F459035

General Info

Members Datasets Scaffolds Average Seq Length
523 281 1046 317

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0084976|Ga0495606_0084976_481_1572
Length 363
Sequence MKISDFQLMCSKYFQSFKLKSNVTYVLKTFMPFVVKNQFKMKKFTSVSDVKNLQEIIKKALQIKENPLSEAEKGKGKTIGLVFLNSSLRTRLSSQIAAQNLGLNVLTLNAAQEAWNLEFADGSVMNGDTVEHIKDAIEVLNQYCDIIAVRCFAGMKSKADDINESILSQFEQHAKVPVISLESATRHPLQSLADCITITENWPSDKLSVQRKPKVVLTWAPHIKPIAHAVGNSFAEWMQEMDVELVIANPEGYDLDKNFTKDVEVVHNQDEALKDADFIYVKNWSSFDDYAAMPEVKENWMLTNEKLTNTNRGKVMHCLPVRRNVELSDEVMDGENSIIYQQAKNRIFSAQAVFSEILDELNS

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
206 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
207 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
208 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
209 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
210 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
211 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
212 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
213 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
214 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
215 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
216 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
217 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
218 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
219 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
220 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
221 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
222 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
223 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
224 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
225 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
226 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
227 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
228 2738541283 Pedobacter sp. OK701 Isolate Unclassified
229 2738541284 Pedobacter sp. YR016 Isolate Unclassified
230 2738541302 Pedobacter sp. CF074 Isolate Unclassified
231 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
232 2738543023 Pedobacter sp. OK628 Isolate Unclassified
233 2739367651 Pedobacter sp. OK291 Isolate Unclassified
234 2739367656 Pedobacter sp. CF523 Isolate Unclassified
235 2739367663 Pedobacter sp. YR510 Isolate Unclassified
236 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
237 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
238 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
239 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
240 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
241 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
242 2818991437 Pedobacter terrae 518 Isolate Unclassified
243 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
244 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
245 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
246 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
247 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
248 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
249 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
250 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
251 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
252 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
253 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
254 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
255 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
256 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
257 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
258 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
259 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
260 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
261 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
262 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
