 Ga0207647_10174170 3300025904 Bacteria 1252
252 Ga0207647_10181078 3300025904 Bacteria 1224
253 Ga0207645_10000500 3300025907 Bacteria 32432
254 Ga0207643_10238300 3300025908 Bacteria 1118
255 Ga0207705_10000040 3300025909 Bacteria 185735
256 Ga0207705_10052265 3300025909 Bacteria 2941
257 Ga0207705_10079552 3300025909 Bacteria 2387
258 Ga0207705_10285935 3300025909 Bacteria 1263
259 Ga0207705_10399221 3300025909 Bacteria 1063
260 Ga0207654_10000448 3300025911 Bacteria 23559
261 Ga0207654_10016399 3300025911 Bacteria 3858
262 Ga0207654_10060801 3300025911 Bacteria 2208
263 Ga0207654_10065009 3300025911 Bacteria 2146
264 Ga0207707_10042303 3300025912 Bacteria 3977
265 Ga0207707_10075539 3300025912 Bacteria 2940
266 Ga0207707_10232452 3300025912 Bacteria 1604
267 Ga0207695_10000013 3300025913 Bacteria 821265
268 Ga0207695_10000031 3300025913 Bacteria 526801
269 Ga0207695_10019585 3300025913 Bacteria 7787
270 Ga0207695_10090793 3300025913 Bacteria 3069
271 Ga0207695_10172958 3300025913 Bacteria 2084
272 Ga0207695_10253423 3300025913 Bacteria 1659
273 Ga0207695_10263800 3300025913 Bacteria 1619
274 Ga0207695_10419466 3300025913 Bacteria 1222
275 Ga0207695_10486355 3300025913 Bacteria 1116
276 Ga0207695_10582906 3300025913 Bacteria 1000
277 Ga0207671_10001284 3300025914 Bacteria 29519
278 Ga0207671_10006387 3300025914 Bacteria 10508
279 Ga0207671_10012595 3300025914 Bacteria 6793
280 Ga0207671_10065170 3300025914 Bacteria 2709
281 Ga0207671_10175474 3300025914 Bacteria 1666
282 Ga0207671_10342192 3300025914 Bacteria 1185
283 Ga0207660_10021889 3300025917 Bacteria 4303
284 Ga0207660_10345959 3300025917 Bacteria 1191
285 Ga0207657_10052893 3300025919 Bacteria 3522
286 Ga0207657_10112215 3300025919 Bacteria 2250
287 Ga0207649_10172681 3300025920 Bacteria 1507
288 Ga0207652_10000074 3300025921 Bacteria 108397
289 Ga0207652_10000276 3300025921 Bacteria 53325
290 Ga0207652_10116965 3300025921 Bacteria 2369
291 Ga0207652_10144206 3300025921 Bacteria 2130
292 Ga0207652_10181994 3300025921 Bacteria 1889
293 Ga0207652_10193534 3300025921 Bacteria 1829
294 Ga0207652_10392020 3300025921 Bacteria 1253
295 Ga0207694_10008772 3300025924 Bacteria 7628
296 Ga0207694_10026475 3300025924 Bacteria 4412
297 Ga0207659_10026442 3300025926 Bacteria 3915
298 Ga0207659_10322791 3300025926 Bacteria 1274
299 Ga0207644_10311050 3300025931 Bacteria 1272
300 Ga0207690_10001498 3300025932 Bacteria 14585
301 Ga0207690_10021548 3300025932 Bacteria 3998
302 Ga0207690_10195544 3300025932 Bacteria 1532
303 Ga0207706_10000399 3300025933 Bacteria 46832
304 Ga0207706_10205773 3300025933 Bacteria 1726
305 Ga0207706_10250891 3300025933 Bacteria 1546
306 Ga0207686_10031172 3300025934 Bacteria 3164
307 Ga0207670_10022011 3300025936 Bacteria 3942
308 Ga0207669_10031704 3300025937 Bacteria 2957
309 Ga0207704_10000011 3300025938 Bacteria 180140
310 Ga0207689_10020371 3300025942 Bacteria 5582
311 Ga0207661_10186931 3300025944 Bacteria 1814
312 Ga0207661_10287210 3300025944 Bacteria 1471
313 Ga0207661_10315267 3300025944 Bacteria 1405
314 Ga0207679_10006242 3300025945 Bacteria 7521
315 Ga0207667_10009634 3300025949 Bacteria 11362
316 Ga0207667_10053093 3300025949 Bacteria 4265
317 Ga0207667_10155720 3300025949 Bacteria 2351
318 Ga0207667_10803869 3300025949 Bacteria 937
319 Ga0207651_10011439 3300025960 Bacteria 4970
320 Ga0207651_10067622 3300025960 Bacteria 2515
321 Ga0207651_10144764 3300025960 Bacteria 1841
322 Ga0207651_10343196 3300025960 Bacteria 1255
323 Ga0207712_10003852 3300025961 Bacteria 9475
324 Ga0207712_10008432 3300025961 Bacteria 6514
325 Ga0207712_10035013 3300025961 Bacteria 3406
326 Ga0207668_10880056 3300025972 Bacteria 796
327 Ga0207640_10152216 3300025981 Bacteria 1701
328 Ga0207640_10225943 3300025981 Bacteria 1436
329 Ga0207658_10332094 3300025986 Bacteria 1319
330 Ga0207658_10563107 3300025986 Bacteria 1021
331 Ga0207677_10138095 3300026023 Bacteria 1862
332 Ga0207703_10077649 3300026035 Bacteria 2757
333 Ga0207639_10003351 3300026041 Bacteria 10774
334 Ga0207639_10274704 3300026041 Bacteria 1480
335 Ga0207678_10030854 3300026067 Bacteria 4679
336 Ga0207678_10054336 3300026067 Bacteria 3449
337 Ga0207708_10121140 3300026075 Bacteria 2038
338 Ga0207702_10000820 3300026078 Bacteria 32858
339 Ga0207702_10174646 3300026078 Bacteria 1973
340 Ga0207702_10202618 3300026078 Bacteria 1840
341 Ga0207702_10453692 3300026078 Bacteria 1244
342 Ga0207641_10020910 3300026088 Bacteria 5379
343 Ga0207648_10001059 3300026089 Bacteria 30821
344 Ga0207676_10034396 3300026095 Bacteria 3836
345 Ga0207674_10006798 3300026116 Bacteria 13419
346 Ga0207674_10047457 3300026116 Bacteria 4402
347 Ga0207674_10249313 3300026116 Bacteria 1722
348 Ga0207674_10330698 3300026116 Unclassified 1474
349 Ga0207674_10625696 3300026116 Bacteria 1039
350 Ga0207675_100001143 3300026118 Bacteria 26301
351 Ga0207675_100535386 3300026118 Bacteria 1169
352 Ga0207675_101407028 3300026118 Bacteria 718
353 Ga0207683_10005152 3300026121 Bacteria 11224
354 Ga0207698_10062880 3300026142 Bacteria 2901
355 Ga0207698_10189084 3300026142 Bacteria 1832
356 Ga0207698_10478980 3300026142 Bacteria 1207
357 Ga0207698_10611679 3300026142 Bacteria 1075
358 Ga0207428_10052585 3300027907 Bacteria 3251
359 Ga0268265_10003979 3300028380 Bacteria 10413
360 Ga0268264_10092763 3300028381 Bacteria 2607
361 Ga0307517_10001632 3300028786 Bacteria 37097
362 Ga0307515_10178512 3300028794 Bacteria 2084
363 Ga0265338_10103655 3300028800 Bacteria 2310
364 Ga0265327_10008451 3300031251 Bacteria 7661
365 Ga0307516_10035657 3300031730 Bacteria 4987
366 Ga0307516_10489169 3300031730 Bacteria 885
