F458964

General Info

Members Datasets Scaffolds Average Seq Length
523 273 1046 478

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100218708|Ga0075431_1002187081
Length 553
Sequence MSGGPLGVMPFSPSHAKSSGSSTQAHWEALAHSMGLRGSASGSAPSCDGVPGVHPVNSDQQPPRGKGAALALLATTQFVVILDASIVNVALPSIGSALEFSQENLSWVVNAYTLTFGGFLLLGGRLADLLGRRRMFMIGLVLFSVASLLGGLAQSDLWLIAARALQGLGAALISPAALSLVTTIFAEGAERNRALGIWGAVAGSGGAAGVLLGGMLTEWAGWEWVLFVNVPIGVAAAALAPRLLPENRDEGAARDFDATGAVLVTGGLALLVYTLVDAESAGWTSTQTLGLGALSLATLAAFVAWESRASHPLMPLGIFRLRTLRGANAVGLLLGMALFAMFFFISLYMQQVLGYSPIEAGFAFLPLAVTIMVSATVAARLVTRFGARSTLVVGMLLIAGALVWFSRAAADGSYLGDLLFPSLVVAVGLGLAFVPVTIAAVAGTRPDEAGLASGFINTSQQVGGALGLAILASIATSRTASVVSEGVADQAVALTEGFQLAFLVGAGFALAGAILAVVTISSRDCRERIESGRVDVPAPCAEQPQARVRVAVR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
272 2808606372 Agromyces sp. 23-23 Isolate Unclassified
273 2919395869 Microbacterium resistens 2980 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.57
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 9.75
Rhizosphere 81.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100218708 3300006847 Bacteria 1944
2 LJQas_1000889 3300000549 Bacteria 4647
3 JGI24740J21852_10003503 3300001979 Bacteria 6878
4 JGI25407J50210_10009771 3300003373 Bacteria 2435
5 JGI25407J50210_10014371 3300003373 Bacteria 2040
6 Ga0070683_100000793 3300005329 Bacteria 23313
7 Ga0070683_100004343 3300005329 Bacteria 11662
8 Ga0070683_100045196 3300005329 Bacteria 4064
9 Ga0070683_100123950 3300005329 Bacteria 2442
10 Ga0070683_100184096 3300005329 Bacteria 1983
11 Ga0070670_100145138 3300005331 Bacteria 2053
12 Ga0070677_10001179 3300005333 Bacteria 8379
13 Ga0068869_100072572 3300005334 Bacteria 2550
14 Ga0070680_100012714 3300005336 Bacteria 6542
15 Ga0070680_100145185 3300005336 Bacteria 1991
16 Ga0070682_100018266 3300005337 Bacteria 4096
17 Ga0068868_100011341 3300005338 Bacteria 6490
18 Ga0068868_100011859 3300005338 Bacteria 6355
19 Ga0068868_100039560 3300005338 Bacteria 3665
20 Ga0070660_100000769 3300005339 Bacteria 21275
21 Ga0070691_10018604 3300005341 Bacteria 3203
22 Ga0070687_100011246 3300005343 Bacteria 3909
23 Ga0070661_100000005 3300005344 Bacteria 220455
24 Ga0070661_100142802 3300005344 Bacteria 1805
25 Ga0070675_100000058 3300005354 Bacteria 66874
26 Ga0070674_100025229 3300005356 Bacteria 3868
27 Ga0070674_100064946 3300005356 Bacteria 2560
28 Ga0070674_100068087 3300005356 Bacteria 2507
29 Ga0070673_100232466 3300005364 Bacteria 1600
30 Ga0070688_100000333 3300005365 Bacteria 24059
31 Ga0070688_100002150 3300005365 Bacteria 9926
32 Ga0070688_100061417 3300005365 Bacteria 2376
33 Ga0070659_100055695 3300005366 Bacteria 3117
34 Ga0070659_100067879 3300005366 Bacteria 2828
35 Ga0070659_100070219 3300005366 Bacteria 2782
36 Ga0070659_100160197 3300005366 Bacteria 1839
37 Ga0070667_100008884 3300005367 Bacteria 8317
38 Ga0070714_100040683 3300005435 Bacteria 3918
39 Ga0070711_100069180 3300005439 Bacteria 2483
40 Ga0070705_100065617 3300005440 Bacteria 2173
41 Ga0070700_100001446 3300005441 Bacteria 11810
42 Ga0070663_100013682 3300005455 Bacteria 5184
43 Ga0070663_100015589 3300005455 Bacteria 4912
44 Ga0070662_100161898 3300005457 Bacteria 1751
45 Ga0068867_100033209 3300005459 Bacteria 3735
46 Ga0068867_100055299 3300005459 Bacteria 2934
47 Ga0070685_10000293 3300005466 Bacteria 31562
48 Ga0070685_10000886 3300005466 Bacteria 16173
49 Ga0070679_100000088 3300005530 Bacteria 69314
50 Ga0070679_100028040 3300005530 Bacteria 5548
51 Ga0070684_100022597 3300005535 Bacteria 5249
52 Ga0070684_100270109 3300005535 Bacteria 1557
53 Ga0070665_100303082 3300005548 Bacteria 1601
54 Ga0070664_100050159 3300005564 Bacteria 3531
55 Ga0068857_100220354 3300005577 Bacteria 1733
56 Ga0068854_100041243 3300005578 Bacteria 3261
57 Ga0068854_100068109 3300005578 Bacteria 2595
58 Ga0068856_100001818 3300005614 Bacteria 22286
59 Ga0068856_100003218 3300005614 Bacteria 16627
60 Ga0068856_100017905 3300005614 Bacteria 6870
61 Ga0068856_100022808 3300005614 Bacteria 6087
62 Ga0068852_100000012 3300005616 Bacteria 140734
63 Ga0068852_100012338 3300005616 Bacteria 6482
64 Ga0068852_100017295 3300005616 Bacteria 5653
65 Ga0068852_100061819 3300005616 Bacteria 3255
66 Ga0068859_100038394 3300005617 Bacteria 4804
67 Ga0068864_100000043 3300005618 Bacteria 162928
68 Ga0068864_100009510 3300005618 Bacteria 8022
69 Ga0068864_100155059 3300005618 Bacteria 2078
70 Ga0068861_100047802 3300005719 Bacteria 3232
71 Ga0068861_100072498 3300005719 Bacteria 2672
72 Ga0068861_100141437 3300005719 Bacteria 1964
73 Ga0068851_10000988 3300005834 Bacteria 12307
74 Ga0068863_100000761 3300005841 Bacteria 32288
75 Ga0068862_100003740 3300005844 Bacteria 12983
76 Ga0081455_10006775 3300005937 Bacteria 12223
77 Ga0081538_10000002 3300005981 Bacteria 242010
78 Ga0081538_10000140 3300005981 Bacteria 74734
79 Ga0081538_10000263 3300005981 Bacteria 59895
80 Ga0081538_10001945 3300005981 Bacteria 20688
81 Ga0081538_10002394 3300005981 Bacteria 18406
