F459022

General Info

Members Datasets Scaffolds Average Seq Length
523 266 1046 143

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0016712|Ga0451577_0016712_1312_1752
Length 146
Sequence MFTPTKSEVRRFFRETWRKHRAAELLSPIEAMALDWIIEHPEYHEELAQTGEDAEYRVEDGRTNPFLHLSMHLAIAEQLSIDQPPGIRTAYERLVRRRGDAHRAAHAVMECLGEVVWAAQRAGQALPPDEMSARYLDCLARQAGQN

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
95 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
212 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
266 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.38
Rhizoplane 3.25
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0016712 3300042876 Bacteria 6785
2 JGI25162J39368_1000091 3300002737 Bacteria 101521
3 JGI25163J39215_1002283 3300002771 Bacteria 2087
4 JGI25165J46597_1000172 3300003214 Bacteria 101521
5 rootH2_10028526 3300003320 Bacteria 9703
6 rootL2_10003861 3300003322 Bacteria 52646
7 rootL2_10200614 3300003322 Bacteria 1941
8 JGI26128J50194_1000122 3300003347 Bacteria 3216
9 Ga0055538_1000063 3300003751 Bacteria 101521
10 Ga0055539_1000096 3300003752 Bacteria 101521
11 Ga0055533_1000107 3300003756 Bacteria 101521
12 Ga0055525_1000140 3300003759 Bacteria 101521
13 Ga0055524_1000554 3300003775 Bacteria 28221
14 Ga0055531_10005291 3300003794 Bacteria 7572
15 Ga0055531_10010645 3300003794 Bacteria 4544
16 Ga0055541_1000064 3300003841 Bacteria 101521
17 Ga0055543_1002200 3300004625 Bacteria 6670
18 Ga0065165_1000935 3300005262 Bacteria 37344
19 Ga0065165_1008803 3300005262 Bacteria 4648
20 Ga0065165_1111094 3300005262 Bacteria 675
21 Ga0070658_11414088 3300005327 Bacteria 604
22 Ga0070676_10001408 3300005328 Bacteria 12133
23 Ga0070676_10004967 3300005328 Bacteria 7042
24 Ga0070676_10009747 3300005328 Bacteria 5195
25 Ga0070676_10018791 3300005328 Bacteria 3835
26 Ga0070676_10298896 3300005328 Bacteria 1091
27 Ga0070690_100162578 3300005330 Bacteria 1531
28 Ga0070670_100113747 3300005331 Bacteria 2333
29 Ga0070670_100138063 3300005331 Bacteria 2107
30 Ga0070670_100392130 3300005331 Bacteria 1225
31 Ga0070670_101124493 3300005331 Bacteria 717
32 Ga0070677_10000846 3300005333 Bacteria 10060
33 Ga0070677_10202977 3300005333 Bacteria 958
34 Ga0068869_100004351 3300005334 Bacteria 8792
35 Ga0068869_100387358 3300005334 Bacteria 1147
36 Ga0068869_100740793 3300005334 Bacteria 841
37 Ga0070666_10008700 3300005335 Bacteria 6313
38 Ga0070666_10025822 3300005335 Bacteria 3832
39 Ga0070666_10289678 3300005335 Bacteria 1165
40 Ga0070682_100884641 3300005337 Bacteria 733
41 Ga0068868_100003852 3300005338 Bacteria 10472
42 Ga0068868_100275248 3300005338 Bacteria 1423
43 Ga0068868_100343214 3300005338 Bacteria 1277
44 Ga0070660_100003506 3300005339 Bacteria 10811
45 Ga0070660_100572978 3300005339 Bacteria 943
46 Ga0070689_100052651 3300005340 Bacteria 3149
47 Ga0070687_100260240 3300005343 Bacteria 1082
48 Ga0070661_100011319 3300005344 Bacteria 6216
49 Ga0070661_100033975 3300005344 Bacteria 3697
50 Ga0070668_100003174 3300005347 Bacteria 12114
51 Ga0070668_100004363 3300005347 Bacteria 10496
52 Ga0070668_100105726 3300005347 Bacteria 2236
53 Ga0070668_100336119 3300005347 Bacteria 1275
54 Ga0070669_100000817 3300005353 Bacteria 22645
55 Ga0070669_100097311 3300005353 Bacteria 2215
56 Ga0070669_100365105 3300005353 Bacteria 1175
57 Ga0070669_100386591 3300005353 Bacteria 1142
58 Ga0070669_100441834 3300005353 Bacteria 1071
59 Ga0070675_100002002 3300005354 Bacteria 15120
60 Ga0070675_100065677 3300005354 Bacteria 3000
61 Ga0070675_100104521 3300005354 Bacteria 2389
62 Ga0070675_100155351 3300005354 Bacteria 1964
63 Ga0070671_100001815 3300005355 Bacteria 16242
64 Ga0070671_100009126 3300005355 Bacteria 7963
65 Ga0070671_100017039 3300005355 Bacteria 5877
66 Ga0070671_100028404 3300005355 Bacteria 4606
67 Ga0070671_100110609 3300005355 Bacteria 2308
68 Ga0070674_100000889 3300005356 Bacteria 15611
69 Ga0070674_100013295 3300005356 Bacteria 5086
70 Ga0070674_100090772 3300005356 Bacteria 2204
71 Ga0070674_100151008 3300005356 Bacteria 1753
72 Ga0070673_100002920 3300005364 Bacteria 10532
73 Ga0070673_100069663 3300005364 Bacteria 2820
74 Ga0070673_100507760 3300005364 Bacteria 1091
75 Ga0070673_100565483 3300005364 Bacteria 1034
76 Ga0070688_100121574 3300005365 Bacteria 1750
77 Ga0070659_100002098 3300005366 Bacteria 14204
78 Ga0070659_100166386 3300005366 Bacteria 1804
79 Ga0070667_100008195 3300005367 Bacteria 8661
80 Ga0070667_100016286 3300005367 Bacteria 6149
81 Ga0070667_100292347 3300005367 Bacteria 1465
82 Ga0070667_100422540 3300005367 Bacteria 1215
83 Ga0070667_100601969 3300005367 Bacteria 1013
84 Ga0070667_100682046 3300005367 Bacteria 950
85 Ga0070667_101038536 3300005367 Bacteria 765
86 Ga0070701_10481952 3300005438 Bacteria 802
87 Ga0070705_100332479 3300005440 Bacteria 1101
88 Ga0070700_100444633 3300005441 Bacteria 985
89 Ga0070663_100031262 3300005455 Bacteria 3658
90 Ga0070663_100489797 3300005455 Bacteria 1019