367 Ga0307413_10291597 3300031824 Bacteria 1233
368 Ga0307510_10008290 3300033180 Bacteria 12386
369 Ga0373941_0035242 3300035115 Bacteria 1515
370 Ga0373937_0161140 3300036401 Bacteria 2103
371 Ga0395899_0000002 3300037312 Bacteria 1324310
372 Ga0395899_0000435 3300037312 Bacteria 47985
373 Ga0395899_0006130 3300037312 Bacteria 9319
374 Ga0395899_0011373 3300037312 Bacteria 6817
375 Ga0395899_0025208 3300037312 Bacteria 4490
376 Ga0395899_0047145 3300037312 Bacteria 3208
377 Ga0395899_0097900 3300037312 Bacteria 2120
378 Ga0395899_0148700 3300037312 Bacteria 1661
379 Ga0395900_0000014 3300037418 Bacteria 386513
380 Ga0395900_0000122 3300037418 Bacteria 133423
381 Ga0395900_0007210 3300037418 Bacteria 11521
382 Ga0395900_0010450 3300037418 Bacteria 9493
383 Ga0395900_0018465 3300037418 Bacteria 7112
384 Ga0395900_0064649 3300037418 Bacteria 3759
385 Ga0395900_0456307 3300037418 Bacteria 1233
386 Ga0395900_0548019 3300037418 Bacteria 1101
387 Ga0395898_0001921 3300037466 Bacteria 26459
388 Ga0395898_0033754 3300037466 Bacteria 5104
389 Ga0395898_0084001 3300037466 Bacteria 3069
390 Ga0395898_0171483 3300037466 Bacteria 2074
391 Ga0395898_0378698 3300037466 Bacteria 1350
392 Ga0395898_0559164 3300037466 Bacteria 1086
393 Ga0395905_0000003 3300037471 Bacteria 1347396
394 Ga0395905_0000037 3300037471 Bacteria 261808
395 Ga0395905_0001611 3300037471 Bacteria 26826
396 Ga0395905_0009413 3300037471 Bacteria 9552
397 Ga0395905_0044350 3300037471 Bacteria 4173
398 Ga0395901_0000219 3300038443 Bacteria 71884
399 Ga0395901_0017848 3300038443 Bacteria 7243
400 Ga0395901_0023012 3300038443 Bacteria 6387
401 Ga0395901_0028934 3300038443 Bacteria 5701
402 Ga0395901_0095774 3300038443 Bacteria 3110
403 Ga0395901_0316009 3300038443 Bacteria 1617
404 Ga0436361_0101242 3300039447 Bacteria 5796
405 Ga0439465_0049417 3300041413 Bacteria 1374
406 Ga0451800_1010139 3300041459 Bacteria 1010
407 Ga0439448_0016780 3300042005 Bacteria 2231
408 Ga0439449_0077448 3300042007 Unclassified 1226
409 Ga0450898_003070 3300042134 Bacteria 2369
410 Ga0439434_0016547 3300042435 Bacteria 2204
411 Ga0453683_0214577 3300044673 Bacteria 1223
412 Ga0466966_0005760 3300044684 Bacteria 8158
413 Ga0466959_0284518 3300045049 Bacteria 1134
414 Ga0495592_0046186 3300046454 Bacteria 3247
415 Ga0495638_0219691 3300046460 Bacteria 1063
416 Ga0495651_0314105 3300046462 Bacteria 1047
417 Ga0495650_0000014 3300046471 Bacteria 581606
418 Ga0495585_0000031 3300046492 Bacteria 143899
419 Ga0495596_0037709 3300046500 Bacteria 1911
420 Ga0495583_0055966 3300046506 Bacteria 1781
421 Ga0495583_0205962 3300046506 Bacteria 798
422 Ga0495606_0000020 3300046507 Bacteria 274490
423 Ga0495606_0013375 3300046507 Bacteria 6486
424 Ga0495606_0028415 3300046507 Bacteria 3946
425 Ga0495606_0282461 3300046507 Bacteria 907
426 Ga0495610_0002311 3300046512 Bacteria 16108
427 Ga0495616_0001192 3300046513 Bacteria 18322
428 Ga0495616_0007545 3300046513 Bacteria 6510
429 Ga0495630_0067973 3300046517 Bacteria 2679
430 Ga0495631_0080933 3300046518 Bacteria 1401
431 Ga0495637_0107066 3300046520 Bacteria 1087
432 Ga0495648_0053818 3300046524 Bacteria 2435
433 Ga0495652_0138069 3300046529 Bacteria 1921
434 Ga0495654_0033146 3300046530 Bacteria 2615
435 Ga0495586_0472987 3300046535 Bacteria 723
436 Ga0495609_0033984 3300046538 Bacteria 2313
437 Ga0495622_0077627 3300046557 Bacteria 1530
438 Ga0495633_0000029 3300046558 Bacteria 200381
439 Ga0495668_0000021 3300046616 Bacteria 381308
440 Ga0495668_0000564 3300046616 Bacteria 45569
441 Ga0495668_0000677 3300046616 Bacteria 41080
442 Ga0495634_0052470 3300046642 Bacteria 2733
443 Ga0495611_0025282 3300046648 Bacteria 2587
444 Ga0495625_0000009 3300046660 Bacteria 404954
445 Ga0495625_0000601 3300046660 Bacteria 52410
446 Ga0495625_0000817 3300046660 Bacteria 42929
447 Ga0495625_0007464 3300046660 Bacteria 9509
448 Ga0495625_0019015 3300046660 Bacteria 5345
449 Ga0495625_0194926 3300046660 Bacteria 1340
450 Ga0495661_0005655 3300046665 Bacteria 8860
451 Ga0495661_0005768 3300046665 Bacteria 8758
452 Ga0495671_0035983 3300046692 Bacteria 2511
453 Ga0495649_0000008 3300046694 Bacteria 483706
454 Ga0495589_0034180 3300046794 Bacteria 2553
455 Ga0495600_0155563 3300046809 Bacteria 1479
456 Ga0495672_0017541 3300047320 Bacteria 4786
457 Ga0495672_0018156 3300047320 Bacteria 4681
458 Ga0495687_003643 3300047443 Bacteria 10986
459 Ga0495673_0033660 3300047469 Bacteria 2376
460 Ga0495686_0000194 3300047472 Bacteria 113904
461 Ga0495686_0030063 3300047472 Bacteria 3530
462 Ga0495678_015399 3300049459 Bacteria 3518
463 Ga0501032_0020175 3300049569 Bacteria 4646
464 Ga0501033_0103934 3300049570 Bacteria 2071
465 Ga0501034_0019749 3300049571 Bacteria 6887
466 Ga0501034_0029136 3300049571 Bacteria 5613
467 Ga0501036_0017548 3300049572 Bacteria 5985
468 Ga0501037_0041664 3300049573 Bacteria 3376
469 Ga0501038_0022825 3300049574 Bacteria 5601
470 Ga0501038_0397185 3300049574 Bacteria 1067
471 Ga0501043_0002617 3300049579 Bacteria 15178
472 Ga0501043_0010965 3300049579 Bacteria 7101
473 Ga0501043_0040190 3300049579 Bacteria 3676
474 Ga0501046_0045923 3300049580 Bacteria 3467
475 Ga0501046_0116477 3300049580 Bacteria 2036
476 Ga0501047_0003056 3300049581 Bacteria 15875
477 Ga0501047_0161653 3300049581 Bacteria 2111
478 Ga0501048_0076807 3300049582 Bacteria 2357
479 Ga0501073_0018070 3300049589 Bacteria 5099
480 Ga0501073_0020556 3300049589 Bacteria 4760
481 Ga0501074_0071739 3300049590 Bacteria 2489
482 Ga0501074_0072898 3300049590 Bacteria 2466
483 Ga0501238_007487 3300049671 Bacteria 1421
484 Ga0501261_032602 3300049690 Unclassified 793
485 Ga0501080_0018945 3300049742 Bacteria 6375