82 Ga0081538_10002441 3300005981 Bacteria 18195
83 Ga0081538_10003607 3300005981 Bacteria 14539
84 Ga0081538_10004322 3300005981 Bacteria 13133
85 Ga0081538_10006088 3300005981 Bacteria 10721
86 Ga0081538_10006811 3300005981 Bacteria 9971
87 Ga0081538_10008984 3300005981 Bacteria 8396
88 Ga0081538_10013516 3300005981 Bacteria 6457
89 Ga0081538_10027176 3300005981 Bacteria 3975
90 Ga0081538_10028938 3300005981 Bacteria 3797
91 Ga0081538_10035459 3300005981 Bacteria 3277
92 Ga0081538_10078166 3300005981 Bacteria 1777
93 Ga0081540_1001667 3300005983 Bacteria 18903
94 Ga0081540_1002235 3300005983 Bacteria 15947
95 Ga0081540_1050990 3300005983 Bacteria 2050
96 Ga0081539_10003296 3300005985 Bacteria 20206
97 Ga0081539_10004860 3300005985 Bacteria 14369
98 Ga0081539_10012367 3300005985 Bacteria 6586
99 Ga0081539_10013349 3300005985 Bacteria 6195
100 Ga0081539_10031571 3300005985 Bacteria 3262
101 Ga0075365_10000276 3300006038 Bacteria 17581
102 Ga0075365_10029790 3300006038 Bacteria 3491
103 Ga0075364_10002860 3300006051 Bacteria 9732
104 Ga0070712_100000777 3300006175 Bacteria 18846
105 Ga0070712_100034134 3300006175 Bacteria 3447
106 Ga0075362_10056537 3300006177 Bacteria 1766
107 Ga0075369_10034729 3300006186 Bacteria 2141
108 Ga0075428_100043403 3300006844 Bacteria 4942
109 Ga0075428_100250590 3300006844 Bacteria 1908
110 Ga0075430_100040449 3300006846 Bacteria 3946
111 Ga0075431_100061514 3300006847 Bacteria 3874
112 Ga0075433_10066035 3300006852 Bacteria 3173
113 Ga0075433_10139657 3300006852 Bacteria 2153
114 Ga0075434_100036916 3300006871 Bacteria 4835
115 Ga0075434_100085741 3300006871 Bacteria 3149
116 Ga0075429_100014763 3300006880 Bacteria 6769
117 Ga0068865_100000017 3300006881 Bacteria 109636
118 Ga0068865_100121249 3300006881 Bacteria 1945
119 Ga0097620_100038396 3300006931 Bacteria 4804
120 Ga0075435_100052673 3300007076 Bacteria 3279
121 Ga0105240_10032516 3300009093 Bacteria 6754
122 Ga0105240_10064174 3300009093 Bacteria 4564
123 Ga0111539_10008397 3300009094 Bacteria 13142
124 Ga0111539_10009996 3300009094 Bacteria 11957
125 Ga0111539_10101809 3300009094 Bacteria 3372
126 Ga0111539_10283584 3300009094 Bacteria 1927
127 Ga0105245_10000056 3300009098 Bacteria 124109
128 Ga0105245_10001521 3300009098 Bacteria 20984
129 Ga0105245_10010088 3300009098 Bacteria 8228
130 Ga0105245_10240217 3300009098 Bacteria 1755
131 Ga0114129_10010286 3300009147 Bacteria 13349
132 Ga0114129_10169199 3300009147 Bacteria 2980
133 Ga0114129_10254539 3300009147 Bacteria 2356
134 Ga0105243_10006066 3300009148 Bacteria 9344
135 Ga0105243_10010452 3300009148 Bacteria 7048
136 Ga0105243_10082929 3300009148 Bacteria 2621
137 Ga0105242_10013611 3300009176 Bacteria 6296
138 Ga0105242_10161914 3300009176 Bacteria 1959
139 Ga0105248_10000032 3300009177 Bacteria 201114
140 Ga0105248_10086267 3300009177 Bacteria 3532
141 Ga0105238_10054931 3300009551 Bacteria 3999
142 Ga0105249_10000331 3300009553 Bacteria 47860
143 Ga0105249_10004558 3300009553 Bacteria 11973
144 Ga0105249_10058446 3300009553 Bacteria 3534
145 Ga0105249_10131733 3300009553 Bacteria 2388
146 Ga0105239_10022244 3300010375 Bacteria 6989
147 Ga0105239_10051668 3300010375 Bacteria 4505
148 Ga0105239_10330320 3300010375 Bacteria 1720
149 Ga0157370_10007487 3300013104 Bacteria 11859
150 Ga0157370_10038083 3300013104 Bacteria 4655
151 Ga0157370_10048328 3300013104 Bacteria 4076
152 Ga0157369_10000099 3300013105 Bacteria 120032
153 Ga0157374_10003750 3300013296 Bacteria 12770
154 Ga0157374_10006293 3300013296 Bacteria 10063
155 Ga0157378_10008870 3300013297 Bacteria 8751
156 Ga0157378_10022014 3300013297 Bacteria 5607
157 Ga0163162_10217361 3300013306 Bacteria 2041
158 Ga0157372_10033847 3300013307 Bacteria 5615
159 Ga0157372_10079841 3300013307 Bacteria 3701
160 Ga0157372_10227501 3300013307 Bacteria 2162
161 Ga0157375_10000717 3300013308 Bacteria 29235
162 Ga0157375_10253831 3300013308 Bacteria 1919
163 Ga0163163_10248875 3300014325 Bacteria 1828
164 Ga0157380_10000028 3300014326 Bacteria 99836
165 Ga0157377_10001456 3300014745 Bacteria 10239
166 Ga0157377_10035285 3300014745 Bacteria 2743
167 Ga0157377_10040171 3300014745 Bacteria 2589
168 Ga0157379_10006275 3300014968 Bacteria 10238
169 Ga0157379_10033027 3300014968 Bacteria 4615
170 Ga0157379_10131436 3300014968 Bacteria 2253
171 Ga0157376_10016514 3300014969 Bacteria 5608
172 Ga0157376_10120412 3300014969 Bacteria 2325
173 Ga0206353_10592025 3300020082 Bacteria 3676
174 Ga0213874_10000596 3300021377 Bacteria 7278
175 Ga0213875_10000039 3300021388 Bacteria 156845
176 Ga0213875_10000786 3300021388 Bacteria 23720
177 Ga0207426_1009309 3300025302 Bacteria 3898
178 Ga0207656_10000559 3300025321 Bacteria 12340
179 Ga0207656_10014901 3300025321 Bacteria 3004
180 Ga0207682_10000799 3300025893 Bacteria 14533
181 Ga0207642_10000854 3300025899 Bacteria 9485
182 Ga0207688_10004057 3300025901 Bacteria 7978
183 Ga0207688_10026687 3300025901 Bacteria 3177
