F459033

General Info

Members Datasets Scaffolds Average Seq Length
523 312 1046 146

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0624145|Ga0495584_0624145_35_529
Length 164
Sequence MDVMTTKSKLRRMDNVLIVVDDLEAAKAFFAELGMELEGETTVEGRWVDRVVGLNDVRADIAMMRTPDGHSRVELTKFHTPPAVRAEPESAPANTLGIRRIMFAVDDIDDVVARLRSHGAELVGEIAQYEDIYRLCFLRGPEGIIIGLAEQLGNKSVTDILGNP

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
285 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
286 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
287 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
288 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 0
Rhizoplane 7.27
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0624145 3300046491 Bacteria 549
2 LJNas_1004050 3300000546 Bacteria 1645
3 LJQas_1001421 3300000549 Bacteria 3589
4 JGI24743J22301_10026911 3300001991 Bacteria 1120
5 JGI25151J46595_10066200 3300003187 Bacteria 1120
6 JGI25407J50210_10020567 3300003373 Bacteria 1715
7 JGI25407J50210_10059814 3300003373 Bacteria 958
8 Ga0055526_1000038 3300003771 Bacteria 131858
9 Ga0055537_1000602 3300003773 Bacteria 19976
10 Ga0055524_1000066 3300003775 Bacteria 131691
11 Ga0055534_1000082 3300003784 Bacteria 75351
12 Ga0055528_1000023 3300003790 Bacteria 131856
13 Ga0065714_10115631 3300005288 Bacteria 1413
14 Ga0065712_10381044 3300005290 Unclassified 734
15 Ga0065715_10375211 3300005293 Bacteria 915
16 Ga0065707_10197243 3300005295 Bacteria 1329
17 Ga0065707_10308676 3300005295 Bacteria 989
18 Ga0070683_100051147 3300005329 Bacteria 3825
19 Ga0070670_100025575 3300005331 Bacteria 5078
20 Ga0070680_100025765 3300005336 Bacteria 4702
21 Ga0070682_100016907 3300005337 Bacteria 4246
22 Ga0070682_100282376 3300005337 Bacteria 1211
23 Ga0068868_100015591 3300005338 Bacteria 5625
24 Ga0070660_100392303 3300005339 Bacteria 1147
25 Ga0070689_101968407 3300005340 Unclassified 534
26 Ga0070687_100922599 3300005343 Bacteria 628
27 Ga0070692_10213464 3300005345 Bacteria 1137
28 Ga0070692_10406882 3300005345 Bacteria 860
29 Ga0070668_100177802 3300005347 Bacteria 1736
30 Ga0070668_100499429 3300005347 Bacteria 1053
31 Ga0070674_100001697 3300005356 Bacteria 11925
32 Ga0070667_101238584 3300005367 Bacteria 699
33 Ga0070714_100000019 3300005435 Bacteria 169455
34 Ga0070701_10509630 3300005438 Bacteria 783
35 Ga0070705_100065605 3300005440 Bacteria 2174
36 Ga0070705_100159636 3300005440 Bacteria 1506
37 Ga0070700_100001788 3300005441 Bacteria 10841
38 Ga0070694_100115108 3300005444 Bacteria 1921
39 Ga0070694_100173160 3300005444 Bacteria 1591
40 Ga0070708_100637202 3300005445 Bacteria 1005
41 Ga0070663_100025844 3300005455 Bacteria 3969
42 Ga0070662_100026717 3300005457 Bacteria 4000
43 Ga0070681_10068024 3300005458 Bacteria 3530
44 Ga0070706_100089007 3300005467 Bacteria 2863
45 Ga0070706_100482924 3300005467 Bacteria 1153
46 Ga0070707_100870096 3300005468 Bacteria 865
47 Ga0070698_100031288 3300005471 Bacteria 5518
48 Ga0070698_101414015 3300005471 Bacteria 647
49 Ga0070699_100512969 3300005518 Bacteria 1090
50 Ga0070679_100084084 3300005530 Unclassified 3171
51 Ga0070684_100107268 3300005535 Bacteria 2501
52 Ga0070697_100030624 3300005536 Bacteria 4323
53 Ga0070697_100066008 3300005536 Bacteria 2958
54 Ga0068853_100175515 3300005539 Bacteria 1941
55 Ga0070695_100299247 3300005545 Bacteria 1188
56 Ga0070665_100000068 3300005548 Bacteria 204531
57 Ga0070665_100015514 3300005548 Bacteria 7654
58 Ga0070704_100041815 3300005549 Bacteria 3166
59 Ga0070704_100114371 3300005549 Bacteria 2059
60 Ga0070704_100471944 3300005549 Bacteria 1084
61 Ga0068855_100006141 3300005563 Bacteria 14645
62 Ga0068855_100911081 3300005563 Bacteria 928
63 Ga0068855_101049476 3300005563 Bacteria 854
64 Ga0068857_100118375 3300005577 Bacteria 2384
65 Ga0068854_100203949 3300005578 Bacteria 1556
66 Ga0068856_100012557 3300005614 Bacteria 8199
67 Ga0068856_100042382 3300005614 Bacteria 4477
68 Ga0068856_100052350 3300005614 Bacteria 4025
69 Ga0070702_100018003 3300005615 Bacteria 3656
70 Ga0068852_100103625 3300005616 Bacteria 2573
71 Ga0068852_100719671 3300005616 Bacteria 1009
72 Ga0068859_100098590 3300005617 Bacteria 2976
73 Ga0068859_100209622 3300005617 Bacteria 2035
74 Ga0068859_100683453 3300005617 Bacteria 1118
75 Ga0068864_100281808 3300005618 Bacteria 1551
76 Ga0068864_100764376 3300005618 Unclassified 948
77 Ga0068866_10093212 3300005718 Bacteria 1645
78 Ga0068870_10210999 3300005840 Bacteria 1183
79 Ga0068870_10604440 3300005840 Bacteria 746
80 Ga0068858_100000012 3300005842 Bacteria 216931
81 Ga0068860_100015536 3300005843 Bacteria 7433
82 Ga0068862_100141634 3300005844 Bacteria 2135
83 Ga0068862_100183008 3300005844 Bacteria 1882
84 Ga0081455_10057132 3300005937 Bacteria 3309
85 Ga0081455_10106857 3300005937 Bacteria 2232
86 Ga0081538_10000750 3300005981 Bacteria 35412
87 Ga0081538_10001641 3300005981 Bacteria 22957