486 Ga0501080_0057669 3300049742 Bacteria 3615
487 Ga0501083_0010977 3300049744 Bacteria 6368
488 Ga0501035_0049816 3300049822 Bacteria 3754
489 Ga0501035_0070308 3300049822 Bacteria 3101
490 Ga0501035_0118522 3300049822 Bacteria 2316
491 Ga0501044_0041476 3300049823 Bacteria 4792
492 Ga0501044_0089169 3300049823 Bacteria 3113
493 nmdc:mga0k408_60776_c1 3300050493 Bacteria 2196
494 nmdc:mga0k408_812_c1 3300050493 Bacteria 17211
495 nmdc:mga08y16_9862_c1 3300050511 Bacteria 10028
496 Ga0500635_0001124 3300053080 Bacteria 6398
497 Ga0500556_0011884 3300053104 Bacteria 2589
498 Ga0500608_000637 3300053122 Bacteria 12928
499 Ga0500618_000266 3300053125 Bacteria 40517
500 Ga0500652_148432 3300053131 Bacteria 973
501 Ga0500579_166932 3300053143 Bacteria 909
502 Ga0500616_0005750 3300053153 Bacteria 8338
503 Ga0500622_0111795 3300053156 Bacteria 1334
504 Ga0500624_000576 3300053157 Bacteria 10124
505 Ga0500627_0001690 3300053158 Bacteria 6248
506 Ga0500611_000075 3300053727 Bacteria 39695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0472987 Ga0495586_0472987_130_702 188
2 3300005334 Ga0068869_100004743 Ga0068869_1000047437 193
3 3300005340 Ga0070689_100008355 Ga0070689_1000083557 193
4 3300005344 Ga0070661_100006279 Ga0070661_1000062792 193
5 3300005354 Ga0070675_100177896 Ga0070675_1001778963 193
6 3300005364 Ga0070673_100065022 Ga0070673_1000650222 193
7 3300005365 Ga0070688_100030137 Ga0070688_1000301372 193
8 3300005535 Ga0070684_100022440 Ga0070684_1000224402 193
9 3300005564 Ga0070664_100039136 Ga0070664_1000391365 193
10 3300005577 Ga0068857_100019836 Ga0068857_1000198363 193
11 3300005617 Ga0068859_100377283 Ga0068859_1003772833 193
12 3300005618 Ga0068864_100005896 Ga0068864_1000058962 193
13 3300006931 Ga0097620_100377294 Ga0097620_1003772943 193
14 3300013296 Ga0157374_10013339 Ga0157374_100133392 193
15 3300013306 Ga0163162_10056892 Ga0163162_100568922 193
16 3300013308 Ga0157375_10048887 Ga0157375_100488873 193
17 3300014325 Ga0163163_10000577 Ga0163163_1000057724 193
18 3300014745 Ga0157377_10023077 Ga0157377_100230771 193
19 3300025901 Ga0207688_10049292 Ga0207688_100492921 193
20 3300025904 Ga0207647_10181078 Ga0207647_101810782 193
21 3300025920 Ga0207649_10172681 Ga0207649_101726812 193
22 3300025926 Ga0207659_10322791 Ga0207659_103227912 193
23 3300025936 Ga0207670_10022011 Ga0207670_100220112 193
24 3300025942 Ga0207689_10020371 Ga0207689_100203712 193
25 3300025944 Ga0207661_10287210 Ga0207661_102872102 193
26 3300025945 Ga0207679_10006242 Ga0207679_100062426 193
27 3300025960 Ga0207651_10067622 Ga0207651_100676222 193
28 3300026067 Ga0207678_10030854 Ga0207678_100308543 193
29 3300026095 Ga0207676_10034396 Ga0207676_100343962 193
30 3300026116 Ga0207674_10006798 Ga0207674_100067984 193
31 3300053143 Ga0500579_166932 Ga0500579_166932_28_654 196
32 3300046518 Ga0495631_0080933 Ga0495631_0080933_750_1385 197
33 3300044684 Ga0466966_0005760 Ga0466966_0005760_4732_5364 198
34 3300005455 Ga0070663_100475021 Ga0070663_1004750211 199
35 3300013105 Ga0157369_10069734 Ga0157369_100697342 199
36 3300013307 Ga0157372_10015691 Ga0157372_100156918 199
37 3300037418 Ga0395900_0548019 Ga0395900_0548019_192_875 199
38 3300001979 JGI24740J21852_10018636 JGI24740J21852_100186364 200
39 3300005331 Ga0070670_100825088 Ga0070670_1008250881 201
40 3300014325 Ga0163163_10157767 Ga0163163_101577672 201
41 3300013297 Ga0157378_10020109 Ga0157378_100201093 202
42 3300049569 Ga0501032_0020175 Ga0501032_0020175_3931_4617 203
43 3300049571 Ga0501034_0019749 Ga0501034_0019749_1928_2614 203
44 3300049579 Ga0501043_0002617 Ga0501043_0002617_930_1616 203
45 3300049580 Ga0501046_0045923 Ga0501046_0045923_1104_1790 203
46 3300049581 Ga0501047_0003056 Ga0501047_0003056_12877_13563 203
47 3300049582 Ga0501048_0076807 Ga0501048_0076807_434_1120 203
48 3300049589 Ga0501073_0020556 Ga0501073_0020556_2026_2712 203
49 3300049590 Ga0501074_0071739 Ga0501074_0071739_560_1246 203
50 3300049742 Ga0501080_0057669 Ga0501080_0057669_977_1663 203
51 3300049744 Ga0501083_0010977 Ga0501083_0010977_5242_5928 203
52 3300049822 Ga0501035_0118522 Ga0501035_0118522_333_1019 203
53 3300049823 Ga0501044_0041476 Ga0501044_0041476_300_986 203
54 3300013102 Ga0157371_10035047 Ga0157371_100350472 204
55 3300053122 Ga0500608_000637 Ga0500608_000637_8272_8961 205
56 3300005330 Ga0070690_100203439 Ga0070690_1002034391 206
57 3300042005 Ga0439448_0016780 Ga0439448_0016780_708_1397 206
58 3300005539 Ga0068853_100038970 Ga0068853_1000389701 207
59 3300005614 Ga0068856_100012101 Ga0068856_1000121018 207
60 3300026041 Ga0207639_10003351 Ga0207639_100033516 207
61 3300026078 Ga0207702_10174646 Ga0207702_101746463 207
62 3300005328 Ga0070676_10000687 Ga0070676_100006873 208
63 3300005354 Ga0070675_100635356 Ga0070675_1006353562 208
64 3300005364 Ga0070673_100001450 Ga0070673_10000145013 208
65 3300005456 Ga0070678_100002206 Ga0070678_1000022069 208
66 3300005459 Ga0068867_100000834 Ga0068867_10000083411 208
67 3300005539 Ga0068853_100029614 Ga0068853_1000296143 208
68 3300005616 Ga0068852_100000515 Ga0068852_1000005152 208
69 3300005718 Ga0068866_10038112 Ga0068866_100381123 208
70 3300006237 Ga0097621_100002096 Ga0097621_10000209610 208
71 3300006358 Ga0068871_100000196 Ga0068871_10000019627 208
72 3300006881 Ga0068865_100000022 Ga0068865_10000002274 208
73 3300009174 Ga0105241_10002650 Ga0105241_1000265011 208
74 3300009176 Ga0105242_10090238 Ga0105242_100902382 208
75 3300009545 Ga0105237_10001823 Ga0105237_1000182318 208
76 3300013296 Ga0157374_10001622 Ga0157374_1000162214 208
77 3300013308 Ga0157375_10972928 Ga0157375_109729281 208