184 Ga0207688_10061805 3300025901 Bacteria 2112
185 Ga0207680_10002095 3300025903 Bacteria 9346
186 Ga0207680_10008912 3300025903 Bacteria 4947
187 Ga0207705_10037460 3300025909 Bacteria 3471
188 Ga0207705_10112303 3300025909 Bacteria 2014
189 Ga0207654_10049955 3300025911 Bacteria 2402
190 Ga0207707_10010959 3300025912 Bacteria 7885
191 Ga0207693_10000853 3300025915 Bacteria 27203
192 Ga0207693_10045654 3300025915 Bacteria 3442
193 Ga0207693_10059118 3300025915 Bacteria 3002
194 Ga0207693_10089288 3300025915 Bacteria 2415
195 Ga0207663_10032289 3300025916 Bacteria 3107
196 Ga0207663_10063936 3300025916 Bacteria 2346
197 Ga0207660_10003389 3300025917 Bacteria 10392
198 Ga0207660_10161199 3300025917 Bacteria 1730
199 Ga0207657_10017412 3300025919 Bacteria 6890
200 Ga0207657_10021488 3300025919 Bacteria 6070
201 Ga0207649_10000005 3300025920 Bacteria 356179
202 Ga0207652_10000286 3300025921 Bacteria 52725
203 Ga0207652_10006790 3300025921 Bacteria 9226
204 Ga0207652_10227385 3300025921 Bacteria 1682
205 Ga0207694_10033893 3300025924 Bacteria 3913
206 Ga0207659_10000020 3300025926 Bacteria 151552
207 Ga0207687_10000007 3300025927 Bacteria 604185
208 Ga0207687_10000105 3300025927 Bacteria 61343
209 Ga0207687_10004167 3300025927 Bacteria 9684
210 Ga0207687_10075663 3300025927 Bacteria 2417
211 Ga0207687_10112530 3300025927 Bacteria 2023
212 Ga0207644_10086493 3300025931 Bacteria 2328
213 Ga0207706_10016720 3300025933 Bacteria 6621
214 Ga0207706_10045533 3300025933 Bacteria 3886
215 Ga0207686_10170020 3300025934 Bacteria 1536
216 Ga0207669_10000029 3300025937 Bacteria 88351
217 Ga0207669_10051312 3300025937 Bacteria 2471
218 Ga0207704_10000025 3300025938 Bacteria 135523
219 Ga0207704_10142943 3300025938 Bacteria 1677
220 Ga0207665_10001721 3300025939 Bacteria 14710
221 Ga0207691_10034978 3300025940 Bacteria 4668
222 Ga0207711_10000020 3300025941 Bacteria 363325
223 Ga0207711_10209752 3300025941 Bacteria 1779
224 Ga0207689_10068637 3300025942 Bacteria 2913
225 Ga0207689_10088109 3300025942 Bacteria 2550
226 Ga0207661_10038998 3300025944 Bacteria 3726
227 Ga0207661_10053877 3300025944 Bacteria 3221
228 Ga0207661_10067195 3300025944 Bacteria 2915
229 Ga0207661_10106285 3300025944 Bacteria 2366
230 Ga0207679_10038668 3300025945 Bacteria 3401
231 Ga0207679_10040314 3300025945 Bacteria 3342
232 Ga0207679_10066784 3300025945 Bacteria 2696
233 Ga0207679_10067178 3300025945 Bacteria 2689
234 Ga0207651_10077705 3300025960 Bacteria 2378
235 Ga0207712_10000032 3300025961 Bacteria 210628
236 Ga0207712_10004596 3300025961 Bacteria 8717
237 Ga0207668_10037672 3300025972 Bacteria 3239
238 Ga0207640_10000137 3300025981 Bacteria 54133
239 Ga0207640_10018760 3300025981 Bacteria 4071
240 Ga0207640_10050126 3300025981 Bacteria 2707
241 Ga0207658_10003652 3300025986 Bacteria 10856
242 Ga0207703_10000030 3300026035 Bacteria 199014
243 Ga0207639_10027335 3300026041 Bacteria 4156
244 Ga0207678_10008257 3300026067 Bacteria 9174
245 Ga0207678_10023587 3300026067 Bacteria 5380
246 Ga0207678_10028022 3300026067 Bacteria 4919
247 Ga0207708_10000398 3300026075 Bacteria 34302
248 Ga0207702_10000016 3300026078 Bacteria 226633
249 Ga0207702_10013026 3300026078 Bacteria 6916
250 Ga0207641_10001906 3300026088 Bacteria 20029
251 Ga0207648_10036694 3300026089 Bacteria 4318
252 Ga0207648_10043465 3300026089 Bacteria 3943
253 Ga0207648_10109204 3300026089 Bacteria 2428
254 Ga0207648_10124303 3300026089 Bacteria 2269
255 Ga0207676_10000042 3300026095 Bacteria 163475
256 Ga0207676_10195261 3300026095 Bacteria 1784
257 Ga0207675_100003658 3300026118 Bacteria 14990
258 Ga0207675_100052523 3300026118 Bacteria 3803
259 Ga0207675_100112576 3300026118 Bacteria 2569
260 Ga0207683_10003687 3300026121 Bacteria 13311
261 Ga0207683_10005133 3300026121 Bacteria 11241
262 Ga0207698_10000012 3300026142 Bacteria 260061
263 Ga0207698_10008710 3300026142 Bacteria 6432
264 Ga0207428_10024080 3300027907 Bacteria 5112
265 Ga0207428_10026444 3300027907 Bacteria 4844
266 Ga0207428_10037296 3300027907 Bacteria 3955
267 Ga0207428_10089474 3300027907 Bacteria 2392
268 Ga0207428_10094357 3300027907 Bacteria 2320
269 Ga0268266_10000216 3300028379 Bacteria 100792
270 Ga0268266_10000553 3300028379 Bacteria 52199
271 Ga0268266_10014029 3300028379 Bacteria 6898
272 Ga0268266_10090581 3300028379 Bacteria 2681
273 Ga0268265_10005149 3300028380 Bacteria 8955
274 Ga0265337_1000069 3300028556 Bacteria 47825
275 Ga0265326_10000012 3300028558 Bacteria 175352
276 Ga0265322_10000003 3300028654 Bacteria 468671
277 Ga0265324_10000398 3300029957 Bacteria 31535
278 Ga0265328_10000555 3300031239 Bacteria 17361
279 Ga0265320_10000001 3300031240 Bacteria 847191
280 Ga0265329_10001477 3300031242 Bacteria 11279
281 Ga0265331_10001290 3300031250 Bacteria 18656
282 Ga0265327_10000003 3300031251 Bacteria 852750
283 Ga0265314_10000044 3300031711 Bacteria 207337
284 Ga0265342_10064053 3300031712 Bacteria 2159
285 Ga0307410_10115053 3300031852 Bacteria 1952