88 Ga0081538_10003372 3300005981 Bacteria 15124
89 Ga0081538_10004762 3300005981 Bacteria 12408
90 Ga0081539_10001190 3300005985 Bacteria 46973
91 Ga0081539_10050130 3300005985 Bacteria 2364
92 Ga0075365_10011982 3300006038 Bacteria 5124
93 Ga0075365_10077599 3300006038 Bacteria 2244
94 Ga0075364_10125710 3300006051 Bacteria 1719
95 Ga0070716_100223928 3300006173 Bacteria 1265
96 Ga0070712_100000007 3300006175 Bacteria 157653
97 Ga0070712_100014494 3300006175 Bacteria 5060
98 Ga0070712_100167355 3300006175 Bacteria 1703
99 Ga0070712_100285111 3300006175 Bacteria 1332
100 Ga0075367_10067166 3300006178 Bacteria 2150
101 Ga0075367_10453103 3300006178 Bacteria 813
102 Ga0075370_10279689 3300006353 Bacteria 991
103 Ga0075428_100092748 3300006844 Bacteria 3292
104 Ga0075428_100134377 3300006844 Bacteria 2690
105 Ga0075428_100715103 3300006844 Bacteria 1067
106 Ga0075430_100005349 3300006846 Bacteria 10842
107 Ga0075430_100142981 3300006846 Bacteria 1992
108 Ga0075430_100779452 3300006846 Unclassified 788
109 Ga0075430_100939204 3300006846 Bacteria 712
110 Ga0075431_100003159 3300006847 Bacteria 15930
111 Ga0075431_100030757 3300006847 Unclassified 5531
112 Ga0075431_100075426 3300006847 Bacteria 3480
113 Ga0075431_100086000 3300006847 Bacteria 3245
114 Ga0075431_100153913 3300006847 Bacteria 2366
115 Ga0075429_100009376 3300006880 Bacteria 8499
116 Ga0075429_100019563 3300006880 Bacteria 5868
117 Ga0075429_100096595 3300006880 Bacteria 2577
118 Ga0075429_100164545 3300006880 Bacteria 1943
119 Ga0075436_100376710 3300006914 Bacteria 1026
120 Ga0097620_100098593 3300006931 Bacteria 2976
121 Ga0097620_100683466 3300006931 Bacteria 1118
122 Ga0099795_10502159 3300007788 Bacteria 566
123 Ga0105240_10211883 3300009093 Bacteria 2263
124 Ga0105240_10630512 3300009093 Bacteria 1177
125 Ga0105240_10790066 3300009093 Bacteria 1029
126 Ga0105240_10807031 3300009093 Bacteria 1016
127 Ga0105240_11727073 3300009093 Bacteria 653
128 Ga0111539_12782356 3300009094 Bacteria 567
129 Ga0105245_10000353 3300009098 Bacteria 42813
130 Ga0105245_10009533 3300009098 Bacteria 8466
131 Ga0105245_10675687 3300009098 Bacteria 1064
132 Ga0105247_10245631 3300009101 Bacteria 1221
133 Ga0114129_10733717 3300009147 Bacteria 1266
134 Ga0114129_10771068 3300009147 Bacteria 1229
135 Ga0114129_11457199 3300009147 Bacteria 843
136 Ga0105243_10252041 3300009148 Bacteria 1576
137 Ga0105241_11342202 3300009174 Bacteria 682
138 Ga0105242_11216827 3300009176 Bacteria 773
139 Ga0105248_10000008 3300009177 Bacteria 403910
140 Ga0105248_10038113 3300009177 Bacteria 5378
141 Ga0105248_10193051 3300009177 Bacteria 2295
142 Ga0105237_10204639 3300009545 Bacteria 1974
143 Ga0105238_11756103 3300009551 Bacteria 652
144 Ga0105249_10474257 3300009553 Bacteria 1293
145 Ga0105249_10497678 3300009553 Bacteria 1264
146 Ga0105249_11297343 3300009553 Bacteria 800
147 Ga0157339_1030089 3300012505 Bacteria 630
148 Ga0157369_11899511 3300013105 Bacteria 604
149 Ga0157374_10005840 3300013296 Bacteria 10398
150 Ga0157374_10017616 3300013296 Bacteria 6292
151 Ga0157374_10282797 3300013296 Bacteria 1638
152 Ga0157374_12523877 3300013296 Bacteria 541
153 Ga0157378_10667966 3300013297 Bacteria 1056
154 Ga0157372_10065995 3300013307 Bacteria 4065
155 Ga0157372_10066875 3300013307 Bacteria 4038
156 Ga0157372_11784805 3300013307 Bacteria 707
157 Ga0157375_10054795 3300013308 Bacteria 3929
158 Ga0157375_10291207 3300013308 Bacteria 1796
159 Ga0157375_12966359 3300013308 Bacteria 567
160 Ga0163163_10892244 3300014325 Bacteria 952
161 Ga0182008_10556324 3300014497 Bacteria 638
162 Ga0157377_10017279 3300014745 Bacteria 3728
163 Ga0157376_10100259 3300014969 Bacteria 2528
164 Ga0157376_11222172 3300014969 Bacteria 780
165 Ga0163161_10000022 3300017792 Bacteria 207890
166 Ga0213873_10172062 3300021358 Bacteria 661
167 Ga0213872_10005782 3300021361 Bacteria 6285
168 Ga0213876_10473984 3300021384 Bacteria 666
169 Ga0213875_10009234 3300021388 Bacteria 5003
170 Ga0213871_10199648 3300021441 Bacteria 624
171 Ga0209565_1000005 3300025263 Bacteria 947317
172 Ga0209673_1000027 3300025273 Bacteria 360561
173 Ga0209675_1000004 3300025291 Bacteria 947166
174 Ga0209025_1021925 3300025294 Bacteria 3413
175 Ga0209564_1000050 3300025295 Bacteria 360560
176 Ga0209256_1000031 3300025299 Bacteria 410189
177 Ga0207692_10207180 3300025898 Bacteria 1156
178 Ga0207692_10292641 3300025898 Bacteria 989
179 Ga0207688_10238412 3300025901 Bacteria 1099
180 Ga0207688_10315268 3300025901 Bacteria 958
181 Ga0207699_10867277 3300025906 Bacteria 665
182 Ga0207643_10474209 3300025908 Bacteria 798
183 Ga0207684_10173509 3300025910 Bacteria 1859
184 Ga0207707_10019393 3300025912 Bacteria 5936
185 Ga0207707_10056448 3300025912 Bacteria 3416
186 Ga0207695_10386757 3300025913 Bacteria 1284
187 Ga0207695_10493244 3300025913 Bacteria 1107
188 Ga0207695_10596812 3300025913 Bacteria 985