91 Ga0070663_100942422 3300005455 Bacteria 748
92 Ga0070678_100002961 3300005456 Bacteria 9406
93 Ga0070678_100093057 3300005456 Bacteria 2317
94 Ga0070678_100096171 3300005456 Bacteria 2284
95 Ga0070678_100260933 3300005456 Bacteria 1457
96 Ga0070678_101646529 3300005456 Bacteria 603
97 Ga0070662_100000180 3300005457 Bacteria 36959
98 Ga0070681_10065398 3300005458 Bacteria 3605
99 Ga0068867_100000687 3300005459 Bacteria 22454
100 Ga0068867_100004020 3300005459 Bacteria 10347
101 Ga0068867_100016329 3300005459 Bacteria 5271
102 Ga0068867_100043237 3300005459 Bacteria 3298
103 Ga0068867_100226238 3300005459 Bacteria 1510
104 Ga0070685_10154248 3300005466 Bacteria 1458
105 Ga0070706_100003982 3300005467 Bacteria 14377
106 Ga0070707_100370008 3300005468 Bacteria 1392
107 Ga0070698_100345754 3300005471 Bacteria 1418
108 Ga0070679_101189037 3300005530 Bacteria 708
109 Ga0068853_100008603 3300005539 Bacteria 8205
110 Ga0068853_100008741 3300005539 Bacteria 8149
111 Ga0068853_101481632 3300005539 Bacteria 657
112 Ga0070672_100016047 3300005543 Bacteria 5354
113 Ga0070672_100024445 3300005543 Bacteria 4466
114 Ga0070665_100036965 3300005548 Bacteria 4910
115 Ga0070665_100049119 3300005548 Bacteria 4234
116 Ga0070665_100155357 3300005548 Bacteria 2290
117 Ga0070665_100331773 3300005548 Bacteria 1526
118 Ga0070665_100874237 3300005548 Bacteria 912
119 Ga0070665_101417651 3300005548 Bacteria 704
120 Ga0068855_100002343 3300005563 Bacteria 23382
121 Ga0070664_100008706 3300005564 Bacteria 8216
122 Ga0070664_100150352 3300005564 Bacteria 2055
123 Ga0070664_100494267 3300005564 Bacteria 1127
124 Ga0070664_101369341 3300005564 Bacteria 669
125 Ga0068854_100106951 3300005578 Bacteria 2105
126 Ga0068854_100394263 3300005578 Bacteria 1144
127 Ga0068856_100009865 3300005614 Bacteria 9273
128 Ga0068856_100032873 3300005614 Bacteria 5080
129 Ga0068856_100712323 3300005614 Bacteria 1024
130 Ga0070702_100055303 3300005615 Bacteria 2288
131 Ga0068852_100006233 3300005616 Bacteria 8602
132 Ga0068852_100952156 3300005616 Bacteria 877
133 Ga0068852_100989337 3300005616 Bacteria 860
134 Ga0068859_100003171 3300005617 Bacteria 16728
135 Ga0068859_100249247 3300005617 Bacteria 1866
136 Ga0068859_100347915 3300005617 Bacteria 1577
137 Ga0068859_100429755 3300005617 Bacteria 1417
138 Ga0068859_101105012 3300005617 Bacteria 872
139 Ga0068859_101158620 3300005617 Bacteria 851
140 Ga0068864_100038757 3300005618 Bacteria 4071
141 Ga0068864_100359243 3300005618 Bacteria 1376
142 Ga0068864_100807977 3300005618 Bacteria 922
143 Ga0068864_101081259 3300005618 Bacteria 798
144 Ga0068864_101678780 3300005618 Bacteria 640
145 Ga0068861_100200794 3300005719 Bacteria 1673
146 Ga0068861_100258818 3300005719 Bacteria 1489
147 Ga0068861_101328342 3300005719 Bacteria 700
148 Ga0068851_10094212 3300005834 Bacteria 1581
149 Ga0068851_10174668 3300005834 Bacteria 1187
150 Ga0068870_10004960 3300005840 Bacteria 5769
151 Ga0068863_100066881 3300005841 Bacteria 3399
152 Ga0068863_100167308 3300005841 Bacteria 2108
153 Ga0068863_100609509 3300005841 Bacteria 1081
154 Ga0068858_100019735 3300005842 Bacteria 6301
155 Ga0068858_100087594 3300005842 Bacteria 2896
156 Ga0068858_100373423 3300005842 Bacteria 1368
157 Ga0068860_100011299 3300005843 Bacteria 8798
158 Ga0068860_100261464 3300005843 Bacteria 1687
159 Ga0068860_100361755 3300005843 Bacteria 1430
160 Ga0068860_100884036 3300005843 Bacteria 909
161 Ga0068862_100113584 3300005844 Bacteria 2380
162 Ga0068862_100966032 3300005844 Bacteria 841
163 Ga0081455_10517387 3300005937 Bacteria 797
164 Ga0075367_10009174 3300006178 Bacteria 5159
165 Ga0075369_10283290 3300006186 Bacteria 772
166 Ga0075366_10066891 3300006195 Bacteria 2138
167 Ga0075366_10182629 3300006195 Bacteria 1274
168 Ga0075366_10283750 3300006195 Bacteria 1012
169 Ga0097621_100006240 3300006237 Bacteria 8458
170 Ga0097621_100017506 3300006237 Bacteria 5443
171 Ga0097621_100212900 3300006237 Bacteria 1681
172 Ga0075370_10012062 3300006353 Bacteria 4557
173 Ga0075370_10076020 3300006353 Bacteria 1925
174 Ga0068871_100001123 3300006358 Bacteria 17958
175 Ga0068871_100245764 3300006358 Bacteria 1557
176 Ga0068871_100269262 3300006358 Bacteria 1488
177 Ga0075428_100045141 3300006844 Bacteria 4842
178 Ga0075428_100101471 3300006844 Bacteria 3137
179 Ga0075433_10795999 3300006852 Bacteria 826
180 Ga0075434_100245583 3300006871 Bacteria 1810
181 Ga0075429_100522697 3300006880 Bacteria 1040
182 Ga0068865_100007114 3300006881 Bacteria 6872
183 Ga0068865_100709591 3300006881 Bacteria 860
184 Ga0097620_100003171 3300006931 Bacteria 16728
185 Ga0097620_100249250 3300006931 Bacteria 1866
186 Ga0097620_100347908 3300006931 Bacteria 1577
187 Ga0097620_100429713 3300006931 Bacteria 1417
188 Ga0097620_100561963 3300006931 Bacteria 1235
189 Ga0097620_101105036 3300006931 Bacteria 872
190 Ga0097620_101158842 3300006931 Bacteria 851
191 Ga0099823_1000083 3300006944 Bacteria 44975
192 Ga0105240_10005445 3300009093 Bacteria 18965