286 Ga0307406_10066888 3300031901 Bacteria 2341
287 Ga0307406_10103361 3300031901 Bacteria 1945
288 Ga0307406_10168228 3300031901 Bacteria 1584
289 Ga0307409_100051998 3300031995 Bacteria 3138
290 Ga0307416_100143311 3300032002 Bacteria 2176
291 Ga0307416_100168880 3300032002 Bacteria 2033
292 Ga0307415_100000897 3300032126 Bacteria 13621
293 Ga0395899_0050808 3300037312 Bacteria 3077
294 Ga0395900_0021837 3300037418 Bacteria 6544
295 Ga0395900_0063212 3300037418 Bacteria 3805
296 Ga0395900_0064246 3300037418 Bacteria 3773
297 Ga0395898_0031372 3300037466 Bacteria 5310
298 Ga0436364_0462369 3300037853 Bacteria 93786
299 Ga0436364_0633675 3300037853 Bacteria 25140
300 Ga0395901_0117188 3300038443 Bacteria 2798
301 Ga0436363_0044269 3300039450 Bacteria 17489
302 Ga0466963_0000012 3300044694 Bacteria 62839
303 Ga0466963_0011126 3300044694 Bacteria 5472
304 Ga0466963_0025126 3300044694 Bacteria 3797
305 Ga0466964_0035712 3300044706 Bacteria 1989
306 Ga0466971_0002588 3300044719 Bacteria 7649
307 Ga0466971_0026275 3300044719 Bacteria 2601
308 Ga0466957_0003292 3300044842 Bacteria 8849
309 Ga0466957_0029203 3300044842 Bacteria 3287
310 Ga0466957_0033812 3300044842 Bacteria 3067
311 Ga0466959_0091576 3300045049 Bacteria 2183
312 Ga0451576_0140343 3300045051 Bacteria 2520
313 Ga0466958_0019028 3300045836 Bacteria 3993
314 Ga0466958_0121870 3300045836 Bacteria 1633
315 Ga0466967_0000344 3300045976 Bacteria 21424
316 Ga0466967_0002951 3300045976 Bacteria 10868
317 Ga0466967_0060767 3300045976 Bacteria 3350
318 Ga0495592_0051783 3300046454 Bacteria 3049
319 Ga0495629_0003392 3300046459 Bacteria 12051
320 Ga0495638_0011572 3300046460 Bacteria 6079
321 Ga0495641_0000004 3300046461 Bacteria 210501
322 Ga0495650_0000079 3300046471 Bacteria 244549
323 Ga0495606_0000211 3300046507 Bacteria 103386
324 Ga0495608_0000208 3300046511 Bacteria 42275
325 Ga0495608_0030777 3300046511 Bacteria 3631
326 Ga0495620_0001177 3300046515 Bacteria 16018
327 Ga0495630_0000025 3300046517 Bacteria 152364
328 Ga0495630_0001088 3300046517 Bacteria 18687
329 Ga0495652_0000003 3300046529 Bacteria 597094
330 Ga0495652_0001501 3300046529 Bacteria 25686
331 Ga0495667_0030451 3300046559 Bacteria 3626
332 Ga0495634_0000002 3300046642 Bacteria 247842
333 Ga0495634_0000191 3300046642 Bacteria 56356
334 Ga0495634_0016502 3300046642 Bacteria 5281
335 Ga0495625_0000029 3300046660 Bacteria 244646
336 Ga0495635_0004480 3300046663 Bacteria 9675
337 Ga0495588_0000311 3300046674 Bacteria 33416
338 Ga0495588_0051087 3300046674 Bacteria 2129
339 Ga0495657_0000406 3300046675 Bacteria 40241
340 Ga0495647_0000005 3300046681 Bacteria 125996
341 Ga0495647_0000289 3300046681 Bacteria 14023
342 Ga0495658_0000876 3300046683 Bacteria 16174
343 Ga0495669_0000188 3300046684 Bacteria 38417
344 Ga0495674_0032548 3300047319 Bacteria 4729
345 Ga0495676_0000320 3300047321 Bacteria 38969
346 Ga0495680_0019110 3300047322 Bacteria 5798
347 Ga0495675_0002624 3300047444 Bacteria 10770
348 Ga0495679_016729 3300047446 Bacteria 2646
349 Ga0495602_0061367 3300048088 Bacteria 3270
350 Ga0495602_0098875 3300048088 Bacteria 2400
351 Ga0496100_0000006 3300048903 Bacteria 297429
352 Ga0496101_0000009 3300048904 Bacteria 297429
353 Ga0496101_0063915 3300048904 Bacteria 2680
354 Ga0496101_0170116 3300048904 Bacteria 1675
355 Ga0496102_0014400 3300048905 Bacteria 6872
356 Ga0496102_0254999 3300048905 Bacteria 1654
357 Ga0496102_0259199 3300048905 Bacteria 1639
358 Ga0496103_0016855 3300048906 Bacteria 4363
359 Ga0496104_0000008 3300048907 Bacteria 516976
360 Ga0496104_0000010 3300048907 Bacteria 475255
361 Ga0496104_0002857 3300048907 Bacteria 14886
362 Ga0496105_0000003 3300048908 Bacteria 713251
363 Ga0496105_0000005 3300048908 Bacteria 475797
364 Ga0496105_0032204 3300048908 Bacteria 4302
365 Ga0496105_0041057 3300048908 Bacteria 3814
366 Ga0496105_0130048 3300048908 Bacteria 2076
367 Ga0496105_0136304 3300048908 Bacteria 2022
368 Ga0496106_0000172 3300048909 Bacteria 47232
369 Ga0496106_0001026 3300048909 Bacteria 20534
370 Ga0496106_0005559 3300048909 Bacteria 9331
371 Ga0496106_0023461 3300048909 Bacteria 4584
372 Ga0496106_0034859 3300048909 Bacteria 3761
373 Ga0496107_0000693 3300048910 Bacteria 19147
374 Ga0496107_0081208 3300048910 Bacteria 2364
375 Ga0496107_0086445 3300048910 Bacteria 2289
376 Ga0496108_0000004 3300048911 Bacteria 545055
377 Ga0496108_0000045 3300048911 Bacteria 137416
378 Ga0496108_0032467 3300048911 Bacteria 4336
379 Ga0496109_0000013 3300048912 Bacteria 227469
380 Ga0496109_0000032 3300048912 Bacteria 162984
381 Ga0496109_0000252 3300048912 Bacteria 51599
382 Ga0496110_0000386 3300048913 Bacteria 29667
383 Ga0496110_0040193 3300048913 Bacteria 4076
384 Ga0496110_0049014 3300048913 Bacteria 3704
385 Ga0496111_0000225 3300048914 Bacteria 26948
386 Ga0496111_0028724 3300048914 Bacteria 3942
387 Ga0496111_0186629 3300048914 Bacteria 1541
388 Ga0496112_0000362 3300048915 Bacteria 29649
389 Ga0496112_0067459 3300048915 Bacteria 3531