189 Ga0207693_10000001 3300025915 Bacteria 469535
190 Ga0207693_10016308 3300025915 Bacteria 5940
191 Ga0207693_10078731 3300025915 Bacteria 2580
192 Ga0207660_10006668 3300025917 Bacteria 7488
193 Ga0207657_10199423 3300025919 Bacteria 1611
194 Ga0207657_10475516 3300025919 Bacteria 980
195 Ga0207657_10599441 3300025919 Bacteria 860
196 Ga0207652_10011249 3300025921 Bacteria 7209
197 Ga0207652_10672104 3300025921 Bacteria 925
198 Ga0207646_10134672 3300025922 Bacteria 2224
199 Ga0207646_10782424 3300025922 Bacteria 850
200 Ga0207681_10036919 3300025923 Bacteria 3226
201 Ga0207650_10012162 3300025925 Bacteria 5933
202 Ga0207687_10000031 3300025927 Bacteria 150246
203 Ga0207687_10029953 3300025927 Bacteria 3665
204 Ga0207687_10685562 3300025927 Bacteria 869
205 Ga0207664_10000008 3300025929 Bacteria 309301
206 Ga0207664_10093647 3300025929 Bacteria 2468
207 Ga0207644_10161150 3300025931 Bacteria 1744
208 Ga0207690_10137307 3300025932 Bacteria 1797
209 Ga0207706_10259349 3300025933 Bacteria 1518
210 Ga0207686_10000042 3300025934 Bacteria 122852
211 Ga0207669_10570679 3300025937 Bacteria 916
212 Ga0207665_10740058 3300025939 Bacteria 775
213 Ga0207711_10000006 3300025941 Bacteria 792692
214 Ga0207711_10103329 3300025941 Bacteria 2523
215 Ga0207689_10752124 3300025942 Bacteria 822
216 Ga0207689_11540017 3300025942 Unclassified 554
217 Ga0207667_10009597 3300025949 Bacteria 11389
218 Ga0207667_10515454 3300025949 Bacteria 1212
219 Ga0207668_10395690 3300025972 Bacteria 1167
220 Ga0207668_10541682 3300025972 Bacteria 1007
221 Ga0207668_11125072 3300025972 Bacteria 704
222 Ga0207640_10298607 3300025981 Bacteria 1273
223 Ga0207658_10510145 3300025986 Bacteria 1072
224 Ga0207703_10000091 3300026035 Bacteria 105608
225 Ga0207678_10040838 3300026067 Bacteria 4022
226 Ga0207708_10000752 3300026075 Bacteria 24268
227 Ga0207702_10006669 3300026078 Bacteria 9926
228 Ga0207702_10036713 3300026078 Bacteria 4099
229 Ga0207702_10118048 3300026078 Bacteria 2370
230 Ga0207702_10187586 3300026078 Bacteria 1908
231 Ga0207641_11223343 3300026088 Bacteria 751
232 Ga0207648_10064076 3300026089 Bacteria 3203
233 Ga0207676_10535311 3300026095 Bacteria 1117
234 Ga0207674_10121634 3300026116 Bacteria 2577
235 Ga0207683_10287074 3300026121 Bacteria 1504
236 Ga0207698_10469459 3300026142 Bacteria 1218
237 Ga0207698_10746093 3300026142 Bacteria 977
238 Ga0209971_1065130 3300027682 Bacteria 883
239 Ga0209974_10018049 3300027876 Bacteria 2339
240 Ga0268266_10000020 3300028379 Bacteria 527065
241 Ga0268266_10021605 3300028379 Bacteria 5482
242 Ga0268266_10022872 3300028379 Bacteria 5320
243 Ga0268266_11100277 3300028379 Bacteria 769
244 Ga0268264_10009671 3300028381 Bacteria 7986
245 Ga0307408_100020159 3300031548 Bacteria 4495
246 Ga0307408_100311498 3300031548 Bacteria 1323
247 Ga0307408_102038270 3300031548 Bacteria 552
248 Ga0307405_10034228 3300031731 Bacteria 3021
249 Ga0307405_10194329 3300031731 Bacteria 1468
250 Ga0307405_11677851 3300031731 Bacteria 562
251 Ga0307413_10238035 3300031824 Bacteria 1342
252 Ga0307410_10037029 3300031852 Bacteria 3183
253 Ga0307410_10294089 3300031852 Bacteria 1279
254 Ga0307406_10050767 3300031901 Bacteria 2631
255 Ga0307406_10059849 3300031901 Bacteria 2454
256 Ga0307406_10203224 3300031901 Bacteria 1460
257 Ga0307406_10398300 3300031901 Bacteria 1090
258 Ga0307407_10089769 3300031903 Bacteria 1881
259 Ga0307407_10176168 3300031903 Bacteria 1413
260 Ga0307407_10603000 3300031903 Bacteria 818
261 Ga0307412_10299275 3300031911 Bacteria 1271
262 Ga0307409_100053189 3300031995 Bacteria 3110
263 Ga0307409_100085577 3300031995 Bacteria 2563
264 Ga0307409_100099279 3300031995 Bacteria 2410
265 Ga0307409_100100748 3300031995 Bacteria 2395
266 Ga0307409_100192361 3300031995 Bacteria 1817
267 Ga0307409_101626045 3300031995 Bacteria 674
268 Ga0307416_100024319 3300032002 Bacteria 4418
269 Ga0307416_100102645 3300032002 Bacteria 2494
270 Ga0307416_100196609 3300032002 Bacteria 1908
271 Ga0307416_100320611 3300032002 Bacteria 1551
272 Ga0307416_102701197 3300032002 Bacteria 593
273 Ga0307414_10448545 3300032004 Bacteria 1131
274 Ga0307411_10103686 3300032005 Bacteria 2018
275 Ga0307411_10570901 3300032005 Bacteria 968
276 Ga0307415_100019245 3300032126 Bacteria 4141
277 Ga0307415_100044770 3300032126 Bacteria 2961
278 Ga0307415_100102445 3300032126 Bacteria 2103
279 Ga0307415_100157576 3300032126 Bacteria 1755
280 Ga0307415_100245778 3300032126 Bacteria 1450
281 Ga0307415_101370226 3300032126 Bacteria 672
282 Ga0373930_0111524 3300034816 Bacteria 659
283 Ga0373949_0211116 3300035090 Bacteria 587
284 Ga0373932_0394054 3300035112 Bacteria 534
285 Ga0373941_0376512 3300035115 Bacteria 583
286 Ga0373946_0471931 3300035171 Bacteria 641
287 Ga0373962_0332275 3300035242 Bacteria 546
288 Ga0373931_1045443 3300035691 Bacteria 554
289 Ga0395899_0133356 3300037312 Bacteria 1772