78 3300025907 Ga0207645_10000500 Ga0207645_1000050019 208
79 3300025911 Ga0207654_10060801 Ga0207654_100608011 208
80 3300025914 Ga0207671_10065170 Ga0207671_100651702 208
81 3300025924 Ga0207694_10008772 Ga0207694_100087725 208
82 3300025934 Ga0207686_10031172 Ga0207686_100311724 208
83 3300025938 Ga0207704_10000011 Ga0207704_1000001166 208
84 3300025960 Ga0207651_10011439 Ga0207651_100114394 208
85 3300026089 Ga0207648_10001059 Ga0207648_1000105920 208
86 3300026121 Ga0207683_10005152 Ga0207683_100051529 208
87 3300026142 Ga0207698_10062880 Ga0207698_100628803 208
88 3300037471 Ga0395905_0000003 Ga0395905_0000003_291386_292039 208
89 3300049574 Ga0501038_0397185 Ga0501038_0397185_34_675 208
90 3300046665 Ga0495661_0005768 Ga0495661_0005768_6400_7089 209
91 3300013297 Ga0157378_10158974 Ga0157378_101589742 210
92 3300031251 Ga0265327_10008451 Ga0265327_100084514 210
93 3300047320 Ga0495672_0017541 Ga0495672_0017541_1874_2509 210
94 iso_pu_bacteria 2643221667 2644369882 210
95 3300005719 Ga0068861_100755118 Ga0068861_1007551182 211
96 3300013297 Ga0157378_10216213 Ga0157378_102162132 211
97 3300026118 Ga0207675_101407028 Ga0207675_1014070281 211
98 3300031730 Ga0307516_10035657 Ga0307516_100356573 211
99 3300037312 Ga0395899_0097900 Ga0395899_0097900_508_1197 211
100 3300037418 Ga0395900_0064649 Ga0395900_0064649_895_1584 211
101 3300037466 Ga0395898_0171483 Ga0395898_0171483_675_1364 211
102 3300037471 Ga0395905_0001611 Ga0395905_0001611_17789_18478 211
103 3300038443 Ga0395901_0017848 Ga0395901_0017848_3368_4057 211
104 3300046648 Ga0495611_0025282 Ga0495611_0025282_1813_2469 211
105 3300013102 Ga0157371_10035586 Ga0157371_100355862 212
106 3300013104 Ga0157370_10059458 Ga0157370_100594583 212
107 3300013104 Ga0157370_10115092 Ga0157370_101150921 212
108 3300014326 Ga0157380_10526524 Ga0157380_105265243 212
109 3300046460 Ga0495638_0219691 Ga0495638_0219691_239_880 212
110 iso_pu_bacteria 2919437846 2919438781 212
111 3300003323 rootH1_10015816 rootH1_100158166 213
112 3300006237 Ga0097621_100573704 Ga0097621_1005737041 213
113 3300013102 Ga0157371_10007069 Ga0157371_100070695 213
114 3300013105 Ga0157369_10000039 Ga0157369_1000003910 213
115 3300013307 Ga0157372_10000001 Ga0157372_10000001352 213
116 3300013307 Ga0157372_10477417 Ga0157372_104774172 213
117 3300014969 Ga0157376_10312718 Ga0157376_103127182 213
118 3300017792 Ga0163161_10245568 Ga0163161_102455682 213
119 3300037312 Ga0395899_0000435 Ga0395899_0000435_45062_45751 213
120 3300045049 Ga0466959_0284518 Ga0466959_0284518_255_944 213
121 iso_pu_bacteria 2599185184 2599476849 213
122 iso_pu_bacteria 2852623160 2852623694 213
123 iso_pu_bacteria 2884933994 2884937400 213
124 iso_pu_bacteria 2898713307 2898715448 213
125 iso_pu_bacteria 2928078545 2928078757 213
126 iso_pu_bacteria 2928147474 2928151565 213
127 iso_pu_bacteria 2932082852 2932084189 213
128 iso_pu_bacteria 8056440228 8056443923 213
129 3300005288 Ga0065714_10224926 Ga0065714_102249261 214
130 3300005366 Ga0070659_100077714 Ga0070659_1000777142 214
131 3300005458 Ga0070681_10450183 Ga0070681_104501831 214
132 3300005530 Ga0070679_100021938 Ga0070679_1000219384 214
133 3300005563 Ga0068855_100007506 Ga0068855_10000750611 214
134 3300006237 Ga0097621_100409111 Ga0097621_1004091111 214
135 3300013100 Ga0157373_10000484 Ga0157373_100004846 214
136 3300013102 Ga0157371_10000618 Ga0157371_1000061828 214
137 3300013104 Ga0157370_10000242 Ga0157370_1000024237 214
138 3300013104 Ga0157370_10161242 Ga0157370_101612421 214
139 3300013105 Ga0157369_10365262 Ga0157369_103652621 214
140 3300013105 Ga0157369_10597295 Ga0157369_105972951 214
141 3300013307 Ga0157372_10105059 Ga0157372_101050593 214
142 3300025912 Ga0207707_10232452 Ga0207707_102324521 214
143 3300025917 Ga0207660_10345959 Ga0207660_103459592 214
144 3300025921 Ga0207652_10181994 Ga0207652_101819942 214
145 3300025932 Ga0207690_10195544 Ga0207690_101955442 214
146 3300026118 Ga0207675_100535386 Ga0207675_1005353861 214
147 3300037312 Ga0395899_0011373 Ga0395899_0011373_5286_5993 214
148 3300037418 Ga0395900_0456307 Ga0395900_0456307_113_820 214
149 3300037466 Ga0395898_0033754 Ga0395898_0033754_113_820 214
150 3300037466 Ga0395898_0378698 Ga0395898_0378698_104_787 214
151 3300038443 Ga0395901_0095774 Ga0395901_0095774_1350_2057 214
152 3300041413 Ga0439465_0049417 Ga0439465_0049417_591_1238 214
153 3300046507 Ga0495606_0013375 Ga0495606_0013375_3024_3704 214
154 3300046616 Ga0495668_0000564 Ga0495668_0000564_31738_32382 214
155 3300046616 Ga0495668_0000677 Ga0495668_0000677_8901_9572 214
156 3300049690 Ga0501261_032602 Ga0501261_032602_111_782 214
157 3300053104 Ga0500556_0011884 Ga0500556_0011884_1341_2012 214
158 3300053153 Ga0500616_0005750 Ga0500616_0005750_2244_2915 214
159 3300053158 Ga0500627_0001690 Ga0500627_0001690_564_1235 214
160 3300003322 rootL2_10341821 rootL2_103418211 215
161 3300005327 Ga0070658_10535684 Ga0070658_105356841 215
162 3300005340 Ga0070689_100412753 Ga0070689_1004127532 215
163 3300005530 Ga0070679_100000386 Ga0070679_1000003867 215
164 3300005841 Ga0068863_100307682 Ga0068863_1003076821 215
165 3300009093 Ga0105240_10000483 Ga0105240_1000048318 215
166 3300009553 Ga0105249_10052674 Ga0105249_100526742 215
167 3300025913 Ga0207695_10000031 Ga0207695_1000003117 215
168 3300025921 Ga0207652_10000276 Ga0207652_1000027643 215
169 3300025961 Ga0207712_10035013 Ga0207712_100350132 215
170 3300025986 Ga0207658_10563107 Ga0207658_105631071 215
171 3300037312 Ga0395899_0148700 Ga0395899_0148700_617_1303 215
172 3300037418 Ga0395900_0018465 Ga0395900_0018465_2628_3314 215
173 3300037466 Ga0395898_0559164 Ga0395898_0559164_319_1005 215