390 Ga0496112_0121416 3300048915 Bacteria 2583
391 Ga0496112_0131303 3300048915 Bacteria 2476
392 Ga0496113_0000127 3300048916 Bacteria 33059
393 Ga0496113_0003820 3300048916 Bacteria 9115
394 Ga0496113_0049089 3300048916 Bacteria 3142
395 Ga0496113_0061953 3300048916 Bacteria 2824
396 Ga0496114_0139420 3300048917 Bacteria 2099
397 Ga0496114_0146241 3300048917 Bacteria 2049
398 Ga0496114_0204994 3300048917 Bacteria 1728
399 Ga0496115_0000020 3300048918 Bacteria 171995
400 Ga0496115_0005197 3300048918 Bacteria 9464
401 Ga0496115_0061955 3300048918 Bacteria 3017
402 Ga0496116_0001659 3300048919 Bacteria 24487
403 Ga0496117_0002954 3300048920 Bacteria 20541
404 Ga0496118_0004753 3300048921 Bacteria 15891
405 Ga0496118_0031058 3300048921 Bacteria 4440
406 Ga0496119_0003832 3300048922 Bacteria 15365
407 Ga0496119_0005699 3300048922 Bacteria 11813
408 Ga0496119_0026226 3300048922 Bacteria 4045
409 Ga0496120_0018303 3300048923 Bacteria 4522
410 Ga0496121_0013909 3300048924 Bacteria 8603
411 Ga0496121_0024190 3300048924 Bacteria 5818
412 Ga0496121_0028063 3300048924 Bacteria 5249
413 Ga0496124_0010869 3300048927 Bacteria 9162
414 Ga0496124_0104111 3300048927 Bacteria 2295
415 Ga0496124_0153736 3300048927 Bacteria 1802
416 Ga0496125_0027583 3300048928 Bacteria 5146
417 Ga0496125_0067149 3300048928 Bacteria 2828
418 Ga0496125_0087036 3300048928 Bacteria 2361
419 Ga0501318_002595 3300049534 Bacteria 1583
420 Ga0501319_000699 3300049535 Bacteria 1703
421 Ga0501031_0003383 3300049568 Bacteria 10245
422 Ga0501032_0067461 3300049569 Bacteria 2389
423 Ga0501034_0003570 3300049571 Bacteria 17667
424 Ga0501034_0007826 3300049571 Bacteria 11367
425 Ga0501034_0009920 3300049571 Bacteria 9951
426 Ga0501034_0041963 3300049571 Bacteria 4630
427 Ga0501036_0006019 3300049572 Bacteria 9837
428 Ga0501036_0017378 3300049572 Bacteria 6014
429 Ga0501037_0005002 3300049573 Bacteria 9639
430 Ga0501038_0007121 3300049574 Bacteria 10333
431 Ga0501039_0014729 3300049575 Bacteria 5983
432 Ga0501039_0201198 3300049575 Bacteria 1566
433 Ga0501040_0051516 3300049576 Bacteria 2816
434 Ga0501040_0059630 3300049576 Bacteria 2622
435 Ga0501040_0104383 3300049576 Bacteria 1979
436 Ga0501042_0124705 3300049578 Bacteria 1854
437 Ga0501043_0005695 3300049579 Bacteria 10038
438 Ga0501046_0007044 3300049580 Bacteria 9904
439 Ga0501046_0102382 3300049580 Bacteria 2196
440 Ga0501047_0001844 3300049581 Bacteria 20430
441 Ga0501048_0005493 3300049582 Bacteria 9644
442 Ga0501048_0038197 3300049582 Bacteria 3446
443 Ga0501068_0060042 3300049584 Bacteria 2308
444 Ga0501069_0000572 3300049585 Bacteria 17023
445 Ga0501070_0005807 3300049586 Bacteria 10531
446 Ga0501070_0007740 3300049586 Bacteria 9107
447 Ga0501070_0016259 3300049586 Bacteria 6252
448 Ga0501071_0026264 3300049587 Bacteria 4086
449 Ga0501071_0051950 3300049587 Bacteria 2955
450 Ga0501072_0010167 3300049588 Bacteria 7166
451 Ga0501072_0038623 3300049588 Bacteria 3747
452 Ga0501073_0005281 3300049589 Bacteria 9688
453 Ga0501074_0060368 3300049590 Bacteria 2731
454 Ga0501074_0123871 3300049590 Bacteria 1848
455 Ga0501075_0017406 3300049591 Bacteria 5192
456 Ga0501075_0061649 3300049591 Bacteria 2827
457 Ga0501076_0036556 3300049592 Bacteria 3849
458 Ga0501077_0013588 3300049593 Bacteria 5104
459 Ga0501080_0039881 3300049742 Bacteria 4382
460 Ga0501080_0158808 3300049742 Bacteria 2089
461 Ga0501083_0004654 3300049744 Bacteria 9694
462 Ga0501083_0040033 3300049744 Bacteria 3182
463 Ga0501035_0003153 3300049822 Bacteria 15842
464 Ga0501044_0004479 3300049823 Bacteria 15616
465 Ga0501044_0023400 3300049823 Bacteria 6570
466 nmdc:mga03683_12941_c1 3300050489 Bacteria 3059
467 nmdc:mga00v17_2330_c1 3300050491 Bacteria 9732
468 nmdc:mga0yw44_272_c1 3300050492 Bacteria 17715
469 nmdc:mga0qj67_13530_c1 3300050509 Bacteria 6154
470 nmdc:mga0qj67_55142_c1 3300050509 Bacteria 3148
471 nmdc:mga06r32_21894_c1 3300050510 Bacteria 5903
472 nmdc:mga06r32_223424_c1 3300050510 Bacteria 1871
473 nmdc:mga06r32_282464_c1 3300050510 Bacteria 1647
474 nmdc:mga06r32_87741_c1 3300050510 Bacteria 3036
475 nmdc:mga08y16_123939_c1 3300050511 Bacteria 2689
476 nmdc:mga08y16_15864_c1 3300050511 Bacteria 7917
477 nmdc:mga08y16_19372_c1 3300050511 Bacteria 7173
478 nmdc:mga08y16_32009_c1 3300050511 Bacteria 5531
479 nmdc:mga08y16_45603_c1 3300050511 Bacteria 4594
480 nmdc:mga0n895_26688_c1 3300050512 Bacteria 5475
481 nmdc:mga0n895_31090_c1 3300050512 Bacteria 5109
482 nmdc:mga0n895_33203_c1 3300050512 Bacteria 4958
483 nmdc:mga0rr50_2615_c1 3300050513 Bacteria 10202
484 nmdc:mga0rr50_66334_c1 3300050513 Bacteria 2738
485 nmdc:mga08x19_30396_c1 3300050514 Bacteria 3392
486 nmdc:mga0a205_179585_c1 3300050515 Bacteria 2011
487 nmdc:mga0a205_28348_c1 3300050515 Bacteria 5354
488 nmdc:mga0a205_34318_c1 3300050515 Bacteria 4869
489 nmdc:mga0a205_40649_c1 3300050515 Bacteria 4477
490 nmdc:mga0sz30_33283_c1 3300050516 Bacteria 2141
491 Ga0495601_0000402 3300053077 Bacteria 22920