290 Ga0395899_0952146 3300037312 Bacteria 520
291 Ga0395900_0124882 3300037418 Bacteria 2639
292 Ga0395900_0626210 3300037418 Bacteria 1014
293 Ga0395900_1424506 3300037418 Bacteria 606
294 Ga0395898_0061270 3300037466 Bacteria 3655
295 Ga0395898_0670443 3300037466 Bacteria 979
296 Ga0395898_0811356 3300037466 Bacteria 876
297 Ga0395898_1607673 3300037466 Bacteria 574
298 Ga0395905_0220869 3300037471 Bacteria 1773
299 Ga0395905_0232187 3300037471 Bacteria 1725
300 Ga0395905_0278368 3300037471 Bacteria 1559
301 Ga0395905_0908347 3300037471 Bacteria 783
302 Ga0436364_0411628 3300037853 Bacteria 850
303 Ga0436364_0715275 3300037853 Bacteria 782
304 Ga0436364_0758385 3300037853 Bacteria 683
305 Ga0395901_0004174 3300038443 Bacteria 14583
306 Ga0395901_0082931 3300038443 Bacteria 3350
307 Ga0395901_0147514 3300038443 Bacteria 2472
308 Ga0395901_0268152 3300038443 Bacteria 1776
309 Ga0395901_0605497 3300038443 Bacteria 1104
310 Ga0395901_0923526 3300038443 Bacteria 853
311 Ga0395901_1216742 3300038443 Bacteria 718
312 Ga0242419_023499 3300038698 Bacteria 523
313 Ga0436365_1582894 3300039437 Bacteria 2008
314 Ga0436360_0885705 3300039438 Bacteria 943
315 Ga0436361_0007439 3300039447 Bacteria 48924
316 Ga0436361_0390306 3300039447 Bacteria 4156
317 Ga0436361_0938103 3300039447 Bacteria 8807
318 Ga0436363_0652219 3300039450 Bacteria 1416
319 Ga0436362_0035815 3300039453 Bacteria 525
320 Ga0436362_0137816 3300039453 Bacteria 515
321 Ga0436362_0384422 3300039453 Bacteria 721
322 Ga0436362_0408148 3300039453 Bacteria 625
323 Ga0436362_0727618 3300039453 Bacteria 540
324 Ga0439461_0153621 3300041410 Bacteria 596
325 Ga0451789_0280886 3300041443 Bacteria 631
326 Ga0451804_0407870 3300041463 Bacteria 615
327 Ga0451807_0461799 3300041486 Bacteria 704
328 Ga0451833_0416868 3300041491 Bacteria 6715
329 Ga0451853_1137946 3300041512 Bacteria 5560
330 Ga0439454_056697 3300042011 Bacteria 672
331 Ga0450923_042174 3300042125 Bacteria 962
332 Ga0439434_0122243 3300042435 Bacteria 850
333 Ga0439444_0106549 3300042437 Bacteria 641
334 Ga0439464_0222504 3300042439 Bacteria 606
335 Ga0451577_0075398 3300042876 Bacteria 3008
336 Ga0451577_0322188 3300042876 Bacteria 1402
337 Ga0439440_0136100 3300042993 Bacteria 694
338 Ga0453683_0070474 3300044673 Bacteria 2186
339 Ga0466963_0085891 3300044694 Bacteria 2137
340 Ga0453684_0199710 3300044712 Bacteria 2332
341 Ga0466971_0051743 3300044719 Bacteria 1849
342 Ga0466970_0126448 3300044765 Bacteria 1402
343 Ga0466970_0415268 3300044765 Bacteria 769
344 Ga0466957_0149557 3300044842 Bacteria 1509
345 Ga0466959_0020002 3300045049 Bacteria 4927
346 Ga0466959_0690961 3300045049 Bacteria 684
347 Ga0451576_0030447 3300045051 Bacteria 5768
348 Ga0451576_1670664 3300045051 Bacteria 660
349 Ga0466958_0031128 3300045836 Bacteria 3171
350 Ga0466967_0940821 3300045976 Bacteria 860
351 Ga0466967_2466662 3300045976 Bacteria 515
352 Ga0495617_203068 3300046452 Bacteria 619
353 Ga0495627_124014 3300046453 Bacteria 729
354 Ga0495629_0012870 3300046459 Bacteria 6052
355 Ga0495653_0481084 3300046463 Bacteria 777
356 Ga0495605_0212484 3300046474 Bacteria 839
357 Ga0495585_0045852 3300046492 Bacteria 2439
358 Ga0495585_0205099 3300046492 Bacteria 1002
359 Ga0495585_0309128 3300046492 Bacteria 775
360 Ga0495596_0035564 3300046500 Bacteria 1975
361 Ga0495596_0280405 3300046500 Bacteria 647
362 Ga0495607_0119766 3300046501 Bacteria 1383
363 Ga0495583_0094501 3300046506 Bacteria 1283
364 Ga0495606_0203612 3300046507 Bacteria 1126
365 Ga0495610_0096588 3300046512 Bacteria 1330
366 Ga0495620_0179994 3300046515 Bacteria 818
367 Ga0495631_0025766 3300046518 Bacteria 2705
368 Ga0495632_0407521 3300046519 Bacteria 593
369 Ga0495637_0002566 3300046520 Bacteria 9983
370 Ga0495637_0088065 3300046520 Bacteria 1228
371 Ga0495643_0068717 3300046522 Bacteria 1864
372 Ga0495644_0004681 3300046523 Bacteria 5376
373 Ga0495665_0700851 3300046531 Bacteria 502
374 Ga0495640_0339671 3300046533 Bacteria 928
375 Ga0495633_0004377 3300046558 Bacteria 9009
376 Ga0495633_0550302 3300046558 Bacteria 519
377 Ga0495611_0567487 3300046648 Bacteria 513
378 Ga0495625_0022940 3300046660 Bacteria 4775
379 Ga0495659_0558056 3300046664 Bacteria 505
380 Ga0495661_0006837 3300046665 Bacteria 7986
381 Ga0495588_0000218 3300046674 Bacteria 54328
382 Ga0495624_0000030 3300046690 Bacteria 91755
383 Ga0495670_0004992 3300046691 Bacteria 6521
384 Ga0495671_0243221 3300046692 Bacteria 869
385 Ga0495649_0030737 3300046694 Bacteria 2964
386 Ga0495649_0262164 3300046694 Bacteria 886
387 Ga0495636_0167451 3300047318 Bacteria 992
388 Ga0495676_0005489 3300047321 Bacteria 11631
389 Ga0495676_0086672 3300047321 Bacteria 2355
390 Ga0495676_1001065 3300047321 Bacteria 533
391 Ga0495683_0287945 3300047323 Bacteria 709
392 Ga0495687_064827 3300047443 Bacteria 1489
393 Ga0495675_0226626 3300047444 Bacteria 1129
394 Ga0495677_0237001 3300047445 Bacteria 712