174 3300038443 Ga0395901_0316009 Ga0395901_0316009_902_1588 215
175 3300002737 JGI25162J39368_1001400 JGI25162J39368_10014009 216
176 3300005288 Ga0065714_10067074 Ga0065714_100670742 216
177 3300005563 Ga0068855_100060751 Ga0068855_1000607511 216
178 3300005578 Ga0068854_100168813 Ga0068854_1001688133 216
179 3300009093 Ga0105240_10422967 Ga0105240_104229672 216
180 3300009545 Ga0105237_10015729 Ga0105237_100157291 216
181 3300009545 Ga0105237_10024963 Ga0105237_100249631 216
182 3300010375 Ga0105239_10004534 Ga0105239_100045349 216
183 3300010375 Ga0105239_10004850 Ga0105239_100048508 216
184 3300013102 Ga0157371_10007112 Ga0157371_100071122 216
185 3300017792 Ga0163161_10508955 Ga0163161_105089552 216
186 3300025233 Ga0209437_100077 Ga0209437_100077150 216
187 3300025258 Ga0209129_1009811 Ga0209129_10098113 216
188 3300025913 Ga0207695_10419466 Ga0207695_104194661 216
189 3300025914 Ga0207671_10006387 Ga0207671_1000638711 216
190 3300025914 Ga0207671_10175474 Ga0207671_101754743 216
191 3300025949 Ga0207667_10053093 Ga0207667_100530934 216
192 3300025981 Ga0207640_10152216 Ga0207640_101522161 216
193 3300028786 Ga0307517_10001632 Ga0307517_1000163216 216
194 3300033180 Ga0307510_10008290 Ga0307510_1000829012 216
195 3300044673 Ga0453683_0214577 Ga0453683_0214577_28_702 216
196 3300046513 Ga0495616_0007545 Ga0495616_0007545_2674_3360 216
197 3300046529 Ga0495652_0138069 Ga0495652_0138069_545_1231 216
198 3300046660 Ga0495625_0019015 Ga0495625_0019015_3981_4667 216
199 3300046660 Ga0495625_0194926 Ga0495625_0194926_220_909 216
200 3300047472 Ga0495686_0000194 Ga0495686_0000194_81954_82640 216
201 3300049459 Ga0495678_015399 Ga0495678_015399_2775_3461 216
202 3300053131 Ga0500652_148432 Ga0500652_148432_104_790 216
203 3300053727 Ga0500611_000075 Ga0500611_000075_11885_12538 216
204 3300001989 JGI24739J22299_10038584 JGI24739J22299_100385842 217
205 3300001990 JGI24737J22298_10000123 JGI24737J22298_100001238 217
206 3300002067 JGI24735J21928_10000006 JGI24735J21928_1000000659 217
207 3300002737 JGI25162J39368_1001073 JGI25162J39368_100107312 217
208 3300002772 JGI25164J39214_1001966 JGI25164J39214_10019663 217
209 3300003214 JGI25165J46597_1000620 JGI25165J46597_100062026 217
210 3300003214 JGI25165J46597_1003427 JGI25165J46597_10034272 217
211 3300003316 rootH1_10192503 rootH1_101925032 217
212 3300003320 rootH2_10035781 rootH2_100357816 217
213 3300003320 rootH2_10176895 rootH2_101768953 217
214 3300003322 rootL2_10028993 rootL2_100289932 217
215 3300003323 rootH1_10002605 rootH1_1000260510 217
216 3300003323 rootH1_10202097 rootH1_102020971 217
217 3300005288 Ga0065714_10072859 Ga0065714_100728593 217
218 3300005288 Ga0065714_10104315 Ga0065714_101043151 217
219 3300005327 Ga0070658_10000026 Ga0070658_10000026127 217
220 3300005327 Ga0070658_10062211 Ga0070658_100622113 217
221 3300005327 Ga0070658_10396033 Ga0070658_103960331 217
222 3300005339 Ga0070660_100012635 Ga0070660_1000126352 217
223 3300005339 Ga0070660_100196616 Ga0070660_1001966162 217
224 3300005341 Ga0070691_10120352 Ga0070691_101203521 217
225 3300005344 Ga0070661_100418863 Ga0070661_1004188631 217
226 3300005356 Ga0070674_100013447 Ga0070674_1000134473 217
227 3300005364 Ga0070673_100270138 Ga0070673_1002701382 217
228 3300005366 Ga0070659_100000578 Ga0070659_10000057824 217
229 3300005457 Ga0070662_100000093 Ga0070662_10000009310 217
230 3300005458 Ga0070681_10017261 Ga0070681_100172613 217
231 3300005458 Ga0070681_10023221 Ga0070681_100232214 217
232 3300005471 Ga0070698_100001497 Ga0070698_10000149721 217
233 3300005539 Ga0068853_100080128 Ga0068853_1000801283 217
234 3300005563 Ga0068855_100004855 Ga0068855_1000048555 217
235 3300005614 Ga0068856_100000259 Ga0068856_10000025942 217
236 3300005614 Ga0068856_100034465 Ga0068856_1000344654 217
237 3300005842 Ga0068858_100073141 Ga0068858_1000731412 217
238 3300006195 Ga0075366_10003171 Ga0075366_100031714 217
239 3300009093 Ga0105240_10000126 Ga0105240_1000012620 217
240 3300009093 Ga0105240_10102848 Ga0105240_101028483 217
241 3300009093 Ga0105240_10108246 Ga0105240_101082463 217
242 3300009093 Ga0105240_10429739 Ga0105240_104297391 217
243 3300009093 Ga0105240_10605842 Ga0105240_106058422 217
244 3300009098 Ga0105245_11165753 Ga0105245_111657531 217
245 3300009174 Ga0105241_10000238 Ga0105241_1000023818 217
246 3300009174 Ga0105241_10012901 Ga0105241_100129017 217
247 3300009545 Ga0105237_10000233 Ga0105237_1000023382 217
248 3300009545 Ga0105237_10001999 Ga0105237_100019992 217
249 3300009545 Ga0105237_10034237 Ga0105237_100342374 217
250 3300009545 Ga0105237_10304891 Ga0105237_103048913 217
251 3300009551 Ga0105238_10019326 Ga0105238_100193263 217
252 3300009553 Ga0105249_10004091 Ga0105249_100040918 217
253 3300010375 Ga0105239_10000005 Ga0105239_10000005378 217
254 3300010375 Ga0105239_10000255 Ga0105239_1000025557 217
255 3300010375 Ga0105239_10002186 Ga0105239_1000218610 217
256 3300010375 Ga0105239_10008725 Ga0105239_100087254 217
257 3300010375 Ga0105239_10217779 Ga0105239_102177791 217
258 3300013100 Ga0157373_10120570 Ga0157373_101205703 217
259 3300013102 Ga0157371_10009843 Ga0157371_100098436 217
260 3300013104 Ga0157370_10087309 Ga0157370_100873091 217
261 3300013105 Ga0157369_10057755 Ga0157369_100577553 217
262 3300013296 Ga0157374_10003352 Ga0157374_1000335212 217
263 3300013297 Ga0157378_10031040 Ga0157378_100310403 217
264 3300013297 Ga0157378_10054038 Ga0157378_100540381 217
265 3300013306 Ga0163162_10000882 Ga0163162_1000088211 217
266 3300013306 Ga0163162_10011306 Ga0163162_100113067 217
267 3300013306 Ga0163162_10012984 Ga0163162_100129848 217