492 Ga0495601_0031656 3300053077 Bacteria 3288
493 Ga0495612_0001859 3300053078 Bacteria 8670
494 Ga0495612_0002051 3300053078 Bacteria 8298
495 Ga0495612_0028300 3300053078 Bacteria 2256
496 Ga0495595_0000091 3300053084 Bacteria 42155
497 Ga0495619_0000001 3300053085 Bacteria 586054
498 Ga0495619_0000022 3300053085 Bacteria 184144
499 Ga0495619_0000141 3300053085 Bacteria 53921
500 Ga0495619_0000205 3300053085 Bacteria 42913
501 Ga0495619_0003901 3300053085 Bacteria 9588
502 Ga0495619_0033102 3300053085 Bacteria 3356
503 Ga0500643_008100 3300053087 Bacteria 4162
504 Ga0500643_014045 3300053087 Bacteria 2799
505 Ga0500646_0000007 3300053090 Bacteria 115744
506 Ga0500583_0001272 3300053092 Bacteria 7203
507 Ga0500651_0000001 3300053093 Bacteria 529808
508 Ga0500641_0000001 3300053096 Bacteria 1115973
509 Ga0500650_0003961 3300053098 Bacteria 5267
510 Ga0500594_0000208 3300053118 Bacteria 14511
511 Ga0500614_000636 3300053123 Bacteria 8951
512 Ga0500652_000001 3300053131 Bacteria 946868
513 Ga0500616_0019559 3300053153 Bacteria 3815
514 Ga0501084_0012548 3300054114 Bacteria 7019
515 Ga0501084_0148310 3300054114 Bacteria 1976
516 Ga0501082_0011292 3300060353 Bacteria 7678
517 Ga0501082_0036421 3300060353 Bacteria 4239
518 Ga0466962_0011945 3300061719 Bacteria 4178
519 Ga0530510_0122451 3300061734 Bacteria 1910
520 2558908124 2558860112 Bacteria 9931328
521 2558909834 2558860112 Bacteria 9931328
522 2808900635 2808606372 Bacteria 4649509
523 2919396549 2919395869 Bacteria 3704152
524 Ga0075431_100218708
525 LJQas_1000889
526 JGI24740J21852_10003503
527 JGI25407J50210_10009771
528 JGI25407J50210_10014371
529 Ga0070683_100000793
530 Ga0070683_100004343
531 Ga0070683_100045196
532 Ga0070683_100123950
533 Ga0070683_100184096
534 Ga0070670_100145138
535 Ga0070677_10001179
536 Ga0068869_100072572
537 Ga0070680_100012714
538 Ga0070680_100145185
539 Ga0070682_100018266
540 Ga0068868_100011341
541 Ga0068868_100011859
542 Ga0068868_100039560
543 Ga0070660_100000769
544 Ga0070691_10018604
545 Ga0070687_100011246
546 Ga0070661_100000005
547 Ga0070661_100142802
548 Ga0070675_100000058
549 Ga0070674_100025229
550 Ga0070674_100064946
551 Ga0070674_100068087
552 Ga0070673_100232466
553 Ga0070688_100000333
554 Ga0070688_100002150
555 Ga0070688_100061417
556 Ga0070659_100055695
557 Ga0070659_100067879
558 Ga0070659_100070219
559 Ga0070659_100160197
560 Ga0070667_100008884
561 Ga0070714_100040683
562 Ga0070711_100069180
563 Ga0070705_100065617
564 Ga0070700_100001446
565 Ga0070663_100013682
566 Ga0070663_100015589
567 Ga0070662_100161898
568 Ga0068867_100033209
569 Ga0068867_100055299
570 Ga0070685_10000293
571 Ga0070685_10000886
572 Ga0070679_100000088
573 Ga0070679_100028040
574 Ga0070684_100022597
575 Ga0070684_100270109
576 Ga0070665_100303082
577 Ga0070664_100050159
578 Ga0068857_100220354
579 Ga0068854_100041243
580 Ga0068854_100068109
581 Ga0068856_100001818
582 Ga0068856_100003218
583 Ga0068856_100017905
584 Ga0068856_100022808
585 Ga0068852_100000012
586 Ga0068852_100012338
587 Ga0068852_100017295
588 Ga0068852_100061819
589 Ga0068859_100038394
590 Ga0068864_100000043
591 Ga0068864_100009510
592 Ga0068864_100155059
593 Ga0068861_100047802
594 Ga0068861_100072498
595 Ga0068861_100141437
596 Ga0068851_10000988
597 Ga0068863_100000761
598 Ga0068862_100003740
599 Ga0081455_10006775
600 Ga0081538_10000002
601 Ga0081538_10000140
602 Ga0081538_10000263
603 Ga0081538_10001945
604 Ga0081538_10002394
605 Ga0081538_10002441
606 Ga0081538_10003607
607 Ga0081538_10004322
608 Ga0081538_10006088
609 Ga0081538_10006811
610 Ga0081538_10008984
611 Ga0081538_10013516
612 Ga0081538_10027176
613 Ga0081538_10028938
614 Ga0081538_10035459
615 Ga0081538_10078166
616 Ga0081540_1001667
617 Ga0081540_1002235
618 Ga0081540_1050990
619 Ga0081539_10003296
620 Ga0081539_10004860
621 Ga0081539_10012367
622 Ga0081539_10013349
623 Ga0081539_10031571
624 Ga0075365_10000276
625 Ga0075365_10029790
626 Ga0075364_10002860
627 Ga0070712_100000777
628 Ga0070712_100034134
629 Ga0075362_10056537
630 Ga0075369_10034729
631 Ga0075428_100043403
632 Ga0075428_100250590
633 Ga0075430_100040449
634 Ga0075431_100061514
635 Ga0075433_10066035
636 Ga0075433_10139657
637 Ga0075434_100036916
638 Ga0075434_100085741
639 Ga0075429_100014763
640 Ga0068865_100000017
641 Ga0068865_100121249
642 Ga0097620_100038396
643 Ga0075435_100052673
644 Ga0105240_10032516
645 Ga0105240_10064174
646 Ga0111539_10008397
647 Ga0111539_10009996
648 Ga0111539_10101809
649 Ga0111539_10283584
650 Ga0105245_10000056
651 Ga0105245_10001521
652 Ga0105245_10010088
653 Ga0105245_10240217
654 Ga0114129_10010286
655 Ga0114129_10169199
656 Ga0114129_10254539
657 Ga0105243_10006066
658 Ga0105243_10010452
659 Ga0105243_10082929
660 Ga0105242_10013611
661 Ga0105242_10161914
662 Ga0105248_10000032
663 Ga0105248_10086267
664 Ga0105238_10054931
665 Ga0105249_10000331
666 Ga0105249_10004558
667 Ga0105249_10058446
668 Ga0105249_10131733
669 Ga0105239_10022244
670 Ga0105239_10051668