395 Ga0495685_087956 3300047447 Bacteria 1031
396 Ga0495673_0299264 3300047469 Bacteria 577
397 Ga0495615_0023588 3300048090 Bacteria 1411
398 Ga0496100_0000002 3300048903 Bacteria 489057
399 Ga0496100_0000049 3300048903 Bacteria 75590
400 Ga0496100_0017280 3300048903 Bacteria 4256
401 Ga0496100_0019389 3300048903 Bacteria 4057
402 Ga0496100_0940573 3300048903 Bacteria 679
403 Ga0496101_0000001 3300048904 Bacteria 489057
404 Ga0496101_0000010 3300048904 Bacteria 281990
405 Ga0496101_0006309 3300048904 Bacteria 7631
406 Ga0496102_0172520 3300048905 Bacteria 2036
407 Ga0496102_0961470 3300048905 Bacteria 775
408 Ga0496103_0207719 3300048906 Bacteria 1259
409 Ga0496104_0066688 3300048907 Bacteria 3417
410 Ga0496105_0683455 3300048908 Bacteria 789
411 Ga0496106_0000018 3300048909 Bacteria 175028
412 Ga0496106_0000084 3300048909 Bacteria 74135
413 Ga0496106_0005943 3300048909 Bacteria 9015
414 Ga0496106_0013067 3300048909 Bacteria 6128
415 Ga0496107_0000003 3300048910 Bacteria 304038
416 Ga0496107_0000032 3300048910 Bacteria 99848
417 Ga0496108_0000005 3300048911 Bacteria 535059
418 Ga0496108_0060126 3300048911 Bacteria 3196
419 Ga0496108_0299294 3300048911 Bacteria 1401
420 Ga0496109_0000095 3300048912 Bacteria 91702
421 Ga0496109_0176174 3300048912 Bacteria 2007
422 Ga0496109_0571056 3300048912 Bacteria 1066
423 Ga0496110_0050917 3300048913 Bacteria 3638
424 Ga0496110_0244194 3300048913 Bacteria 1634
425 Ga0496111_0048061 3300048914 Bacteria 3073
426 Ga0496112_1017235 3300048915 Bacteria 748
427 Ga0496113_0012557 3300048916 Bacteria 5698
428 Ga0496113_0468392 3300048916 Bacteria 1012
429 Ga0496114_0091035 3300048917 Bacteria 2590
430 Ga0496114_0328242 3300048917 Bacteria 1352
431 Ga0496114_0654044 3300048917 Bacteria 924
432 Ga0496115_0000010 3300048918 Bacteria 227112
433 Ga0496121_0051959 3300048924 Bacteria 3446
434 Ga0496121_0214789 3300048924 Bacteria 1360
435 Ga0496126_0179099 3300048929 Bacteria 1802
436 Ga0496126_0476992 3300048929 Bacteria 1000
437 Ga0495682_0322458 3300049460 Bacteria 545
438 Ga0501299_104532 3300049522 Bacteria 662
439 Ga0501031_0259484 3300049568 Bacteria 1129
440 Ga0501031_0292281 3300049568 Bacteria 1056
441 Ga0501031_0937985 3300049568 Bacteria 554
442 Ga0501033_0544770 3300049570 Bacteria 800
443 Ga0501036_0151662 3300049572 Bacteria 1955
444 Ga0501036_0453303 3300049572 Bacteria 1069
445 Ga0501036_0736815 3300049572 Bacteria 813
446 Ga0501037_0098603 3300049573 Bacteria 2111
447 Ga0501038_0670022 3300049574 Bacteria 779
448 Ga0501038_1103350 3300049574 Bacteria 579
449 Ga0501039_0052639 3300049575 Bacteria 3149
450 Ga0501040_0169531 3300049576 Bacteria 1545
451 Ga0501041_0179618 3300049577 Bacteria 1325
452 Ga0501041_0366465 3300049577 Bacteria 911
453 Ga0501042_0065703 3300049578 Bacteria 2592
454 Ga0501042_0177002 3300049578 Bacteria 1539
455 Ga0501042_1268570 3300049578 Bacteria 537
456 Ga0501043_0426518 3300049579 Bacteria 999
457 Ga0501046_0699311 3300049580 Bacteria 714
458 Ga0501048_0014660 3300049582 Bacteria 5800
459 Ga0501048_0317886 3300049582 Bacteria 1109
460 Ga0501067_0100140 3300049583 Bacteria 1610
461 Ga0501071_0126986 3300049587 Bacteria 1893
462 Ga0501071_0855888 3300049587 Bacteria 701
463 Ga0501071_1048929 3300049587 Bacteria 630
464 Ga0501072_0005944 3300049588 Bacteria 9296
465 Ga0501072_0233726 3300049588 Bacteria 1464
466 Ga0501072_0304471 3300049588 Bacteria 1267
467 Ga0501074_0684616 3300049590 Bacteria 724
468 Ga0501075_0138747 3300049591 Bacteria 1852
469 Ga0501075_0429340 3300049591 Bacteria 1007
470 Ga0501075_1056307 3300049591 Bacteria 617
471 Ga0501075_1487455 3300049591 Bacteria 513
472 Ga0501076_0031883 3300049592 Bacteria 4113
473 Ga0501076_0624897 3300049592 Bacteria 889
474 Ga0501076_1199976 3300049592 Bacteria 624
475 Ga0501077_0421728 3300049593 Bacteria 853
476 Ga0501077_0631970 3300049593 Bacteria 688
477 Ga0501209_229243 3300049656 Bacteria 577
478 Ga0501214_049217 3300049659 Bacteria 636
479 Ga0501222_059500 3300049662 Bacteria 576
480 Ga0501224_068732 3300049664 Bacteria 559
481 Ga0501230_057635 3300049667 Bacteria 782
482 Ga0501079_0186795 3300049741 Bacteria 1618
483 Ga0501079_0846402 3300049741 Bacteria 720
484 Ga0501079_0958144 3300049741 Bacteria 674
485 Ga0501081_0060373 3300049743 Bacteria 2626
486 Ga0501081_0410879 3300049743 Bacteria 1003
487 Ga0501282_047314 3300049778 Bacteria 525
488 Ga0501035_0396882 3300049822 Bacteria 1148
489 Ga0501035_0575847 3300049822 Bacteria 920
490 Ga0501044_0546251 3300049823 Bacteria 1056
491 Ga0501045_0043751 3300049824 Bacteria 3261
492 nmdc:mga03n38_18870_c1 3300050490 Bacteria 2729
493 nmdc:mga0yw44_3554_c1 3300050492 Bacteria 6949
494 nmdc:mga0yw44_60647_c1 3300050492 Bacteria 2318
495 nmdc:mga07m45_262323_c1 3300050496 Bacteria 1005
496 nmdc:mga05p37_1416692_c1 3300050507 Bacteria 699
497 nmdc:mga05p37_201970_c1 3300050507 Bacteria 2407