263 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
264 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
265 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
266 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
267 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
268 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
269 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
270 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
271 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
272 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
273 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
274 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
275 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
276 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
277 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
278 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
279 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
280 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
281 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.89
Metatranscriptomes 0.38
Isolates 14.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 8.41
Nodule 0.19
Rhizoplane 0.38
Rhizosphere 78.39
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0084976 3300046507 Bacteria 1958
2 SwRhRL2b_contig_1316395 2162886007 Bacteria 3098
3 SwRhRL2b_contig_999397 2162886007 Bacteria 14282
4 JGI24739J22299_10012505 3300001989 Bacteria 3114
5 JGI24737J22298_10002537 3300001990 Bacteria 6482
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI25162J39368_1000024 3300002737 Bacteria 229507
8 JGI25162J39368_1001318 3300002737 Bacteria 13921
9 JGI25164J39214_1000855 3300002772 Bacteria 10454
10 JGI25152J39213_1000007 3300002773 Bacteria 156012
11 JGI25150J39212_1000013 3300002774 Bacteria 182307
12 JGI25151J46595_10000004 3300003187 Bacteria 494006
13 JGI25165J46597_1001051 3300003214 Bacteria 17893
14 JGI25153J46596_10000004 3300003215 Bacteria 494006
15 rootH1_10034282 3300003316 Bacteria 9753
16 rootH2_10005719 3300003320 Bacteria 108734
17 rootH2_10034253 3300003320 Bacteria 4356
18 rootH2_10199718 3300003320 Bacteria 2830
19 rootL2_10188325 3300003322 Bacteria 3215
20 rootH1_10002666 3300003323 Bacteria 23641
21 rootH1_10062121 3300003323 Bacteria 7043
22 rootH1_10164695 3300003323 Bacteria 4269
23 Ga0055536_1000010 3300003781 Bacteria 304614
24 Ga0055530_10002214 3300003791 Bacteria 12844
25 Ga0058863_11862405 3300004799 Bacteria 1151
26 Ga0065714_10003996 3300005288 Bacteria 10318
27 Ga0065714_10008508 3300005288 Bacteria 2837
28 Ga0065714_10019517 3300005288 Bacteria 2096
29 Ga0065714_10064770 3300005288 Bacteria 19370
30 Ga0065714_10078396 3300005288 Bacteria 2593
31 Ga0065714_10091473 3300005288 Bacteria 1909
32 Ga0065704_10070374 3300005289 Bacteria 28734
33 Ga0065704_10073279 3300005289 Bacteria 7354
34 Ga0065704_10074546 3300005289 Bacteria 6194
35 Ga0065704_10074685 3300005289 Bacteria 6078
36 Ga0065704_10075281 3300005289 Bacteria 5680
37 Ga0070658_10000011 3300005327 Bacteria 294396
38 Ga0070658_10310988 3300005327 Bacteria 1344
39 Ga0070676_10000277 3300005328 Bacteria 22624
40 Ga0070683_100003504 3300005329 Bacteria 12763
41 Ga0070680_100010203 3300005336 Bacteria 7242
42 Ga0068868_100005721 3300005338 Bacteria 8753
43 Ga0068868_100046851 3300005338 Bacteria 3385
44 Ga0070660_100279327 3300005339 Bacteria 1366
45 Ga0070668_100281915 3300005347 Bacteria 1388
46 Ga0070673_100003782 3300005364 Bacteria 9493
47 Ga0070659_100000449 3300005366 Bacteria 30726
48 Ga0070659_100002083 3300005366 Bacteria 14235
49 Ga0070659_100096749 3300005366 Bacteria 2372
50 Ga0070663_100033364 3300005455 Bacteria 3556
51 Ga0070678_100006236 3300005456 Bacteria 6976
52 Ga0070662_100000032 3300005457 Bacteria 78824
53 Ga0068867_100009759 3300005459 Bacteria 6765
54 Ga0070679_100071406 3300005530 Bacteria 3463