268 3300013306 Ga0163162_10167330 Ga0163162_101673303 217
269 3300013307 Ga0157372_10000193 Ga0157372_100001931 217
270 3300013307 Ga0157372_10320419 Ga0157372_103204193 217
271 3300021361 Ga0213872_10013188 Ga0213872_100131883 217
272 3300025230 Ga0209563_113051 Ga0209563_1130512 217
273 3300025231 Ga0207427_100106 Ga0207427_10010640 217
274 3300025233 Ga0209437_100226 Ga0209437_10022639 217
275 3300025250 Ga0209026_1006228 Ga0209026_10062282 217
276 3300025261 Ga0209233_1000089 Ga0209233_100008939 217
277 3300025261 Ga0209233_1024405 Ga0209233_10244052 217
278 3300025272 Ga0209455_1002616 Ga0209455_10026162 217
279 3300025904 Ga0207647_10000354 Ga0207647_1000035427 217
280 3300025909 Ga0207705_10000040 Ga0207705_1000004010 217
281 3300025909 Ga0207705_10285935 Ga0207705_102859352 217
282 3300025911 Ga0207654_10000448 Ga0207654_1000044819 217
283 3300025911 Ga0207654_10016399 Ga0207654_100163993 217
284 3300025913 Ga0207695_10000013 Ga0207695_10000013342 217
285 3300025913 Ga0207695_10019585 Ga0207695_100195853 217
286 3300025913 Ga0207695_10090793 Ga0207695_100907933 217
287 3300025913 Ga0207695_10172958 Ga0207695_101729582 217
288 3300025913 Ga0207695_10263800 Ga0207695_102638003 217
289 3300025913 Ga0207695_10486355 Ga0207695_104863552 217
290 3300025913 Ga0207695_10582906 Ga0207695_105829062 217
291 3300025914 Ga0207671_10001284 Ga0207671_100012844 217
292 3300025914 Ga0207671_10012595 Ga0207671_100125952 217
293 3300025914 Ga0207671_10342192 Ga0207671_103421922 217
294 3300025919 Ga0207657_10052893 Ga0207657_100528933 217
295 3300025919 Ga0207657_10112215 Ga0207657_101122152 217
296 3300025921 Ga0207652_10116965 Ga0207652_101169653 217
297 3300025924 Ga0207694_10026475 Ga0207694_100264753 217
298 3300025932 Ga0207690_10001498 Ga0207690_100014983 217
299 3300025933 Ga0207706_10000399 Ga0207706_1000039948 217
300 3300025937 Ga0207669_10031704 Ga0207669_100317043 217
301 3300025949 Ga0207667_10009634 Ga0207667_100096345 217
302 3300025949 Ga0207667_10803869 Ga0207667_108038691 217
303 3300025960 Ga0207651_10144764 Ga0207651_101447643 217
304 3300025961 Ga0207712_10003852 Ga0207712_100038526 217
305 3300026035 Ga0207703_10077649 Ga0207703_100776492 217
306 3300026041 Ga0207639_10274704 Ga0207639_102747042 217
307 3300026078 Ga0207702_10000820 Ga0207702_1000082013 217
308 3300026078 Ga0207702_10453692 Ga0207702_104536921 217
309 3300026116 Ga0207674_10625696 Ga0207674_106256961 217
310 3300026142 Ga0207698_10478980 Ga0207698_104789801 217
311 3300028794 Ga0307515_10178512 Ga0307515_101785123 217
312 3300028800 Ga0265338_10103655 Ga0265338_101036553 217
313 3300031824 Ga0307413_10291597 Ga0307413_102915972 217
314 3300035115 Ga0373941_0035242 Ga0373941_0035242_177_866 217
315 3300037312 Ga0395899_0000002 Ga0395899_0000002_913585_914274 217
316 3300037312 Ga0395899_0025208 Ga0395899_0025208_2841_3530 217
317 3300037418 Ga0395900_0000014 Ga0395900_0000014_221855_222544 217
318 3300037418 Ga0395900_0000122 Ga0395900_0000122_10215_10904 217
319 3300037466 Ga0395898_0084001 Ga0395898_0084001_1862_2551 217
320 3300037471 Ga0395905_0000037 Ga0395905_0000037_221845_222534 217
321 3300038443 Ga0395901_0000219 Ga0395901_0000219_30459_31148 217
322 3300039447 Ga0436361_0101242 Ga0436361_0101242_1925_2602 217
323 3300041459 Ga0451800_1010139 Ga0451800_1010139_260_931 217
324 3300046462 Ga0495651_0314105 Ga0495651_0314105_122_811 217
325 3300046471 Ga0495650_0000014 Ga0495650_0000014_556374_557063 217
326 3300046492 Ga0495585_0000031 Ga0495585_0000031_123261_123950 217
327 3300046500 Ga0495596_0037709 Ga0495596_0037709_948_1637 217
328 3300046506 Ga0495583_0055966 Ga0495583_0055966_1015_1704 217
329 3300046506 Ga0495583_0205962 Ga0495583_0205962_50_739 217
330 3300046507 Ga0495606_0000020 Ga0495606_0000020_7561_8250 217
331 3300046507 Ga0495606_0028415 Ga0495606_0028415_396_1085 217
332 3300046507 Ga0495606_0282461 Ga0495606_0282461_87_776 217
333 3300046512 Ga0495610_0002311 Ga0495610_0002311_11011_11700 217
334 3300046513 Ga0495616_0001192 Ga0495616_0001192_13725_14414 217
335 3300046520 Ga0495637_0107066 Ga0495637_0107066_224_913 217
336 3300046524 Ga0495648_0053818 Ga0495648_0053818_1321_2010 217
337 3300046530 Ga0495654_0033146 Ga0495654_0033146_1100_1789 217
338 3300046538 Ga0495609_0033984 Ga0495609_0033984_1334_2023 217
339 3300046557 Ga0495622_0077627 Ga0495622_0077627_532_1221 217
340 3300046558 Ga0495633_0000029 Ga0495633_0000029_33030_33719 217
341 3300046616 Ga0495668_0000021 Ga0495668_0000021_124987_125676 217
342 3300046660 Ga0495625_0000009 Ga0495625_0000009_70956_71645 217
343 3300046660 Ga0495625_0000601 Ga0495625_0000601_15752_16441 217
344 3300046660 Ga0495625_0000817 Ga0495625_0000817_25900_26589 217
345 3300046660 Ga0495625_0007464 Ga0495625_0007464_5197_5886 217
346 3300046665 Ga0495661_0005655 Ga0495661_0005655_5774_6463 217
347 3300046692 Ga0495671_0035983 Ga0495671_0035983_918_1607 217
348 3300046694 Ga0495649_0000008 Ga0495649_0000008_176913_177602 217
349 3300046794 Ga0495589_0034180 Ga0495589_0034180_1278_1967 217
350 3300046809 Ga0495600_0155563 Ga0495600_0155563_254_943 217
351 3300047320 Ga0495672_0018156 Ga0495672_0018156_2827_3492 217
352 3300047443 Ga0495687_003643 Ga0495687_003643_10188_10877 217
353 3300047469 Ga0495673_0033660 Ga0495673_0033660_1538_2227 217
354 3300047472 Ga0495686_0030063 Ga0495686_0030063_2096_2785 217
355 3300049572 Ga0501036_0017548 Ga0501036_0017548_2003_2662 217
356 3300049573 Ga0501037_0041664 Ga0501037_0041664_1000_1659 217
357 3300049574 Ga0501038_0022825 Ga0501038_0022825_1000_1659 217
358 3300049579 Ga0501043_0040190 Ga0501043_0040190_729_1388 217