498 nmdc:mga05p37_27333_c1 3300050507 Bacteria 6945
499 nmdc:mga05p37_993999_c1 3300050507 Bacteria 892
500 nmdc:mga09592_39323_c1 3300050508 Bacteria 3973
501 nmdc:mga09592_5100_c1 3300050508 Bacteria 10663
502 nmdc:mga0qj67_109848_c1 3300050509 Bacteria 2226
503 nmdc:mga0qj67_11729_c1 3300050509 Bacteria 6577
504 nmdc:mga0qj67_1303103_c1 3300050509 Bacteria 563
505 nmdc:mga06r32_220125_c1 3300050510 Bacteria 1887
506 nmdc:mga06r32_345841_c1 3300050510 Bacteria 1472
507 nmdc:mga06r32_70756_c1 3300050510 Bacteria 3375
508 nmdc:mga06r32_839499_c1 3300050510 Bacteria 878
509 nmdc:mga0a205_783953_c1 3300050515 Bacteria 801
510 Ga0495601_0150020 3300053077 Bacteria 1522
511 Ga0495601_0609548 3300053077 Bacteria 700
512 Ga0495655_0000007 3300053083 Bacteria 201058
513 Ga0500566_0003245 3300053094 Bacteria 9726
514 Ga0500628_000003 3300053129 Bacteria 204304
515 Ga0501084_0013937 3300054114 Bacteria 6654
516 Ga0501084_0233633 3300054114 Bacteria 1552
517 Ga0590071_106686 3300059421 Bacteria 709
518 Ga0587082_142444 3300059504 Bacteria 560
519 Ga0501082_0546285 3300060353 Bacteria 1013
520 Ga0501082_1128042 3300060353 Bacteria 685
521 Ga0466962_0081546 3300061719 Bacteria 1547
522 Ga0530510_0017933 3300061734 Bacteria 5019
523 Ga0530510_0042837 3300061734 Bacteria 3270
524 Ga0495584_0624145
525 LJNas_1004050
526 LJQas_1001421
527 JGI24743J22301_10026911
528 JGI25151J46595_10066200
529 JGI25407J50210_10020567
530 JGI25407J50210_10059814
531 Ga0055526_1000038
532 Ga0055537_1000602
533 Ga0055524_1000066
534 Ga0055534_1000082
535 Ga0055528_1000023
536 Ga0065714_10115631
537 Ga0065712_10381044
538 Ga0065715_10375211
539 Ga0065707_10197243
540 Ga0065707_10308676
541 Ga0070683_100051147
542 Ga0070670_100025575
543 Ga0070680_100025765
544 Ga0070682_100016907
545 Ga0070682_100282376
546 Ga0068868_100015591
547 Ga0070660_100392303
548 Ga0070689_101968407
549 Ga0070687_100922599
550 Ga0070692_10213464
551 Ga0070692_10406882
552 Ga0070668_100177802
553 Ga0070668_100499429
554 Ga0070674_100001697
555 Ga0070667_101238584
556 Ga0070714_100000019
557 Ga0070701_10509630
558 Ga0070705_100065605
559 Ga0070705_100159636
560 Ga0070700_100001788
561 Ga0070694_100115108
562 Ga0070694_100173160
563 Ga0070708_100637202
564 Ga0070663_100025844
565 Ga0070662_100026717
566 Ga0070681_10068024
567 Ga0070706_100089007
568 Ga0070706_100482924
569 Ga0070707_100870096
570 Ga0070698_100031288
571 Ga0070698_101414015
572 Ga0070699_100512969
573 Ga0070679_100084084
574 Ga0070684_100107268
575 Ga0070697_100030624
576 Ga0070697_100066008
577 Ga0068853_100175515
578 Ga0070695_100299247
579 Ga0070665_100000068
580 Ga0070665_100015514
581 Ga0070704_100041815
582 Ga0070704_100114371
583 Ga0070704_100471944
584 Ga0068855_100006141
585 Ga0068855_100911081
586 Ga0068855_101049476
587 Ga0068857_100118375
588 Ga0068854_100203949
589 Ga0068856_100012557
590 Ga0068856_100042382
591 Ga0068856_100052350
592 Ga0070702_100018003
593 Ga0068852_100103625
594 Ga0068852_100719671
595 Ga0068859_100098590
596 Ga0068859_100209622
597 Ga0068859_100683453
598 Ga0068864_100281808
599 Ga0068864_100764376
600 Ga0068866_10093212
601 Ga0068870_10210999
602 Ga0068870_10604440
603 Ga0068858_100000012
604 Ga0068860_100015536
605 Ga0068862_100141634
606 Ga0068862_100183008
607 Ga0081455_10057132
608 Ga0081455_10106857
609 Ga0081538_10000750
610 Ga0081538_10001641
611 Ga0081538_10003372
612 Ga0081538_10004762
613 Ga0081539_10001190
614 Ga0081539_10050130
615 Ga0075365_10011982
616 Ga0075365_10077599
617 Ga0075364_10125710
618 Ga0070716_100223928
619 Ga0070712_100000007
620 Ga0070712_100014494
621 Ga0070712_100167355
622 Ga0070712_100285111
623 Ga0075367_10067166
624 Ga0075367_10453103
625 Ga0075370_10279689
626 Ga0075428_100092748
627 Ga0075428_100134377
628 Ga0075428_100715103
629 Ga0075430_100005349
630 Ga0075430_100142981
631 Ga0075430_100779452
632 Ga0075430_100939204
633 Ga0075431_100003159
634 Ga0075431_100030757
635 Ga0075431_100075426
636 Ga0075431_100086000
637 Ga0075431_100153913
638 Ga0075429_100009376
639 Ga0075429_100019563
640 Ga0075429_100096595
641 Ga0075429_100164545
642 Ga0075436_100376710
643 Ga0097620_100098593
644 Ga0097620_100683466
645 Ga0099795_10502159
646 Ga0105240_10211883
647 Ga0105240_10630512
648 Ga0105240_10790066
649 Ga0105240_10807031
650 Ga0105240_11727073
651 Ga0111539_12782356
652 Ga0105245_10000353
653 Ga0105245_10009533
654 Ga0105245_10675687
655 Ga0105247_10245631
656 Ga0114129_10733717
657 Ga0114129_10771068
658 Ga0114129_11457199
659 Ga0105243_10252041
660 Ga0105241_11342202
661 Ga0105242_11216827
662 Ga0105248_10000008
663 Ga0105248_10038113
664 Ga0105248_10193051
665 Ga0105237_10204639
666 Ga0105238_11756103
667 Ga0105249_10474257
668 Ga0105249_10497678
669 Ga0105249_11297343
670 Ga0157339_1030089
671 Ga0157369_11899511
672 Ga0157374_10005840
673 Ga0157374_10017616
674 Ga0157374_10282797
675 Ga0157374_12523877