193 Ga0111539_12472205 3300009094 Bacteria 602
194 Ga0105245_11614337 3300009098 Bacteria 700
195 Ga0114129_10523670 3300009147 Bacteria 1545
196 Ga0114129_11997739 3300009147 Bacteria 701
197 Ga0105241_11115655 3300009174 Bacteria 743
198 Ga0105248_10698076 3300009177 Bacteria 1145
199 Ga0105237_10004231 3300009545 Bacteria 16718
200 Ga0105238_10002848 3300009551 Bacteria 17266
201 Ga0105249_11176091 3300009553 Bacteria 838
202 Ga0105239_10000467 3300010375 Bacteria 59045
203 Ga0157317_1000984 3300012475 Bacteria 1431
204 Ga0157319_1000009 3300012497 Bacteria 227971
205 Ga0157373_10002400 3300013100 Bacteria 14226
206 Ga0157373_10249830 3300013100 Bacteria 1254
207 Ga0157373_10898074 3300013100 Bacteria 657
208 Ga0157371_10000194 3300013102 Bacteria 90011
209 Ga0157374_10014972 3300013296 Bacteria 6795
210 Ga0157374_10054458 3300013296 Bacteria 3731
211 Ga0157374_10687188 3300013296 Bacteria 1036
212 Ga0157378_10018119 3300013297 Bacteria 6183
213 Ga0163162_10009609 3300013306 Bacteria 9409
214 Ga0163162_10043193 3300013306 Bacteria 4513
215 Ga0163162_10391147 3300013306 Bacteria 1523
216 Ga0163162_10801242 3300013306 Bacteria 1059
217 Ga0163162_12068472 3300013306 Bacteria 653
218 Ga0157372_10002701 3300013307 Bacteria 19180
219 Ga0157372_12622983 3300013307 Bacteria 578
220 Ga0157375_10188412 3300013308 Bacteria 2217
221 Ga0157375_10368629 3300013308 Bacteria 1602
222 Ga0163163_10150902 3300014325 Bacteria 2368
223 Ga0163163_10262587 3300014325 Bacteria 1778
224 Ga0163163_11066300 3300014325 Unclassified 871
225 Ga0157379_10005934 3300014968 Bacteria 10518
226 Ga0157379_10022942 3300014968 Bacteria 5532
227 Ga0157376_10589926 3300014969 Bacteria 1105
228 Ga0163161_10009732 3300017792 Bacteria 6659
229 Ga0163161_10093852 3300017792 Bacteria 2224
230 Ga0213872_10000358 3300021361 Bacteria 38353
231 Ga0209760_101246 3300025207 Bacteria 2829
232 Ga0209784_100079 3300025224 Bacteria 136351
233 Ga0209566_100093 3300025225 Bacteria 136351
234 Ga0209674_100115 3300025226 Bacteria 136351
235 Ga0209563_100113 3300025230 Bacteria 136351
236 Ga0207427_100262 3300025231 Bacteria 40896
237 Ga0209437_100176 3300025233 Bacteria 136351
238 Ga0209677_100072 3300025253 Bacteria 136351
239 Ga0209233_1000183 3300025261 Bacteria 136351
240 Ga0209673_1015105 3300025273 Bacteria 2951
241 Ga0209673_1022853 3300025273 Bacteria 2145
242 Ga0209673_1040755 3300025273 Bacteria 1326
243 Ga0209564_1000003 3300025295 Bacteria 1585848
244 Ga0209050_1000202 3300025298 Bacteria 133468
245 Ga0209050_1014101 3300025298 Bacteria 3476
246 Ga0209256_1000471 3300025299 Bacteria 60530
247 Ga0209256_1001715 3300025299 Bacteria 21046
248 Ga0209256_1055650 3300025299 Bacteria 939
249 Ga0209051_1002398 3300025303 Bacteria 13498
250 Ga0209257_1001664 3300025304 Bacteria 25177
251 Ga0209257_1008776 3300025304 Bacteria 5617
252 Ga0209257_1041657 3300025304 Bacteria 1361
253 Ga0207697_10052425 3300025315 Bacteria 1688
254 Ga0207697_10061319 3300025315 Bacteria 1565
255 Ga0207656_10030564 3300025321 Bacteria 2226
256 Ga0207656_10125627 3300025321 Bacteria 1198
257 Ga0207682_10003176 3300025893 Bacteria 7196
258 Ga0207682_10005109 3300025893 Bacteria 5376
259 Ga0207682_10173462 3300025893 Bacteria 982
260 Ga0207688_10031758 3300025901 Bacteria 2917
261 Ga0207688_10134674 3300025901 Bacteria 1450
262 Ga0207680_10154596 3300025903 Bacteria 1532
263 Ga0207680_10165623 3300025903 Bacteria 1485
264 Ga0207680_10429514 3300025903 Bacteria 936
265 Ga0207645_10000143 3300025907 Bacteria 55663
266 Ga0207645_10000995 3300025907 Bacteria 23383
267 Ga0207645_10013147 3300025907 Bacteria 5590
268 Ga0207645_10027328 3300025907 Bacteria 3686
269 Ga0207645_10198698 3300025907 Bacteria 1319
270 Ga0207643_10005029 3300025908 Bacteria 7083
271 Ga0207705_10198207 3300025909 Bacteria 1521
272 Ga0207684_10004653 3300025910 Bacteria 12885
273 Ga0207707_10049899 3300025912 Bacteria 3646
274 Ga0207695_10011417 3300025913 Bacteria 10764
275 Ga0207671_10002430 3300025914 Bacteria 19948
276 Ga0207662_10798187 3300025918 Bacteria 665
277 Ga0207657_10003358 3300025919 Bacteria 17114
278 Ga0207657_10246926 3300025919 Bacteria 1424
279 Ga0207657_10383333 3300025919 Bacteria 1107
280 Ga0207649_11154855 3300025920 Bacteria 612
281 Ga0207681_10108155 3300025923 Bacteria 2018
282 Ga0207681_10116464 3300025923 Bacteria 1952
283 Ga0207681_10204703 3300025923 Bacteria 1517
284 Ga0207681_10797237 3300025923 Bacteria 789
285 Ga0207681_10830696 3300025923 Bacteria 772
286 Ga0207650_10079732 3300025925 Bacteria 2480
287 Ga0207650_10100242 3300025925 Bacteria 2228
288 Ga0207650_10140026 3300025925 Bacteria 1901
289 Ga0207650_11277882 3300025925 Bacteria 625
290 Ga0207659_10007684 3300025926 Bacteria 6652
291 Ga0207659_10011417 3300025926 Bacteria 5611
292 Ga0207659_10094408 3300025926 Bacteria 2241
293 Ga0207659_10149571 3300025926 Bacteria 1822
294 Ga0207687_10393990 3300025927 Bacteria 1137
295 Ga0207687_10521209 3300025927 Bacteria 994