55 Ga0070684_100026406 3300005535 Bacteria 4892
56 Ga0070684_100140169 3300005535 Bacteria 2186
57 Ga0068853_100008727 3300005539 Bacteria 8154
58 Ga0070665_100000003 3300005548 Bacteria 811857
59 Ga0070665_100005248 3300005548 Bacteria 13397
60 Ga0068855_100000508 3300005563 Bacteria 48055
61 Ga0068855_100010454 3300005563 Bacteria 11197
62 Ga0068855_100183762 3300005563 Bacteria 2363
63 Ga0068855_100515878 3300005563 Bacteria 1297
64 Ga0068857_100072451 3300005577 Bacteria 3070
65 Ga0068854_100082162 3300005578 Bacteria 2381
66 Ga0068856_100001512 3300005614 Bacteria 24373
67 Ga0068856_100035627 3300005614 Bacteria 4878
68 Ga0068856_100401438 3300005614 Bacteria 1390
69 Ga0068852_100002452 3300005616 Bacteria 12774
70 Ga0068858_100016470 3300005842 Bacteria 6941
71 Ga0075366_10000804 3300006195 Bacteria 15009
72 Ga0075366_10001072 3300006195 Bacteria 13441
73 Ga0075366_10026341 3300006195 Bacteria 3405
74 Ga0097621_100000165 3300006237 Bacteria 41398
75 Ga0068871_100000018 3300006358 Bacteria 89690
76 Ga0068865_100000396 3300006881 Bacteria 24307
77 Ga0105244_10000011 3300009036 Bacteria 263939
78 Ga0105244_10015993 3300009036 Bacteria 4288
79 Ga0105240_10000237 3300009093 Bacteria 109895
80 Ga0105240_10022011 3300009093 Bacteria 8465
81 Ga0105240_10029393 3300009093 Bacteria 7160
82 Ga0105240_10080973 3300009093 Bacteria 3992
83 Ga0105240_10105597 3300009093 Unclassified 3419
84 Ga0105240_10193574 3300009093 Bacteria 2389
85 Ga0105240_10322811 3300009093 Bacteria 1759
86 Ga0105240_10612145 3300009093 Bacteria 1198
87 Ga0105245_10332035 3300009098 Bacteria 1501
88 Ga0105243_10000009 3300009148 Bacteria 354419
89 Ga0105243_10000145 3300009148 Bacteria 81468
90 Ga0105243_10132757 3300009148 Bacteria 2115
91 Ga0105241_10003076 3300009174 Bacteria 12441
92 Ga0105241_10007004 3300009174 Bacteria 8292
93 Ga0105241_10021319 3300009174 Bacteria 4789
94 Ga0105241_10535386 3300009174 Unclassified 1049
95 Ga0105242_10005497 3300009176 Bacteria 9783
96 Ga0105237_10000224 3300009545 Bacteria 79854
97 Ga0105237_10000952 3300009545 Bacteria 38921
98 Ga0105237_10000963 3300009545 Bacteria 38740
99 Ga0105237_10001604 3300009545 Bacteria 29361
100 Ga0105237_10001948 3300009545 Bacteria 26296
101 Ga0105237_10057582 3300009545 Bacteria 3889
102 Ga0105237_10089685 3300009545 Bacteria 3064
103 Ga0105237_10140955 3300009545 Bacteria 2405
104 Ga0105237_10381019 3300009545 Bacteria 1415
105 Ga0105238_10054337 3300009551 Bacteria 4022
106 Ga0105238_10121567 3300009551 Bacteria 2590
107 Ga0105249_10021227 3300009553 Bacteria 5814
108 Ga0105239_10000002 3300010375 Bacteria 610298
109 Ga0105239_10000013 3300010375 Bacteria 327371
110 Ga0105239_10001207 3300010375 Bacteria 35283
111 Ga0105239_10004436 3300010375 Bacteria 16776
112 Ga0105239_10006888 3300010375 Bacteria 13111
113 Ga0105239_10014078 3300010375 Bacteria 8880
114 Ga0105239_10016396 3300010375 Bacteria 8194
115 Ga0105239_10122009 3300010375 Bacteria 2895
116 Ga0105239_10139806 3300010375 Bacteria 2698
117 Ga0157373_10000005 3300013100 Bacteria 262158
118 Ga0157373_10000256 3300013100 Bacteria 43374
119 Ga0157373_10000936 3300013100 Bacteria 22553
120 Ga0157373_10001025 3300013100 Bacteria 21601
121 Ga0157373_10001318 3300013100 Bacteria 18986
122 Ga0157373_10016309 3300013100 Bacteria 5420
123 Ga0157373_10025856 3300013100 Bacteria 4243
124 Ga0157373_10087000 3300013100 Bacteria 2202
125 Ga0157371_10000046 3300013102 Bacteria 187304
126 Ga0157371_10000079 3300013102 Bacteria 152295
127 Ga0157371_10000216 3300013102 Bacteria 83975
128 Ga0157371_10002552 3300013102 Bacteria 17284
129 Ga0157371_10017592 3300013102 Bacteria 5306
130 Ga0157371_10017639 3300013102 Bacteria 5296
131 Ga0157371_10022991 3300013102 Bacteria 4558
132 Ga0157371_10061989 3300013102 Bacteria 2652
133 Ga0157371_10116522 3300013102 Bacteria 1898
134 Ga0157370_10001014 3300013104 Bacteria 35409