676 Ga0157378_10667966
677 Ga0157372_10065995
678 Ga0157372_10066875
679 Ga0157372_11784805
680 Ga0157375_10054795
681 Ga0157375_10291207
682 Ga0157375_12966359
683 Ga0163163_10892244
684 Ga0182008_10556324
685 Ga0157377_10017279
686 Ga0157376_10100259
687 Ga0157376_11222172
688 Ga0163161_10000022
689 Ga0213873_10172062
690 Ga0213872_10005782
691 Ga0213876_10473984
692 Ga0213875_10009234
693 Ga0213871_10199648
694 Ga0209565_1000005
695 Ga0209673_1000027
696 Ga0209675_1000004
697 Ga0209025_1021925
698 Ga0209564_1000050
699 Ga0209256_1000031
700 Ga0207692_10207180
701 Ga0207692_10292641
702 Ga0207688_10238412
703 Ga0207688_10315268
704 Ga0207699_10867277
705 Ga0207643_10474209
706 Ga0207684_10173509
707 Ga0207707_10019393
708 Ga0207707_10056448
709 Ga0207695_10386757
710 Ga0207695_10493244
711 Ga0207695_10596812
712 Ga0207693_10000001
713 Ga0207693_10016308
714 Ga0207693_10078731
715 Ga0207660_10006668
716 Ga0207657_10199423
717 Ga0207657_10475516
718 Ga0207657_10599441
719 Ga0207652_10011249
720 Ga0207652_10672104
721 Ga0207646_10134672
722 Ga0207646_10782424
723 Ga0207681_10036919
724 Ga0207650_10012162
725 Ga0207687_10000031
726 Ga0207687_10029953
727 Ga0207687_10685562
728 Ga0207664_10000008
729 Ga0207664_10093647
730 Ga0207644_10161150
731 Ga0207690_10137307
732 Ga0207706_10259349
733 Ga0207686_10000042
734 Ga0207669_10570679
735 Ga0207665_10740058
736 Ga0207711_10000006
737 Ga0207711_10103329
738 Ga0207689_10752124
739 Ga0207689_11540017
740 Ga0207667_10009597
741 Ga0207667_10515454
742 Ga0207668_10395690
743 Ga0207668_10541682
744 Ga0207668_11125072
745 Ga0207640_10298607
746 Ga0207658_10510145
747 Ga0207703_10000091
748 Ga0207678_10040838
749 Ga0207708_10000752
750 Ga0207702_10006669
751 Ga0207702_10036713
752 Ga0207702_10118048
753 Ga0207702_10187586
754 Ga0207641_11223343
755 Ga0207648_10064076
756 Ga0207676_10535311
757 Ga0207674_10121634
758 Ga0207683_10287074
759 Ga0207698_10469459
760 Ga0207698_10746093
761 Ga0209971_1065130
762 Ga0209974_10018049
763 Ga0268266_10000020
764 Ga0268266_10021605
765 Ga0268266_10022872
766 Ga0268266_11100277
767 Ga0268264_10009671
768 Ga0307408_100020159
769 Ga0307408_100311498
770 Ga0307408_102038270
771 Ga0307405_10034228
772 Ga0307405_10194329
773 Ga0307405_11677851
774 Ga0307413_10238035
775 Ga0307410_10037029
776 Ga0307410_10294089
777 Ga0307406_10050767
778 Ga0307406_10059849
779 Ga0307406_10203224
780 Ga0307406_10398300
781 Ga0307407_10089769
782 Ga0307407_10176168
783 Ga0307407_10603000
784 Ga0307412_10299275
785 Ga0307409_100053189
786 Ga0307409_100085577
787 Ga0307409_100099279
788 Ga0307409_100100748
789 Ga0307409_100192361
790 Ga0307409_101626045
791 Ga0307416_100024319
792 Ga0307416_100102645
793 Ga0307416_100196609
794 Ga0307416_100320611
795 Ga0307416_102701197
796 Ga0307414_10448545
797 Ga0307411_10103686
798 Ga0307411_10570901
799 Ga0307415_100019245
800 Ga0307415_100044770
801 Ga0307415_100102445
802 Ga0307415_100157576
803 Ga0307415_100245778
804 Ga0307415_101370226
805 Ga0373930_0111524
806 Ga0373949_0211116
807 Ga0373932_0394054
808 Ga0373941_0376512
809 Ga0373946_0471931
810 Ga0373962_0332275
811 Ga0373931_1045443
812 Ga0395899_0133356
813 Ga0395899_0952146
814 Ga0395900_0124882
815 Ga0395900_0626210
816 Ga0395900_1424506
817 Ga0395898_0061270
818 Ga0395898_0670443
819 Ga0395898_0811356
820 Ga0395898_1607673
821 Ga0395905_0220869
822 Ga0395905_0232187
823 Ga0395905_0278368
824 Ga0395905_0908347
825 Ga0436364_0411628
826 Ga0436364_0715275
827 Ga0436364_0758385
828 Ga0395901_0004174
829 Ga0395901_0082931
830 Ga0395901_0147514
831 Ga0395901_0268152
832 Ga0395901_0605497
833 Ga0395901_0923526
834 Ga0395901_1216742
835 Ga0242419_023499
836 Ga0436365_1582894
837 Ga0436360_0885705
838 Ga0436361_0007439
839 Ga0436361_0390306
840 Ga0436361_0938103
841 Ga0436363_0652219
842 Ga0436362_0035815
843 Ga0436362_0137816
844 Ga0436362_0384422
845 Ga0436362_0408148
846 Ga0436362_0727618
847 Ga0439461_0153621
848 Ga0451789_0280886
849 Ga0451804_0407870
850 Ga0451807_0461799
851 Ga0451833_0416868
852 Ga0451853_1137946
853 Ga0439454_056697
854 Ga0450923_042174
855 Ga0439434_0122243
856 Ga0439444_0106549
857 Ga0439464_0222504
858 Ga0451577_0075398
859 Ga0451577_0322188
860 Ga0439440_0136100
861 Ga0453683_0070474
862 Ga0466963_0085891
863 Ga0453684_0199710
864 Ga0466971_0051743
865 Ga0466970_0126448
866 Ga0466970_0415268
867 Ga0466957_0149557
868 Ga0466959_0020002
869 Ga0466959_0690961
870 Ga0451576_0030447
871 Ga0451576_1670664
872 Ga0466958_0031128
873 Ga0466967_0940821
874 Ga0466967_2466662
875 Ga0495617_203068
876 Ga0495627_124014
877 Ga0495629_0012870
878 Ga0495653_0481084
879 Ga0495605_0212484
880 Ga0495585_0045852
881 Ga0495585_0205099
882 Ga0495585_0309128
883 Ga0495596_0035564
884 Ga0495596_0280405
885 Ga0495607_0119766
886 Ga0495583_0094501
887 Ga0495606_0203612
888 Ga0495610_0096588
889 Ga0495620_0179994