296 Ga0207644_10002491 3300025931 Bacteria 11854
297 Ga0207644_10008045 3300025931 Bacteria 6898
298 Ga0207644_10010360 3300025931 Bacteria 6145
299 Ga0207644_10017326 3300025931 Bacteria 4863
300 Ga0207690_10000286 3300025932 Bacteria 35939
301 Ga0207706_10000002 3300025933 Bacteria 360309
302 Ga0207706_10927926 3300025933 Bacteria 734
303 Ga0207686_10324830 3300025934 Bacteria 1151
304 Ga0207709_10561332 3300025935 Bacteria 899
305 Ga0207669_10083526 3300025937 Bacteria 2054
306 Ga0207669_10087483 3300025937 Bacteria 2018
307 Ga0207669_10092788 3300025937 Bacteria 1971
308 Ga0207669_11083735 3300025937 Bacteria 676
309 Ga0207704_10217617 3300025938 Bacteria 1410
310 Ga0207691_10000016 3300025940 Bacteria 141024
311 Ga0207691_10004984 3300025940 Bacteria 12808
312 Ga0207691_10113465 3300025940 Bacteria 2408
313 Ga0207691_10971354 3300025940 Bacteria 709
314 Ga0207711_10514437 3300025941 Bacteria 1116
315 Ga0207689_10139011 3300025942 Bacteria 2001
316 Ga0207689_10247702 3300025942 Bacteria 1473
317 Ga0207689_10259606 3300025942 Bacteria 1437
318 Ga0207689_10292958 3300025942 Bacteria 1348
319 Ga0207689_11099016 3300025942 Bacteria 670
320 Ga0207679_10001831 3300025945 Bacteria 13228
321 Ga0207667_10004685 3300025949 Bacteria 16739
322 Ga0207651_10100081 3300025960 Bacteria 2148
323 Ga0207651_10228340 3300025960 Bacteria 1509
324 Ga0207651_10250123 3300025960 Bacteria 1450
325 Ga0207668_10024734 3300025972 Bacteria 3880
326 Ga0207668_10058197 3300025972 Bacteria 2700
327 Ga0207668_10063979 3300025972 Bacteria 2597
328 Ga0207640_10147460 3300025981 Bacteria 1724
329 Ga0207640_10974728 3300025981 Bacteria 744
330 Ga0207658_10044583 3300025986 Bacteria 3229
331 Ga0207658_10090715 3300025986 Bacteria 2369
332 Ga0207658_10250860 3300025986 Bacteria 1504
333 Ga0207658_10342817 3300025986 Bacteria 1299
334 Ga0207658_10371654 3300025986 Bacteria 1250
335 Ga0207658_10749707 3300025986 Bacteria 884
336 Ga0207658_10923641 3300025986 Bacteria 795
337 Ga0207677_10011884 3300026023 Bacteria 4983
338 Ga0207703_10090094 3300026035 Bacteria 2577
339 Ga0207703_10189298 3300026035 Bacteria 1821
340 Ga0207703_10452395 3300026035 Bacteria 1200
341 Ga0207703_10533598 3300026035 Bacteria 1105
342 Ga0207639_10004632 3300026041 Bacteria 9258
343 Ga0207639_10261268 3300026041 Bacteria 1514
344 Ga0207639_10634571 3300026041 Bacteria 987
345 Ga0207639_10999637 3300026041 Bacteria 783
346 Ga0207708_10334543 3300026075 Bacteria 1239
347 Ga0207702_10012572 3300026078 Bacteria 7042
348 Ga0207702_10078953 3300026078 Bacteria 2851
349 Ga0207702_10429062 3300026078 Bacteria 1279
350 Ga0207641_10213555 3300026088 Bacteria 1785
351 Ga0207641_10448741 3300026088 Bacteria 1246
352 Ga0207641_10658329 3300026088 Bacteria 1029
353 Ga0207648_10009135 3300026089 Bacteria 9529
354 Ga0207648_10011657 3300026089 Bacteria 8274
355 Ga0207648_10016618 3300026089 Bacteria 6717
356 Ga0207648_10064537 3300026089 Bacteria 3191
357 Ga0207648_11361690 3300026089 Bacteria 667
358 Ga0207676_10053509 3300026095 Bacteria 3160
359 Ga0207676_10355633 3300026095 Bacteria 1356
360 Ga0207676_10573726 3300026095 Bacteria 1081
361 Ga0207674_10180301 3300026116 Bacteria 2064
362 Ga0207675_100076949 3300026118 Bacteria 3125
363 Ga0207675_100085579 3300026118 Bacteria 2959
364 Ga0207675_101711223 3300026118 Bacteria 649
365 Ga0207683_10000057 3300026121 Bacteria 84479
366 Ga0207683_10001224 3300026121 Bacteria 23300
367 Ga0207683_10031486 3300026121 Bacteria 4604
368 Ga0207683_10121742 3300026121 Bacteria 2343
369 Ga0207683_10743904 3300026121 Bacteria 910
370 Ga0207683_10932814 3300026121 Bacteria 806
371 Ga0207683_11074702 3300026121 Bacteria 747
372 Ga0207698_10029945 3300026142 Bacteria 3907
373 Ga0207698_10285691 3300026142 Bacteria 1528
374 Ga0207698_10940323 3300026142 Bacteria 873
375 Ga0209389_1004365 3300027296 Bacteria 11746
376 Ga0209371_1023197 3300027312 Bacteria 1466
377 Ga0209968_1000538 3300027526 Bacteria 5927
378 Ga0209999_1010658 3300027543 Bacteria 1661
379 Ga0209971_1006464 3300027682 Bacteria 2771
380 Ga0209966_1000382 3300027695 Bacteria 13432
381 Ga0209974_10008602 3300027876 Bacteria 3483
382 Ga0268266_10007438 3300028379 Bacteria 9884
383 Ga0268266_10111665 3300028379 Bacteria 2422
384 Ga0268266_10223612 3300028379 Bacteria 1731
385 Ga0268266_10305142 3300028379 Bacteria 1486
386 Ga0268266_10573860 3300028379 Bacteria 1082
387 Ga0268264_10008275 3300028381 Bacteria 8641
388 Ga0268264_10127155 3300028381 Bacteria 2254
389 Ga0268264_10163566 3300028381 Bacteria 2007
390 Ga0268264_10259935 3300028381 Bacteria 1617
391 Ga0268264_10261750 3300028381 Bacteria 1612
392 Ga0268264_11034200 3300028381 Bacteria 829
393 Ga0307515_10116179 3300028794 Bacteria 3074
394 Ga0268256_1085562 3300030500 Bacteria 582
395 Ga0307408_100050002 3300031548 Bacteria 3004
396 Ga0307408_100276963 3300031548 Bacteria 1395
397 Ga0307516_10002315 3300031730 Bacteria 25651
398 Ga0307405_10004186 3300031731 Bacteria 6790