359 3300049671 Ga0501238_007487 Ga0501238_007487_353_1054 217
360 3300049822 Ga0501035_0049816 Ga0501035_0049816_1442_2101 217
361 3300049822 Ga0501035_0070308 Ga0501035_0070308_2184_2864 217
362 3300049823 Ga0501044_0089169 Ga0501044_0089169_1478_2137 217
363 3300050493 nmdc:mga0k408_812_c1 nmdc:mga0k408_812_c1_4815_5504 217
364 3300053080 Ga0500635_0001124 Ga0500635_0001124_5481_6170 217
365 3300053125 Ga0500618_000266 Ga0500618_000266_807_1496 217
366 3300053156 Ga0500622_0111795 Ga0500622_0111795_458_1147 217
367 3300053157 Ga0500624_000576 Ga0500624_000576_3422_4111 217
368 3300005327 Ga0070658_10581084 Ga0070658_105810842 218
369 3300006195 Ga0075366_10049493 Ga0075366_100494932 218
370 3300009093 Ga0105240_10013857 Ga0105240_1001385711 218
371 3300013100 Ga0157373_10206628 Ga0157373_102066281 218
372 3300025904 Ga0207647_10174170 Ga0207647_101741702 218
373 3300025913 Ga0207695_10253423 Ga0207695_102534232 218
374 3300050493 nmdc:mga0k408_60776_c1 nmdc:mga0k408_60776_c1_176_835 218
375 iso_pu_bacteria 2818991444 2819586870 218
376 3300005290 Ga0065712_10068728 Ga0065712_100687283 219
377 3300005327 Ga0070658_10124755 Ga0070658_101247552 219
378 3300005334 Ga0068869_100163380 Ga0068869_1001633801 219
379 3300005336 Ga0070680_100022839 Ga0070680_1000228393 219
380 3300005337 Ga0070682_100031038 Ga0070682_1000310382 219
381 3300005339 Ga0070660_100057129 Ga0070660_1000571292 219
382 3300005353 Ga0070669_100008945 Ga0070669_1000089456 219
383 3300005354 Ga0070675_100001853 Ga0070675_10000185312 219
384 3300005355 Ga0070671_100036857 Ga0070671_1000368571 219
385 3300005365 Ga0070688_100000797 Ga0070688_1000007973 219
386 3300005457 Ga0070662_100220464 Ga0070662_1002204641 219
387 3300005458 Ga0070681_10187476 Ga0070681_101874762 219
388 3300005459 Ga0068867_100109441 Ga0068867_1001094412 219
389 3300005459 Ga0068867_100119942 Ga0068867_1001199423 219
390 3300005466 Ga0070685_10144121 Ga0070685_101441211 219
391 3300005530 Ga0070679_100005217 Ga0070679_1000052174 219
392 3300005530 Ga0070679_100076729 Ga0070679_1000767292 219
393 3300005577 Ga0068857_100053867 Ga0068857_1000538674 219
394 3300005577 Ga0068857_100101746 Ga0068857_1001017462 219
395 3300005578 Ga0068854_100208337 Ga0068854_1002083372 219
396 3300005616 Ga0068852_100264611 Ga0068852_1002646112 219
397 3300005616 Ga0068852_100678449 Ga0068852_1006784491 219
398 3300005617 Ga0068859_100012546 Ga0068859_1000125464 219
399 3300005618 Ga0068864_100507956 Ga0068864_1005079561 219
400 3300005719 Ga0068861_100009935 Ga0068861_1000099358 219
401 3300005834 Ga0068851_10122216 Ga0068851_101222162 219
402 3300005840 Ga0068870_10010458 Ga0068870_100104582 219
403 3300005841 Ga0068863_100097472 Ga0068863_1000974721 219
404 3300005843 Ga0068860_100149394 Ga0068860_1001493942 219
405 3300005844 Ga0068862_100014732 Ga0068862_1000147327 219
406 3300005985 Ga0081539_10000603 Ga0081539_1000060312 219
407 3300006931 Ga0097620_100012546 Ga0097620_1000125464 219
408 3300009094 Ga0111539_10001795 Ga0111539_1000179520 219
409 3300009553 Ga0105249_10004874 Ga0105249_100048749 219
410 3300013100 Ga0157373_10252046 Ga0157373_102520462 219
411 3300013102 Ga0157371_10013529 Ga0157371_100135292 219
412 3300013102 Ga0157371_10099263 Ga0157371_100992632 219
413 3300013102 Ga0157371_10165855 Ga0157371_101658552 219
414 3300013104 Ga0157370_10734677 Ga0157370_107346771 219
415 3300013105 Ga0157369_10946683 Ga0157369_109466831 219
416 3300013296 Ga0157374_10393131 Ga0157374_103931312 219
417 3300013306 Ga0163162_10280345 Ga0163162_102803452 219
418 3300013307 Ga0157372_10032123 Ga0157372_100321232 219
419 3300013307 Ga0157372_11045731 Ga0157372_110457312 219
420 3300013308 Ga0157375_10044099 Ga0157375_100440994 219
421 3300014326 Ga0157380_10004288 Ga0157380_1000428811 219
422 3300014745 Ga0157377_10000903 Ga0157377_100009039 219
423 3300014969 Ga0157376_10091000 Ga0157376_100910002 219
424 3300025321 Ga0207656_10032320 Ga0207656_100323201 219
425 3300025909 Ga0207705_10079552 Ga0207705_100795522 219
426 3300025912 Ga0207707_10042303 Ga0207707_100423033 219
427 3300025921 Ga0207652_10144206 Ga0207652_101442062 219
428 3300025921 Ga0207652_10193534 Ga0207652_101935341 219
429 3300025926 Ga0207659_10026442 Ga0207659_100264424 219
430 3300025931 Ga0207644_10311050 Ga0207644_103110502 219
431 3300025933 Ga0207706_10250891 Ga0207706_102508912 219
432 3300025961 Ga0207712_10008432 Ga0207712_100084324 219
433 3300025972 Ga0207668_10880056 Ga0207668_108800561 219
434 3300025981 Ga0207640_10225943 Ga0207640_102259432 219
435 3300025986 Ga0207658_10332094 Ga0207658_103320942 219
436 3300026023 Ga0207677_10138095 Ga0207677_101380952 219
437 3300026075 Ga0207708_10121140 Ga0207708_101211402 219
438 3300026088 Ga0207641_10020910 Ga0207641_100209101 219
439 3300026116 Ga0207674_10047457 Ga0207674_100474574 219
440 3300026116 Ga0207674_10249313 Ga0207674_102493132 219
441 3300026116 Ga0207674_10330698 Ga0207674_103306982 219
442 3300026118 Ga0207675_100001143 Ga0207675_10000114323 219
443 3300026142 Ga0207698_10611679 Ga0207698_106116792 219
444 3300027907 Ga0207428_10052585 Ga0207428_100525853 219
445 3300028380 Ga0268265_10003979 Ga0268265_100039792 219
446 3300037471 Ga0395905_0044350 Ga0395905_0044350_68_754 219
447 3300050511 nmdc:mga08y16_9862_c1 nmdc:mga08y16_9862_c1_2788_3471 219
448 iso_pu_bacteria 2818991460 2819681134 219
449 iso_pu_bacteria 2884791551 2884794931 219
450 iso_pu_bacteria 2896109856 2896112117 219
451 iso_pu_bacteria 2929177148 2929179434 219
452 iso_pu_bacteria 2945977869 2945981844 219
453 iso_pu_bacteria 2946013367 2946018755 219
454 3300005329 Ga0070683_100224332 Ga0070683_1002243321 220