671 Ga0105239_10330320
672 Ga0157370_10007487
673 Ga0157370_10038083
674 Ga0157370_10048328
675 Ga0157369_10000099
676 Ga0157374_10003750
677 Ga0157374_10006293
678 Ga0157378_10008870
679 Ga0157378_10022014
680 Ga0163162_10217361
681 Ga0157372_10033847
682 Ga0157372_10079841
683 Ga0157372_10227501
684 Ga0157375_10000717
685 Ga0157375_10253831
686 Ga0163163_10248875
687 Ga0157380_10000028
688 Ga0157377_10001456
689 Ga0157377_10035285
690 Ga0157377_10040171
691 Ga0157379_10006275
692 Ga0157379_10033027
693 Ga0157379_10131436
694 Ga0157376_10016514
695 Ga0157376_10120412
696 Ga0206353_10592025
697 Ga0213874_10000596
698 Ga0213875_10000039
699 Ga0213875_10000786
700 Ga0207426_1009309
701 Ga0207656_10000559
702 Ga0207656_10014901
703 Ga0207682_10000799
704 Ga0207642_10000854
705 Ga0207688_10004057
706 Ga0207688_10026687
707 Ga0207688_10061805
708 Ga0207680_10002095
709 Ga0207680_10008912
710 Ga0207705_10037460
711 Ga0207705_10112303
712 Ga0207654_10049955
713 Ga0207707_10010959
714 Ga0207693_10000853
715 Ga0207693_10045654
716 Ga0207693_10059118
717 Ga0207693_10089288
718 Ga0207663_10032289
719 Ga0207663_10063936
720 Ga0207660_10003389
721 Ga0207660_10161199
722 Ga0207657_10017412
723 Ga0207657_10021488
724 Ga0207649_10000005
725 Ga0207652_10000286
726 Ga0207652_10006790
727 Ga0207652_10227385
728 Ga0207694_10033893
729 Ga0207659_10000020
730 Ga0207687_10000007
731 Ga0207687_10000105
732 Ga0207687_10004167
733 Ga0207687_10075663
734 Ga0207687_10112530
735 Ga0207644_10086493
736 Ga0207706_10016720
737 Ga0207706_10045533
738 Ga0207686_10170020
739 Ga0207669_10000029
740 Ga0207669_10051312
741 Ga0207704_10000025
742 Ga0207704_10142943
743 Ga0207665_10001721
744 Ga0207691_10034978
745 Ga0207711_10000020
746 Ga0207711_10209752
747 Ga0207689_10068637
748 Ga0207689_10088109
749 Ga0207661_10038998
750 Ga0207661_10053877
751 Ga0207661_10067195
752 Ga0207661_10106285
753 Ga0207679_10038668
754 Ga0207679_10040314
755 Ga0207679_10066784
756 Ga0207679_10067178
757 Ga0207651_10077705
758 Ga0207712_10000032
759 Ga0207712_10004596
760 Ga0207668_10037672
761 Ga0207640_10000137
762 Ga0207640_10018760
763 Ga0207640_10050126
764 Ga0207658_10003652
765 Ga0207703_10000030
766 Ga0207639_10027335
767 Ga0207678_10008257
768 Ga0207678_10023587
769 Ga0207678_10028022
770 Ga0207708_10000398
771 Ga0207702_10000016
772 Ga0207702_10013026
773 Ga0207641_10001906
774 Ga0207648_10036694
775 Ga0207648_10043465
776 Ga0207648_10109204
777 Ga0207648_10124303
778 Ga0207676_10000042
779 Ga0207676_10195261
780 Ga0207675_100003658
781 Ga0207675_100052523
782 Ga0207675_100112576
783 Ga0207683_10003687
784 Ga0207683_10005133
785 Ga0207698_10000012
786 Ga0207698_10008710
787 Ga0207428_10024080
788 Ga0207428_10026444
789 Ga0207428_10037296
790 Ga0207428_10089474
791 Ga0207428_10094357
792 Ga0268266_10000216
793 Ga0268266_10000553
794 Ga0268266_10014029
795 Ga0268266_10090581
796 Ga0268265_10005149
797 Ga0265337_1000069
798 Ga0265326_10000012
799 Ga0265322_10000003
800 Ga0265324_10000398
801 Ga0265328_10000555
802 Ga0265320_10000001
803 Ga0265329_10001477
804 Ga0265331_10001290
805 Ga0265327_10000003
806 Ga0265314_10000044
807 Ga0265342_10064053
808 Ga0307410_10115053
809 Ga0307406_10066888
810 Ga0307406_10103361
811 Ga0307406_10168228
812 Ga0307409_100051998
813 Ga0307416_100143311
814 Ga0307416_100168880
815 Ga0307415_100000897
816 Ga0395899_0050808
817 Ga0395900_0021837
818 Ga0395900_0063212
819 Ga0395900_0064246
820 Ga0395898_0031372
821 Ga0436364_0462369
822 Ga0436364_0633675
823 Ga0395901_0117188
824 Ga0436363_0044269
825 Ga0466963_0000012
826 Ga0466963_0011126
827 Ga0466963_0025126
828 Ga0466964_0035712
829 Ga0466971_0002588
830 Ga0466971_0026275
831 Ga0466957_0003292
832 Ga0466957_0029203
833 Ga0466957_0033812
834 Ga0466959_0091576
835 Ga0451576_0140343
836 Ga0466958_0019028
837 Ga0466958_0121870
838 Ga0466967_0000344
839 Ga0466967_0002951
840 Ga0466967_0060767
841 Ga0495592_0051783
842 Ga0495629_0003392
843 Ga0495638_0011572
844 Ga0495641_0000004
845 Ga0495650_0000079
846 Ga0495606_0000211
847 Ga0495608_0000208
848 Ga0495608_0030777
849 Ga0495620_0001177
850 Ga0495630_0000025
851 Ga0495630_0001088
852 Ga0495652_0000003
853 Ga0495652_0001501
854 Ga0495667_0030451
855 Ga0495634_0000002
856 Ga0495634_0000191
857 Ga0495634_0016502
858 Ga0495625_0000029
859 Ga0495635_0004480
860 Ga0495588_0000311
861 Ga0495588_0051087
862 Ga0495657_0000406
863 Ga0495647_0000005
864 Ga0495647_0000289
865 Ga0495658_0000876
866 Ga0495669_0000188
867 Ga0495674_0032548
868 Ga0495676_0000320
869 Ga0495680_0019110
870 Ga0495675_0002624
871 Ga0495679_016729
872 Ga0495602_0061367
873 Ga0495602_0098875
874 Ga0496100_0000006
875 Ga0496101_0000009
876 Ga0496101_0063915
877 Ga0496101_0170116
878 Ga0496102_0014400
879 Ga0496102_0254999
880 Ga0496102_0259199
881 Ga0496103_0016855
882 Ga0496104_0000008
883 Ga0496104_0000010
884 Ga0496104_0002857
885 Ga0496105_0000003
886 Ga0496105_0000005
887 Ga0496105_0032204
888 Ga0496105_0041057