399 Ga0307413_10081961 3300031824 Bacteria 2070
400 Ga0307410_10013577 3300031852 Bacteria 4758
401 Ga0307410_10020524 3300031852 Bacteria 4043
402 Ga0307410_10277113 3300031852 Bacteria 1314
403 Ga0307406_10017586 3300031901 Bacteria 4165
404 Ga0307406_10091971 3300031901 Bacteria 2044
405 Ga0307406_10334277 3300031901 Bacteria 1177
406 Ga0307407_10045211 3300031903 Bacteria 2486
407 Ga0307407_10180101 3300031903 Bacteria 1400
408 Ga0307412_10005841 3300031911 Bacteria 6926
409 Ga0307409_100000539 3300031995 Bacteria 16378
410 Ga0307409_100006577 3300031995 Bacteria 6851
411 Ga0307409_100030734 3300031995 Bacteria 3864
412 Ga0307409_100049940 3300031995 Bacteria 3192
413 Ga0307409_100056898 3300031995 Bacteria 3027
414 Ga0307416_100003828 3300032002 Bacteria 8943
415 Ga0307414_10016610 3300032004 Bacteria 4479
416 Ga0307414_10190944 3300032004 Bacteria 1657
417 Ga0307414_12101335 3300032004 Bacteria 527
418 Ga0307411_10627404 3300032005 Bacteria 927
419 Ga0307415_100009667 3300032126 Bacteria 5422
420 Ga0307415_100079308 3300032126 Bacteria 2338
421 Ga0373934_0265203 3300035086 Bacteria 711
422 Ga0373940_0358486 3300035088 Bacteria 513
423 Ga0373960_0025230 3300035121 Bacteria 1614
424 Ga0373931_0014426 3300035691 Bacteria 3862
425 Ga0373931_0196641 3300035691 Bacteria 1202
426 Ga0373935_0068489 3300035692 Bacteria 2284
427 Ga0373937_0296213 3300036401 Bacteria 1529
428 Ga0373937_0380294 3300036401 Bacteria 1339
429 Ga0373925_0090876 3300037068 Bacteria 2334
430 Ga0395900_0000131 3300037418 Bacteria 125554
431 Ga0395900_0009871 3300037418 Bacteria 9778
432 Ga0395898_0001532 3300037466 Bacteria 31823
433 Ga0395898_0318262 3300037466 Bacteria 1484
434 Ga0436361_0373741 3300039447 Bacteria 5825
435 Ga0436361_0522259 3300039447 Bacteria 3007
436 Ga0436361_0530495 3300039447 Bacteria 101563
437 Ga0439453_0054239 3300041408 Bacteria 816
438 Ga0451797_1574349 3300041453 Bacteria 786
439 Ga0451800_0249636 3300041459 Bacteria 713
440 Ga0451800_1224347 3300041459 Bacteria 830
441 Ga0451807_2450466 3300041486 Bacteria 1177
442 Ga0451807_2646479 3300041486 Bacteria 843
443 Ga0451839_0421155 3300041496 Bacteria 1057
444 Ga0451853_0648061 3300041512 Bacteria 1183
445 Ga0451853_1918001 3300041512 Bacteria 1159
446 Ga0439452_097435 3300042010 Bacteria 633
447 Ga0450888_010797 3300042126 Bacteria 1063
448 Ga0450890_003812 3300042127 Bacteria 1987
449 Ga0439459_0001805 3300042438 Bacteria 3215
450 Ga0451577_0607881 3300042876 Bacteria 992
451 Ga0451577_0730405 3300042876 Bacteria 896
452 Ga0466963_0292518 3300044694 Bacteria 1145
453 Ga0453684_0006446 3300044712 Bacteria 22283
454 Ga0453684_0059806 3300044712 Bacteria 4908
455 Ga0451576_0021518 3300045051 Bacteria 7010
456 Ga0451576_0293567 3300045051 Bacteria 1700
457 Ga0495638_0068706 3300046460 Bacteria 2172
458 Ga0495650_0020093 3300046471 Bacteria 3266
459 Ga0495607_0004617 3300046501 Bacteria 10080
460 Ga0495658_0251407 3300046683 Bacteria 1112
461 Ga0495658_0555696 3300046683 Bacteria 735
462 Ga0495686_0230773 3300047472 Bacteria 1048
463 Ga0496101_0363694 3300048904 Bacteria 1137
464 Ga0496102_0018101 3300048905 Bacteria 6184
465 Ga0496103_0036955 3300048906 Bacteria 2992
466 Ga0496106_0003509 3300048909 Bacteria 11691
467 Ga0496106_0022498 3300048909 Bacteria 4684
468 Ga0496106_0037267 3300048909 Bacteria 3638
469 Ga0496106_1016210 3300048909 Bacteria 652
470 Ga0496107_0010849 3300048910 Bacteria 6341
471 Ga0496109_0081141 3300048912 Bacteria 2989
472 Ga0496111_0386860 3300048914 Bacteria 1034
473 Ga0496111_1033732 3300048914 Bacteria 588
474 Ga0496114_0126135 3300048917 Bacteria 2207
475 Ga0496123_0114433 3300048926 Bacteria 1534
476 Ga0496123_0308970 3300048926 Bacteria 751
477 Ga0496124_0099793 3300048927 Bacteria 2354
478 Ga0501036_0064500 3300049572 Bacteria 3100
479 Ga0501040_0034794 3300049576 Bacteria 3413
480 Ga0501042_0476189 3300049578 Bacteria 906
481 Ga0501042_0892199 3300049578 Bacteria 647
482 Ga0501071_0130502 3300049587 Bacteria 1866
483 Ga0501071_0698051 3300049587 Bacteria 781
484 Ga0501073_0697944 3300049589 Bacteria 700
485 Ga0501074_0173082 3300049590 Bacteria 1541
486 Ga0501075_0002112 3300049591 Bacteria 13146
487 Ga0501076_0630109 3300049592 Bacteria 885
488 Ga0501077_0004417 3300049593 Bacteria 8533
489 Ga0501080_0019910 3300049742 Bacteria 6214
490 Ga0501080_0282407 3300049742 Bacteria 1509
491 Ga0501081_1359743 3300049743 Bacteria 539
492 Ga0501044_0427037 3300049823 Bacteria 1235
493 Ga0501045_0194785 3300049824 Bacteria 1510
494 nmdc:mga03n38_113783_c1 3300050490 Bacteria 1321
495 nmdc:mga0yw44_60001_c1 3300050492 Bacteria 2329
496 nmdc:mga0k408_128941_c1 3300050493 Bacteria 1501
497 nmdc:mga0k408_235096_c1 3300050493 Bacteria 1094
498 nmdc:mga0k408_62072_c1 3300050493 Bacteria 2173
499 nmdc:mga0k408_99995_c1 3300050493 Bacteria 1710
500 nmdc:mga06z11_407402_c1 3300050494 Bacteria 819
501 nmdc:mga07m45_16109_c1 3300050496 Bacteria 4000
502 nmdc:mga07m45_503787_c1 3300050496 Bacteria 701