455 3300005364 Ga0070673_100562588 Ga0070673_1005625881 220
456 3300005617 Ga0068859_100023042 Ga0068859_1000230422 220
457 3300005841 Ga0068863_100590923 Ga0068863_1005909231 220
458 3300005843 Ga0068860_100044363 Ga0068860_1000443632 220
459 3300006931 Ga0097620_100023042 Ga0097620_1000230425 220
460 3300010375 Ga0105239_10156860 Ga0105239_101568603 220
461 3300013297 Ga0157378_10206030 Ga0157378_102060302 220
462 3300013306 Ga0163162_10820200 Ga0163162_108202002 220
463 3300013308 Ga0157375_10129178 Ga0157375_101291781 220
464 3300014326 Ga0157380_10191010 Ga0157380_101910101 220
465 3300025911 Ga0207654_10065009 Ga0207654_100650093 220
466 3300025933 Ga0207706_10205773 Ga0207706_102057733 220
467 3300025944 Ga0207661_10186931 Ga0207661_101869311 220
468 3300025960 Ga0207651_10343196 Ga0207651_103431961 220
469 3300026067 Ga0207678_10054336 Ga0207678_100543361 220
470 3300028381 Ga0268264_10092763 Ga0268264_100927631 220
471 3300036401 Ga0373937_0161140 Ga0373937_0161140_1165_1854 220
472 3300037312 Ga0395899_0006130 Ga0395899_0006130_4698_5399 220
473 3300037312 Ga0395899_0047145 Ga0395899_0047145_527_1231 220
474 3300037418 Ga0395900_0007210 Ga0395900_0007210_6295_6996 220
475 3300037418 Ga0395900_0010450 Ga0395900_0010450_3185_3889 220
476 3300037466 Ga0395898_0001921 Ga0395898_0001921_1842_2543 220
477 3300037471 Ga0395905_0009413 Ga0395905_0009413_291_995 220
478 3300038443 Ga0395901_0023012 Ga0395901_0023012_4055_4759 220
479 3300038443 Ga0395901_0028934 Ga0395901_0028934_39_740 220
480 3300046454 Ga0495592_0046186 Ga0495592_0046186_374_1063 220
481 3300046517 Ga0495630_0067973 Ga0495630_0067973_40_729 220
482 3300046642 Ga0495634_0052470 Ga0495634_0052470_738_1427 220
483 3300005336 Ga0070680_100002202 Ga0070680_1000022026 221
484 3300005458 Ga0070681_10026241 Ga0070681_100262411 221
485 3300013102 Ga0157371_10182863 Ga0157371_101828631 221
486 3300013102 Ga0157371_10339658 Ga0157371_103396581 221
487 3300013105 Ga0157369_10387491 Ga0157369_103874911 221
488 3300014325 Ga0163163_10048321 Ga0163163_100483213 221
489 3300025909 Ga0207705_10399221 Ga0207705_103992211 221
490 3300025912 Ga0207707_10075539 Ga0207707_100755392 221
491 3300025917 Ga0207660_10021889 Ga0207660_100218892 221
492 3300025921 Ga0207652_10000074 Ga0207652_1000007440 221
493 3300025949 Ga0207667_10155720 Ga0207667_101557202 221
494 3300042007 Ga0439449_0077448 Ga0439449_0077448_421_1143 221
495 3300042134 Ga0450898_003070 Ga0450898_003070_365_1042 221
496 3300042435 Ga0439434_0016547 Ga0439434_0016547_856_1578 221
497 3300005327 Ga0070658_10054094 Ga0070658_100540942 222
498 3300005329 Ga0070683_100389908 Ga0070683_1003899082 222
499 3300005366 Ga0070659_100053194 Ga0070659_1000531942 222
500 3300005457 Ga0070662_100440141 Ga0070662_1004401411 222
501 3300005840 Ga0068870_10226174 Ga0068870_102261742 222
502 3300009093 Ga0105240_10177825 Ga0105240_101778251 222
503 3300013100 Ga0157373_10047722 Ga0157373_100477222 222
504 3300013104 Ga0157370_10000457 Ga0157370_100004578 222
505 3300025908 Ga0207643_10238300 Ga0207643_102383001 222
506 3300025909 Ga0207705_10052265 Ga0207705_100522653 222
507 3300025921 Ga0207652_10392020 Ga0207652_103920202 222
508 3300025932 Ga0207690_10021548 Ga0207690_100215484 222
509 3300025944 Ga0207661_10315267 Ga0207661_103152672 222
510 3300026078 Ga0207702_10202618 Ga0207702_102026182 222
511 3300026142 Ga0207698_10189084 Ga0207698_101890842 222
512 3300031730 Ga0307516_10489169 Ga0307516_104891692 222
513 3300049571 Ga0501034_0029136 Ga0501034_0029136_3882_4565 222
514 3300049579 Ga0501043_0010965 Ga0501043_0010965_3386_4069 222
515 3300049580 Ga0501046_0116477 Ga0501046_0116477_983_1666 222
516 3300049581 Ga0501047_0161653 Ga0501047_0161653_1055_1738 222
517 3300049589 Ga0501073_0018070 Ga0501073_0018070_1103_1786 222
518 3300049590 Ga0501074_0072898 Ga0501074_0072898_1307_1990 222
519 3300049742 Ga0501080_0018945 Ga0501080_0018945_3882_4565 222
520 2162886007 SwRhRL2b_contig_595418 SwRhRL2b_0218.00000940 223
521 3300002739 JGI25158J39367_1011228 JGI25158J39367_10112283 223
522 3300005289 Ga0065704_10105250 Ga0065704_101052502 223
523 3300049570 Ga0501033_0103934 Ga0501033_0103934_1309_1998 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

30

259

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f8e-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9365 6 217
7ygf-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9364 6 217
3cpg-assembly1.cif.gz_A crystal structure of an unknown protein from bifidobacterium adolescentis 0.9204 6 217
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.9161 12 218
7uax-assembly1.cif.gz_A the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp 0.9135 6 218
ID Description Score Start End Superfamily
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.916 7 222 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9115 6 223 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9113 6 219 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9102 6 221 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9048 6 223 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A561J3B1-F1-model_v4 deleted 0.989 1 220
AF-A0A1H7Y049-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9881 1 221 GO:0030170
AF-A0A7Y2FLW4-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.988 20 220 GO:0030170
AF-A0A7Y2E1S4-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9859 4 121 GO:0030170
AF-A0A1Q3TBM9-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9851 1 220 GO:0030170

Feature Viewer

pLDDT pTM Quality
94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map