135 Ga0157370_10002361 3300013104 Bacteria 22770
136 Ga0157370_10014349 3300013104 Bacteria 8104
137 Ga0157370_10020909 3300013104 Bacteria 6528
138 Ga0157370_10021398 3300013104 Bacteria 6445
139 Ga0157370_10030370 3300013104 Bacteria 5295
140 Ga0157370_10052066 3300013104 Bacteria 3909
141 Ga0157370_10204819 3300013104 Bacteria 1830
142 Ga0157370_10224061 3300013104 Bacteria 1741
143 Ga0157370_10239703 3300013104 Bacteria 1678
144 Ga0157369_10000046 3300013105 Bacteria 172851
145 Ga0157369_10002118 3300013105 Bacteria 23921
146 Ga0157369_10002502 3300013105 Bacteria 22008
147 Ga0157369_10051465 3300013105 Bacteria 4457
148 Ga0157369_10070760 3300013105 Bacteria 3747
149 Ga0157374_10000348 3300013296 Bacteria 42744
150 Ga0157374_10010541 3300013296 Bacteria 7955
151 Ga0157374_10084201 3300013296 Bacteria 3022
152 Ga0163162_10000031 3300013306 Bacteria 157666
153 Ga0163162_10000037 3300013306 Bacteria 138420
154 Ga0163162_10006339 3300013306 Bacteria 11456
155 Ga0163162_10009851 3300013306 Bacteria 9295
156 Ga0157372_10000001 3300013307 Bacteria 791349
157 Ga0157372_10000196 3300013307 Bacteria 66430
158 Ga0157372_10023256 3300013307 Bacteria 6716
159 Ga0157372_10032550 3300013307 Bacteria 5719
160 Ga0157372_10084127 3300013307 Bacteria 3605
161 Ga0157372_10348795 3300013307 Bacteria 1724
162 Ga0157375_10000722 3300013308 Bacteria 29134
163 Ga0157375_10012838 3300013308 Bacteria 7439
164 Ga0157375_10017987 3300013308 Bacteria 6400
165 Ga0157375_10204731 3300013308 Bacteria 2130
166 Ga0182008_10000025 3300014497 Bacteria 191222
167 Ga0182008_10000037 3300014497 Bacteria 129884
168 Ga0182008_10000058 3300014497 Bacteria 100175
169 Ga0182008_10000208 3300014497 Bacteria 46272
170 Ga0182006_1000039 3300015261 Bacteria 211568
171 Ga0182006_1000333 3300015261 Bacteria 40401
172 Ga0182006_1000576 3300015261 Bacteria 27061
173 Ga0182006_1002025 3300015261 Bacteria 11378
174 Ga0182006_1003058 3300015261 Bacteria 8777
175 Ga0182006_1003255 3300015261 Bacteria 8413
176 Ga0182007_10000009 3300015262 Bacteria 316298
177 Ga0183373_1008 3300015682 Bacteria 255339
178 Ga0163161_10000343 3300017792 Bacteria 39534
179 Ga0163161_10000628 3300017792 Bacteria 28142
180 Ga0163161_10001101 3300017792 Bacteria 20390
181 Ga0163161_10002195 3300017792 Bacteria 14086
182 Ga0163161_10005715 3300017792 Bacteria 8621
183 Ga0163161_10062075 3300017792 Bacteria 2722
184 Ga0206351_10804740 3300020077 Bacteria 1231
185 Ga0207427_100103 3300025231 Bacteria 119618
186 Ga0209437_100017 3300025233 Bacteria 694471
187 Ga0209437_100101 3300025233 Bacteria 226668
188 Ga0207425_1000008 3300025245 Bacteria 618024
189 Ga0209026_1001716 3300025250 Bacteria 9131
190 Ga0209026_1002049 3300025250 Bacteria 7962
191 Ga0209026_1009429 3300025250 Bacteria 1917
192 Ga0209129_1000042 3300025258 Bacteria 305537
193 Ga0209233_1000124 3300025261 Bacteria 226743
194 Ga0209233_1012541 3300025261 Bacteria 2455
195 Ga0209233_1028619 3300025261 Bacteria 1335
196 Ga0209455_1004555 3300025272 Bacteria 4496
197 Ga0209675_1000935 3300025291 Bacteria 18609
198 Ga0209676_1000009 3300025292 Bacteria 981719
199 Ga0209025_1000020 3300025294 Bacteria 618024
200 Ga0209758_1000022 3300025297 Bacteria 618024
201 Ga0209050_1000103 3300025298 Bacteria 229225
202 Ga0207655_1000242 3300025728 Bacteria 89450
203 Ga0207647_10000104 3300025904 Bacteria 65696
204 Ga0207647_10016843 3300025904 Bacteria 4979
205 Ga0207647_10028212 3300025904 Bacteria 3649
206 Ga0207645_10000650 3300025907 Bacteria 28882
207 Ga0207705_10000015 3300025909 Bacteria 382901
208 Ga0207654_10007717 3300025911 Bacteria 5429
209 Ga0207654_10040210 3300025911 Bacteria 2634
210 Ga0207654_10108830 3300025911 Bacteria 1720
211 Ga0207654_10262008 3300025911 Bacteria 1163
212 Ga0207695_10000013 3300025913 Bacteria 821265
213 Ga0207695_10005995 3300025913 Bacteria 15895
214 Ga0207695_10012058 3300025913 Bacteria 10392