503 nmdc:mga07m45_5422_c1 3300050496 Bacteria 6347
504 nmdc:mga07m45_9129_c1 3300050496 Bacteria 5123
505 nmdc:mga05p37_533675_c1 3300050507 Bacteria 1339
506 nmdc:mga09592_557595_c1 3300050508 Bacteria 984
507 nmdc:mga0n895_101003_c1 3300050512 Bacteria 2894
508 nmdc:mga0sz30_268952_c1 3300050516 Bacteria 759
509 Ga0500578_0000746 3300053086 Bacteria 38474
510 Ga0500569_008315 3300053109 Bacteria 2371
511 Ga0500568_0012261 3300053139 Bacteria 3948
512 Ga0500604_0055897 3300053151 Bacteria 1228
513 Ga0500622_0000874 3300053156 Bacteria 25654
514 Ga0500622_0046111 3300053156 Bacteria 2254
515 Ga0500584_106787 3300053726 Bacteria 1140
516 Ga0500645_011303 3300053730 Bacteria 2919
517 Ga0500587_041245 3300053739 Bacteria 661
518 Ga0501084_0002715 3300054114 Bacteria 14259
519 Ga0501082_0020322 3300060353 Bacteria 5724
520 Ga0530510_0003180 3300061734 Bacteria 11288
521 Ga0530510_0940359 3300061734 Bacteria 661
522 2587733245 2585428058 Bacteria 6853932
523 2857579654 2857576091 Bacteria 5465855
524 Ga0451577_0016712
525 JGI25162J39368_1000091
526 JGI25163J39215_1002283
527 JGI25165J46597_1000172
528 rootH2_10028526
529 rootL2_10003861
530 rootL2_10200614
531 JGI26128J50194_1000122
532 Ga0055538_1000063
533 Ga0055539_1000096
534 Ga0055533_1000107
535 Ga0055525_1000140
536 Ga0055524_1000554
537 Ga0055531_10005291
538 Ga0055531_10010645
539 Ga0055541_1000064
540 Ga0055543_1002200
541 Ga0065165_1000935
542 Ga0065165_1008803
543 Ga0065165_1111094
544 Ga0070658_11414088
545 Ga0070676_10001408
546 Ga0070676_10004967
547 Ga0070676_10009747
548 Ga0070676_10018791
549 Ga0070676_10298896
550 Ga0070690_100162578
551 Ga0070670_100113747
552 Ga0070670_100138063
553 Ga0070670_100392130
554 Ga0070670_101124493
555 Ga0070677_10000846
556 Ga0070677_10202977
557 Ga0068869_100004351
558 Ga0068869_100387358
559 Ga0068869_100740793
560 Ga0070666_10008700
561 Ga0070666_10025822
562 Ga0070666_10289678
563 Ga0070682_100884641
564 Ga0068868_100003852
565 Ga0068868_100275248
566 Ga0068868_100343214
567 Ga0070660_100003506
568 Ga0070660_100572978
569 Ga0070689_100052651
570 Ga0070687_100260240
571 Ga0070661_100011319
572 Ga0070661_100033975
573 Ga0070668_100003174
574 Ga0070668_100004363
575 Ga0070668_100105726
576 Ga0070668_100336119
577 Ga0070669_100000817
578 Ga0070669_100097311
579 Ga0070669_100365105
580 Ga0070669_100386591
581 Ga0070669_100441834
582 Ga0070675_100002002
583 Ga0070675_100065677
584 Ga0070675_100104521
585 Ga0070675_100155351
586 Ga0070671_100001815
587 Ga0070671_100009126
588 Ga0070671_100017039
589 Ga0070671_100028404
590 Ga0070671_100110609
591 Ga0070674_100000889
592 Ga0070674_100013295
593 Ga0070674_100090772
594 Ga0070674_100151008
595 Ga0070673_100002920
596 Ga0070673_100069663
597 Ga0070673_100507760
598 Ga0070673_100565483
599 Ga0070688_100121574
600 Ga0070659_100002098
601 Ga0070659_100166386
602 Ga0070667_100008195
603 Ga0070667_100016286
604 Ga0070667_100292347
605 Ga0070667_100422540
606 Ga0070667_100601969
607 Ga0070667_100682046
608 Ga0070667_101038536
609 Ga0070701_10481952
610 Ga0070705_100332479
611 Ga0070700_100444633
612 Ga0070663_100031262
613 Ga0070663_100489797
614 Ga0070663_100942422
615 Ga0070678_100002961
616 Ga0070678_100093057
617 Ga0070678_100096171
618 Ga0070678_100260933
619 Ga0070678_101646529
620 Ga0070662_100000180
621 Ga0070681_10065398
622 Ga0068867_100000687
623 Ga0068867_100004020
624 Ga0068867_100016329
625 Ga0068867_100043237
626 Ga0068867_100226238
627 Ga0070685_10154248
628 Ga0070706_100003982
629 Ga0070707_100370008
630 Ga0070698_100345754
631 Ga0070679_101189037
632 Ga0068853_100008603
633 Ga0068853_100008741
634 Ga0068853_101481632
635 Ga0070672_100016047
636 Ga0070672_100024445
637 Ga0070665_100036965
638 Ga0070665_100049119
639 Ga0070665_100155357
640 Ga0070665_100331773
641 Ga0070665_100874237
642 Ga0070665_101417651
643 Ga0068855_100002343
644 Ga0070664_100008706
645 Ga0070664_100150352
646 Ga0070664_100494267
647 Ga0070664_101369341
648 Ga0068854_100106951
649 Ga0068854_100394263
650 Ga0068856_100009865
651 Ga0068856_100032873
652 Ga0068856_100712323
653 Ga0070702_100055303
654 Ga0068852_100006233
655 Ga0068852_100952156
656 Ga0068852_100989337
657 Ga0068859_100003171
658 Ga0068859_100249247
659 Ga0068859_100347915
660 Ga0068859_100429755
661 Ga0068859_101105012
662 Ga0068859_101158620
663 Ga0068864_100038757
664 Ga0068864_100359243
665 Ga0068864_100807977
666 Ga0068864_101081259
667 Ga0068864_101678780
668 Ga0068861_100200794
669 Ga0068861_100258818
670 Ga0068861_101328342
671 Ga0068851_10094212
672 Ga0068851_10174668
673 Ga0068870_10004960
674 Ga0068863_100066881
675 Ga0068863_100167308
676 Ga0068863_100609509
677 Ga0068858_100019735
678 Ga0068858_100087594
679 Ga0068858_100373423
680 Ga0068860_100011299
681 Ga0068860_100261464
682 Ga0068860_100361755
683 Ga0068860_100884036
684 Ga0068862_100113584
685 Ga0068862_100966032
686 Ga0081455_10517387
687 Ga0075367_10009174
688 Ga0075369_10283290