889 Ga0496105_0130048
890 Ga0496105_0136304
891 Ga0496106_0000172
892 Ga0496106_0001026
893 Ga0496106_0005559
894 Ga0496106_0023461
895 Ga0496106_0034859
896 Ga0496107_0000693
897 Ga0496107_0081208
898 Ga0496107_0086445
899 Ga0496108_0000004
900 Ga0496108_0000045
901 Ga0496108_0032467
902 Ga0496109_0000013
903 Ga0496109_0000032
904 Ga0496109_0000252
905 Ga0496110_0000386
906 Ga0496110_0040193
907 Ga0496110_0049014
908 Ga0496111_0000225
909 Ga0496111_0028724
910 Ga0496111_0186629
911 Ga0496112_0000362
912 Ga0496112_0067459
913 Ga0496112_0121416
914 Ga0496112_0131303
915 Ga0496113_0000127
916 Ga0496113_0003820
917 Ga0496113_0049089
918 Ga0496113_0061953
919 Ga0496114_0139420
920 Ga0496114_0146241
921 Ga0496114_0204994
922 Ga0496115_0000020
923 Ga0496115_0005197
924 Ga0496115_0061955
925 Ga0496116_0001659
926 Ga0496117_0002954
927 Ga0496118_0004753
928 Ga0496118_0031058
929 Ga0496119_0003832
930 Ga0496119_0005699
931 Ga0496119_0026226
932 Ga0496120_0018303
933 Ga0496121_0013909
934 Ga0496121_0024190
935 Ga0496121_0028063
936 Ga0496124_0010869
937 Ga0496124_0104111
938 Ga0496124_0153736
939 Ga0496125_0027583
940 Ga0496125_0067149
941 Ga0496125_0087036
942 Ga0501318_002595
943 Ga0501319_000699
944 Ga0501031_0003383
945 Ga0501032_0067461
946 Ga0501034_0003570
947 Ga0501034_0007826
948 Ga0501034_0009920
949 Ga0501034_0041963
950 Ga0501036_0006019
951 Ga0501036_0017378
952 Ga0501037_0005002
953 Ga0501038_0007121
954 Ga0501039_0014729
955 Ga0501039_0201198
956 Ga0501040_0051516
957 Ga0501040_0059630
958 Ga0501040_0104383
959 Ga0501042_0124705
960 Ga0501043_0005695
961 Ga0501046_0007044
962 Ga0501046_0102382
963 Ga0501047_0001844
964 Ga0501048_0005493
965 Ga0501048_0038197
966 Ga0501068_0060042
967 Ga0501069_0000572
968 Ga0501070_0005807
969 Ga0501070_0007740
970 Ga0501070_0016259
971 Ga0501071_0026264
972 Ga0501071_0051950
973 Ga0501072_0010167
974 Ga0501072_0038623
975 Ga0501073_0005281
976 Ga0501074_0060368
977 Ga0501074_0123871
978 Ga0501075_0017406
979 Ga0501075_0061649
980 Ga0501076_0036556
981 Ga0501077_0013588
982 Ga0501080_0039881
983 Ga0501080_0158808
984 Ga0501083_0004654
985 Ga0501083_0040033
986 Ga0501035_0003153
987 Ga0501044_0004479
988 Ga0501044_0023400
989 nmdc:mga03683_12941_c1
990 nmdc:mga00v17_2330_c1
991 nmdc:mga0yw44_272_c1
992 nmdc:mga0qj67_13530_c1
993 nmdc:mga0qj67_55142_c1
994 nmdc:mga06r32_21894_c1
995 nmdc:mga06r32_223424_c1
996 nmdc:mga06r32_282464_c1
997 nmdc:mga06r32_87741_c1
998 nmdc:mga08y16_123939_c1
999 nmdc:mga08y16_15864_c1
1000 nmdc:mga08y16_19372_c1
1001 nmdc:mga08y16_32009_c1
1002 nmdc:mga08y16_45603_c1
1003 nmdc:mga0n895_26688_c1
1004 nmdc:mga0n895_31090_c1
1005 nmdc:mga0n895_33203_c1
1006 nmdc:mga0rr50_2615_c1
1007 nmdc:mga0rr50_66334_c1
1008 nmdc:mga08x19_30396_c1
1009 nmdc:mga0a205_179585_c1
1010 nmdc:mga0a205_28348_c1
1011 nmdc:mga0a205_34318_c1
1012 nmdc:mga0a205_40649_c1
1013 nmdc:mga0sz30_33283_c1
1014 Ga0495601_0000402
1015 Ga0495601_0031656
1016 Ga0495612_0001859
1017 Ga0495612_0002051
1018 Ga0495612_0028300
1019 Ga0495595_0000091
1020 Ga0495619_0000001
1021 Ga0495619_0000022
1022 Ga0495619_0000141
1023 Ga0495619_0000205
1024 Ga0495619_0003901
1025 Ga0495619_0033102
1026 Ga0500643_008100
1027 Ga0500643_014045
1028 Ga0500646_0000007
1029 Ga0500583_0001272
1030 Ga0500651_0000001
1031 Ga0500641_0000001
1032 Ga0500650_0003961
1033 Ga0500594_0000208
1034 Ga0500614_000636
1035 Ga0500652_000001
1036 Ga0500616_0019559
1037 Ga0501084_0012548
1038 Ga0501084_0148310
1039 Ga0501082_0011292
1040 Ga0501082_0036421
1041 Ga0466962_0011945
1042 Ga0530510_0122451
1043 2558908124
1044 2558909834
1045 2808900635
1046 2919396549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

73

468

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

68

247

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8934 13 465
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8926 13 465
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8911 13 465
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8896 12 465
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8893 13 465
ID Description Score Start End Superfamily
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9546 16 214 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9539 14 247 1.20.1250.20
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9512 14 238 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9471 13 201 1.20.1250.20
af_Q2FVL1_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9428 33 212 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A372JM89-F1-model_v4 MFS transporter 0.9866 15 119 GO:0016020
GO:0022857
AF-A0A656JVK0-F1-model_v4 Membrane protein 0.9738 31 130 GO:0016020
GO:0022857
AF-A0A535C655-F1-model_v4 MFS transporter 0.9735 6 126 GO:0016020
GO:0022857
AF-A0A358L8V1-F1-model_v4 EmrB/QacA family drug resistance transporter 0.9688 12 191 GO:0005886
GO:0022857
AF-A0A2V7LDE2-F1-model_v4 Multidrug efflux MFS transporter 0.9674 9 169 GO:0005886
GO:0022857

Map