890 Ga0495631_0025766
891 Ga0495632_0407521
892 Ga0495637_0002566
893 Ga0495637_0088065
894 Ga0495643_0068717
895 Ga0495644_0004681
896 Ga0495665_0700851
897 Ga0495640_0339671
898 Ga0495633_0004377
899 Ga0495633_0550302
900 Ga0495611_0567487
901 Ga0495625_0022940
902 Ga0495659_0558056
903 Ga0495661_0006837
904 Ga0495588_0000218
905 Ga0495624_0000030
906 Ga0495670_0004992
907 Ga0495671_0243221
908 Ga0495649_0030737
909 Ga0495649_0262164
910 Ga0495636_0167451
911 Ga0495676_0005489
912 Ga0495676_0086672
913 Ga0495676_1001065
914 Ga0495683_0287945
915 Ga0495687_064827
916 Ga0495675_0226626
917 Ga0495677_0237001
918 Ga0495685_087956
919 Ga0495673_0299264
920 Ga0495615_0023588
921 Ga0496100_0000002
922 Ga0496100_0000049
923 Ga0496100_0017280
924 Ga0496100_0019389
925 Ga0496100_0940573
926 Ga0496101_0000001
927 Ga0496101_0000010
928 Ga0496101_0006309
929 Ga0496102_0172520
930 Ga0496102_0961470
931 Ga0496103_0207719
932 Ga0496104_0066688
933 Ga0496105_0683455
934 Ga0496106_0000018
935 Ga0496106_0000084
936 Ga0496106_0005943
937 Ga0496106_0013067
938 Ga0496107_0000003
939 Ga0496107_0000032
940 Ga0496108_0000005
941 Ga0496108_0060126
942 Ga0496108_0299294
943 Ga0496109_0000095
944 Ga0496109_0176174
945 Ga0496109_0571056
946 Ga0496110_0050917
947 Ga0496110_0244194
948 Ga0496111_0048061
949 Ga0496112_1017235
950 Ga0496113_0012557
951 Ga0496113_0468392
952 Ga0496114_0091035
953 Ga0496114_0328242
954 Ga0496114_0654044
955 Ga0496115_0000010
956 Ga0496121_0051959
957 Ga0496121_0214789
958 Ga0496126_0179099
959 Ga0496126_0476992
960 Ga0495682_0322458
961 Ga0501299_104532
962 Ga0501031_0259484
963 Ga0501031_0292281
964 Ga0501031_0937985
965 Ga0501033_0544770
966 Ga0501036_0151662
967 Ga0501036_0453303
968 Ga0501036_0736815
969 Ga0501037_0098603
970 Ga0501038_0670022
971 Ga0501038_1103350
972 Ga0501039_0052639
973 Ga0501040_0169531
974 Ga0501041_0179618
975 Ga0501041_0366465
976 Ga0501042_0065703
977 Ga0501042_0177002
978 Ga0501042_1268570
979 Ga0501043_0426518
980 Ga0501046_0699311
981 Ga0501048_0014660
982 Ga0501048_0317886
983 Ga0501067_0100140
984 Ga0501071_0126986
985 Ga0501071_0855888
986 Ga0501071_1048929
987 Ga0501072_0005944
988 Ga0501072_0233726
989 Ga0501072_0304471
990 Ga0501074_0684616
991 Ga0501075_0138747
992 Ga0501075_0429340
993 Ga0501075_1056307
994 Ga0501075_1487455
995 Ga0501076_0031883
996 Ga0501076_0624897
997 Ga0501076_1199976
998 Ga0501077_0421728
999 Ga0501077_0631970
1000 Ga0501209_229243
1001 Ga0501214_049217
1002 Ga0501222_059500
1003 Ga0501224_068732
1004 Ga0501230_057635
1005 Ga0501079_0186795
1006 Ga0501079_0846402
1007 Ga0501079_0958144
1008 Ga0501081_0060373
1009 Ga0501081_0410879
1010 Ga0501282_047314
1011 Ga0501035_0396882
1012 Ga0501035_0575847
1013 Ga0501044_0546251
1014 Ga0501045_0043751
1015 nmdc:mga03n38_18870_c1
1016 nmdc:mga0yw44_3554_c1
1017 nmdc:mga0yw44_60647_c1
1018 nmdc:mga07m45_262323_c1
1019 nmdc:mga05p37_1416692_c1
1020 nmdc:mga05p37_201970_c1
1021 nmdc:mga05p37_27333_c1
1022 nmdc:mga05p37_993999_c1
1023 nmdc:mga09592_39323_c1
1024 nmdc:mga09592_5100_c1
1025 nmdc:mga0qj67_109848_c1
1026 nmdc:mga0qj67_11729_c1
1027 nmdc:mga0qj67_1303103_c1
1028 nmdc:mga06r32_220125_c1
1029 nmdc:mga06r32_345841_c1
1030 nmdc:mga06r32_70756_c1
1031 nmdc:mga06r32_839499_c1
1032 nmdc:mga0a205_783953_c1
1033 Ga0495601_0150020
1034 Ga0495601_0609548
1035 Ga0495655_0000007
1036 Ga0500566_0003245
1037 Ga0500628_000003
1038 Ga0501084_0013937
1039 Ga0501084_0233633
1040 Ga0590071_106686
1041 Ga0587082_142444
1042 Ga0501082_0546285
1043 Ga0501082_1128042
1044 Ga0466962_0081546
1045 Ga0530510_0017933
1046 Ga0530510_0042837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

148

0.94

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

12

42

0.9

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9572 1 150
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.951 1 150
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8184 8 145
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.7916 8 146
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7891 117 150
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9547 5 150 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9482 5 150 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8377 13 148 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8235 13 148 3.10.180.10
af_A0A0R0LFH0_212_347_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8137 11 147 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A536LG09-F1-model_v4 VOC family protein 0.9966 5 150 GO:0004493
GO:0046491
AF-A0A543GAS1-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9954 5 150 GO:0004493
GO:0016829
GO:0046491
GO:0051213
AF-A0A511MCV0-F1-model_v4 Glyoxalase 0.9908 7 150 GO:0004493
GO:0046491
AF-A0A536LG09-F1-model_v4 VOC family protein 0.9898 5 150 GO:0004493
GO:0046491
AF-A0A4Q6BND0-F1-model_v4 VOC family protein 0.9889 5 72

Map