689 Ga0075366_10066891
690 Ga0075366_10182629
691 Ga0075366_10283750
692 Ga0097621_100006240
693 Ga0097621_100017506
694 Ga0097621_100212900
695 Ga0075370_10012062
696 Ga0075370_10076020
697 Ga0068871_100001123
698 Ga0068871_100245764
699 Ga0068871_100269262
700 Ga0075428_100045141
701 Ga0075428_100101471
702 Ga0075433_10795999
703 Ga0075434_100245583
704 Ga0075429_100522697
705 Ga0068865_100007114
706 Ga0068865_100709591
707 Ga0097620_100003171
708 Ga0097620_100249250
709 Ga0097620_100347908
710 Ga0097620_100429713
711 Ga0097620_100561963
712 Ga0097620_101105036
713 Ga0097620_101158842
714 Ga0099823_1000083
715 Ga0105240_10005445
716 Ga0111539_12472205
717 Ga0105245_11614337
718 Ga0114129_10523670
719 Ga0114129_11997739
720 Ga0105241_11115655
721 Ga0105248_10698076
722 Ga0105237_10004231
723 Ga0105238_10002848
724 Ga0105249_11176091
725 Ga0105239_10000467
726 Ga0157317_1000984
727 Ga0157319_1000009
728 Ga0157373_10002400
729 Ga0157373_10249830
730 Ga0157373_10898074
731 Ga0157371_10000194
732 Ga0157374_10014972
733 Ga0157374_10054458
734 Ga0157374_10687188
735 Ga0157378_10018119
736 Ga0163162_10009609
737 Ga0163162_10043193
738 Ga0163162_10391147
739 Ga0163162_10801242
740 Ga0163162_12068472
741 Ga0157372_10002701
742 Ga0157372_12622983
743 Ga0157375_10188412
744 Ga0157375_10368629
745 Ga0163163_10150902
746 Ga0163163_10262587
747 Ga0163163_11066300
748 Ga0157379_10005934
749 Ga0157379_10022942
750 Ga0157376_10589926
751 Ga0163161_10009732
752 Ga0163161_10093852
753 Ga0213872_10000358
754 Ga0209760_101246
755 Ga0209784_100079
756 Ga0209566_100093
757 Ga0209674_100115
758 Ga0209563_100113
759 Ga0207427_100262
760 Ga0209437_100176
761 Ga0209677_100072
762 Ga0209233_1000183
763 Ga0209673_1015105
764 Ga0209673_1022853
765 Ga0209673_1040755
766 Ga0209564_1000003
767 Ga0209050_1000202
768 Ga0209050_1014101
769 Ga0209256_1000471
770 Ga0209256_1001715
771 Ga0209256_1055650
772 Ga0209051_1002398
773 Ga0209257_1001664
774 Ga0209257_1008776
775 Ga0209257_1041657
776 Ga0207697_10052425
777 Ga0207697_10061319
778 Ga0207656_10030564
779 Ga0207656_10125627
780 Ga0207682_10003176
781 Ga0207682_10005109
782 Ga0207682_10173462
783 Ga0207688_10031758
784 Ga0207688_10134674
785 Ga0207680_10154596
786 Ga0207680_10165623
787 Ga0207680_10429514
788 Ga0207645_10000143
789 Ga0207645_10000995
790 Ga0207645_10013147
791 Ga0207645_10027328
792 Ga0207645_10198698
793 Ga0207643_10005029
794 Ga0207705_10198207
795 Ga0207684_10004653
796 Ga0207707_10049899
797 Ga0207695_10011417
798 Ga0207671_10002430
799 Ga0207662_10798187
800 Ga0207657_10003358
801 Ga0207657_10246926
802 Ga0207657_10383333
803 Ga0207649_11154855
804 Ga0207681_10108155
805 Ga0207681_10116464
806 Ga0207681_10204703
807 Ga0207681_10797237
808 Ga0207681_10830696
809 Ga0207650_10079732
810 Ga0207650_10100242
811 Ga0207650_10140026
812 Ga0207650_11277882
813 Ga0207659_10007684
814 Ga0207659_10011417
815 Ga0207659_10094408
816 Ga0207659_10149571
817 Ga0207687_10393990
818 Ga0207687_10521209
819 Ga0207644_10002491
820 Ga0207644_10008045
821 Ga0207644_10010360
822 Ga0207644_10017326
823 Ga0207690_10000286
824 Ga0207706_10000002
825 Ga0207706_10927926
826 Ga0207686_10324830
827 Ga0207709_10561332
828 Ga0207669_10083526
829 Ga0207669_10087483
830 Ga0207669_10092788
831 Ga0207669_11083735
832 Ga0207704_10217617
833 Ga0207691_10000016
834 Ga0207691_10004984
835 Ga0207691_10113465
836 Ga0207691_10971354
837 Ga0207711_10514437
838 Ga0207689_10139011
839 Ga0207689_10247702
840 Ga0207689_10259606
841 Ga0207689_10292958
842 Ga0207689_11099016
843 Ga0207679_10001831
844 Ga0207667_10004685
845 Ga0207651_10100081
846 Ga0207651_10228340
847 Ga0207651_10250123
848 Ga0207668_10024734
849 Ga0207668_10058197
850 Ga0207668_10063979
851 Ga0207640_10147460
852 Ga0207640_10974728
853 Ga0207658_10044583
854 Ga0207658_10090715
855 Ga0207658_10250860
856 Ga0207658_10342817
857 Ga0207658_10371654
858 Ga0207658_10749707
859 Ga0207658_10923641
860 Ga0207677_10011884
861 Ga0207703_10090094
862 Ga0207703_10189298
863 Ga0207703_10452395
864 Ga0207703_10533598
865 Ga0207639_10004632
866 Ga0207639_10261268
867 Ga0207639_10634571
868 Ga0207639_10999637
869 Ga0207708_10334543
870 Ga0207702_10012572
871 Ga0207702_10078953
872 Ga0207702_10429062
873 Ga0207641_10213555
874 Ga0207641_10448741
875 Ga0207641_10658329
876 Ga0207648_10009135
877 Ga0207648_10011657
878 Ga0207648_10016618
879 Ga0207648_10064537
880 Ga0207648_11361690
881 Ga0207676_10053509
882 Ga0207676_10355633
883 Ga0207676_10573726
884 Ga0207674_10180301
885 Ga0207675_100076949
886 Ga0207675_100085579
887 Ga0207675_101711223
888 Ga0207683_10000057
889 Ga0207683_10001224
890 Ga0207683_10031486
891 Ga0207683_10121742
892 Ga0207683_10743904
893 Ga0207683_10932814
894 Ga0207683_11074702
895 Ga0207698_10029945
896 Ga0207698_10285691
897 Ga0207698_10940323
898 Ga0209389_1004365
899 Ga0209371_1023197
900 Ga0209968_1000538
901 Ga0209999_1010658
902 Ga0209971_1006464
903 Ga0209966_1000382
904 Ga0209974_10008602
905 Ga0268266_10007438
906 Ga0268266_10111665
907 Ga0268266_10223612
908 Ga0268266_10305142
909 Ga0268266_10573860
910 Ga0268264_10008275
911 Ga0268264_10127155
912 Ga0268264_10163566
913 Ga0268264_10259935
914 Ga0268264_10261750
915 Ga0268264_11034200
916 Ga0307515_10116179
917 Ga0268256_1085562
918 Ga0307408_100050002
919 Ga0307408_100276963
920 Ga0307516_10002315
921 Ga0307405_10004186
922 Ga0307413_10081961
923 Ga0307410_10013577
924 Ga0307410_10020524
925 Ga0307410_10277113
926 Ga0307406_10017586
927 Ga0307406_10091971
928 Ga0307406_10334277
929 Ga0307407_10045211
930 Ga0307407_10180101
931 Ga0307412_10005841
932 Ga0307409_100000539
933 Ga0307409_100006577
934 Ga0307409_100030734
935 Ga0307409_100049940
936 Ga0307409_100056898
937 Ga0307416_100003828
938 Ga0307414_10016610
939 Ga0307414_10190944
940 Ga0307414_12101335
941 Ga0307411_10627404
942 Ga0307415_100009667
943 Ga0307415_100079308
944 Ga0373934_0265203
945 Ga0373940_0358486
946 Ga0373960_0025230
947 Ga0373931_0014426
948 Ga0373931_0196641
949 Ga0373935_0068489
950 Ga0373937_0296213
951 Ga0373937_0380294
952 Ga0373925_0090876
953 Ga0395900_0000131
954 Ga0395900_0009871
955 Ga0395898_0001532
956 Ga0395898_0318262
957 Ga0436361_0373741
958 Ga0436361_0522259
959 Ga0436361_0530495
960 Ga0439453_0054239
961 Ga0451797_1574349
962 Ga0451800_0249636
963 Ga0451800_1224347
964 Ga0451807_2450466
965 Ga0451807_2646479
966 Ga0451839_0421155
967 Ga0451853_0648061
968 Ga0451853_1918001
969 Ga0439452_097435
970 Ga0450888_010797
971 Ga0450890_003812
972 Ga0439459_0001805
973 Ga0451577_0607881
974 Ga0451577_0730405
975 Ga0466963_0292518
976 Ga0453684_0006446
977 Ga0453684_0059806
978 Ga0451576_0021518
979 Ga0451576_0293567
980 Ga0495638_0068706
981 Ga0495650_0020093
982 Ga0495607_0004617
983 Ga0495658_0251407
984 Ga0495658_0555696
985 Ga0495686_0230773
986 Ga0496101_0363694
987 Ga0496102_0018101
988 Ga0496103_0036955
989 Ga0496106_0003509
990 Ga0496106_0022498
991 Ga0496106_0037267
992 Ga0496106_1016210
993 Ga0496107_0010849
994 Ga0496109_0081141
995 Ga0496111_0386860
996 Ga0496111_1033732
997 Ga0496114_0126135
998 Ga0496123_0114433
999 Ga0496123_0308970
1000 Ga0496124_0099793
1001 Ga0501036_0064500
1002 Ga0501040_0034794
1003 Ga0501042_0476189
1004 Ga0501042_0892199
1005 Ga0501071_0130502
1006 Ga0501071_0698051
1007 Ga0501073_0697944
1008 Ga0501074_0173082
1009 Ga0501075_0002112
1010 Ga0501076_0630109
1011 Ga0501077_0004417
1012 Ga0501080_0019910
1013 Ga0501080_0282407
1014 Ga0501081_1359743
1015 Ga0501044_0427037
1016 Ga0501045_0194785
1017 nmdc:mga03n38_113783_c1
1018 nmdc:mga0yw44_60001_c1
1019 nmdc:mga0k408_128941_c1
1020 nmdc:mga0k408_235096_c1
1021 nmdc:mga0k408_62072_c1
1022 nmdc:mga0k408_99995_c1
1023 nmdc:mga06z11_407402_c1
1024 nmdc:mga07m45_16109_c1
1025 nmdc:mga07m45_503787_c1
1026 nmdc:mga07m45_5422_c1
1027 nmdc:mga07m45_9129_c1
1028 nmdc:mga05p37_533675_c1
1029 nmdc:mga09592_557595_c1
1030 nmdc:mga0n895_101003_c1
1031 nmdc:mga0sz30_268952_c1
1032 Ga0500578_0000746
1033 Ga0500569_008315
1034 Ga0500568_0012261
1035 Ga0500604_0055897
1036 Ga0500622_0000874
1037 Ga0500622_0046111
1038 Ga0500584_106787
1039 Ga0500645_011303
1040 Ga0500587_041245
1041 Ga0501084_0002715
1042 Ga0501082_0020322
1043 Ga0530510_0003180
1044 Ga0530510_0940359
1045 2587733245
1046 2857579654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08897

DUF1841

Domain of unknown function (DUF1841)

5

141

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbo-assembly2.cif.gz_B human steroid receptor rna activator protein carboxy-terminal domain 0.2857 5 139
4nbo-assembly2.cif.gz_B human steroid receptor rna activator protein carboxy-terminal domain 0.2754 5 139
6ygi-assembly1.cif.gz_A duck hepatitis b virus capsid mutant r124e_delta78-122 0.2737 2 85
1yen-assembly1.cif.gz_D t-to-t(high) quaternary transitions in human hemoglobin: betap36a oxy (2mm ihp, 20% peg) (10 test sets) 0.2601 8 140
3mjp-assembly1.cif.gz_D crystal structure determination of japanese quail (coturnix coturnix japonica) hemoglobin at 2.76 angstrom resolution 0.2478 8 140
ID Description Score Start End Superfamily
af_P9WGH5_2_93_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.523 76 139 1.10.1740.10
af_P23484_2_79_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5173 64 140 1.10.1740.10
4nleB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.4654 91 140 1.10.40.30
af_P23484_2_79_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4572 64 140 1.10.1740.10
af_O44978_624_799_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4079 72 137 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A536UEG1-F1-model_v4 DUF1841 family protein 0.9914 1 114
AF-G9EJN3-F1-model_v4 Uncharacterized protein 0.9903 92 139
AF-A0A653I5A4-F1-model_v4 DUF1841 domain-containing protein 0.9883 1 140
AF-A0A0L6T7T4-F1-model_v4 DUF1841 domain-containing protein 0.9786 1 140
AF-A0A345DEB3-F1-model_v4 DUF1841 domain-containing protein 0.9768 1 140

Map