215 Ga0207695_10063612 3300025913 Bacteria 3803
216 Ga0207695_10185392 3300025913 Bacteria 2000
217 Ga0207695_10279223 3300025913 Bacteria 1564
218 Ga0207671_10000257 3300025914 Bacteria 79555
219 Ga0207671_10001649 3300025914 Bacteria 25415
220 Ga0207671_10002707 3300025914 Bacteria 18581
221 Ga0207671_10005976 3300025914 Bacteria 11017
222 Ga0207671_10010699 3300025914 Bacteria 7545
223 Ga0207671_10011508 3300025914 Bacteria 7189
224 Ga0207671_10015114 3300025914 Bacteria 6065
225 Ga0207671_10027878 3300025914 Bacteria 4221
226 Ga0207671_10050884 3300025914 Bacteria 3068
227 Ga0207657_10115063 3300025919 Bacteria 2217
228 Ga0207652_10127751 3300025921 Bacteria 2265
229 Ga0207652_10230376 3300025921 Bacteria 1670
230 Ga0207694_10030177 3300025924 Bacteria 4140
231 Ga0207687_10306053 3300025927 Bacteria 1281
232 Ga0207644_10004079 3300025931 Bacteria 9474
233 Ga0207690_10003150 3300025932 Bacteria 9903
234 Ga0207690_10038065 3300025932 Bacteria 3128
235 Ga0207706_10000191 3300025933 Bacteria 68535
236 Ga0207709_10000026 3300025935 Bacteria 354467
237 Ga0207709_10000365 3300025935 Bacteria 45523
238 Ga0207669_10074946 3300025937 Bacteria 2142
239 Ga0207704_10000053 3300025938 Bacteria 79904
240 Ga0207661_10011433 3300025944 Bacteria 6432
241 Ga0207667_10009017 3300025949 Bacteria 11800
242 Ga0207667_10066475 3300025949 Bacteria 3758
243 Ga0207667_10085157 3300025949 Bacteria 3272
244 Ga0207667_10219017 3300025949 Bacteria 1950
245 Ga0207667_10438960 3300025949 Bacteria 1327
246 Ga0207651_10063426 3300025960 Bacteria 2580
247 Ga0207668_10218805 3300025972 Bacteria 1528
248 Ga0207640_10175836 3300025981 Bacteria 1600
249 Ga0207677_10005788 3300026023 Bacteria 6724
250 Ga0207703_10255426 3300026035 Bacteria 1582
251 Ga0207639_10006469 3300026041 Bacteria 7969
252 Ga0207678_10051050 3300026067 Bacteria 3571
253 Ga0207702_10018455 3300026078 Bacteria 5772
254 Ga0207648_10000175 3300026089 Bacteria 66839
255 Ga0207674_10470008 3300026116 Bacteria 1215
256 Ga0207683_10019929 3300026121 Bacteria 5731
257 Ga0207698_10004722 3300026142 Bacteria 8333
258 Ga0268266_10000018 3300028379 Bacteria 569141
259 Ga0268266_10005285 3300028379 Bacteria 12122
260 Ga0307517_10002197 3300028786 Bacteria 31568
261 Ga0307515_10000927 3300028794 Bacteria 67260
262 Ga0307515_10001771 3300028794 Bacteria 48123
263 Ga0316177_1066667 3300030731 Bacteria 4256
264 Ga0316181_1280954 3300030744 Bacteria 6095
265 Ga0265327_10015148 3300031251 Bacteria 4997
266 Ga0265316_10126691 3300031344 Unclassified 1925
267 Ga0307408_100000534 3300031548 Bacteria 32864
268 Ga0307408_100000564 3300031548 Bacteria 31968
269 Ga0307408_100000881 3300031548 Bacteria 23605
270 Ga0307408_100006316 3300031548 Bacteria 7868
271 Ga0307405_10000016 3300031731 Bacteria 197180
272 Ga0307407_10000006 3300031903 Bacteria 218714
273 Ga0307412_10000001 3300031911 Bacteria 822691
274 Ga0307412_10000034 3300031911 Bacteria 206033
275 Ga0307412_10000154 3300031911 Bacteria 49488
276 Ga0307412_10003359 3300031911 Bacteria 8890
277 Ga0307412_10235421 3300031911 Bacteria 1413
278 Ga0307409_100093935 3300031995 Bacteria 2466
279 Ga0307416_100000030 3300032002 Bacteria 162430
280 Ga0307416_100000032 3300032002 Bacteria 156777
281 Ga0307416_100282595 3300032002 Bacteria 1637
282 Ga0307414_10000127 3300032004 Bacteria 53237
283 Ga0307414_10000392 3300032004 Bacteria 23857
284 Ga0307414_10001064 3300032004 Bacteria 14054
285 Ga0307414_10001471 3300032004 Bacteria 12250
286 Ga0307414_10003449 3300032004 Bacteria 8439
287 Ga0307414_10012506 3300032004 Bacteria 5021
288 Ga0307414_10015489 3300032004 Bacteria 4602
289 Ga0307414_10017742 3300032004 Bacteria 4363
290 Ga0307414_10088776 3300032004 Bacteria 2289
291 Ga0307414_10134861 3300032004 Unclassified 1923
292 Ga0307414_10159976 3300032004 Bacteria 1787
293 Ga0307414_10199158 3300032004 Bacteria 1627
294 Ga0307411_10122547 3300032005 Bacteria 1884
295 Ga0307507_10000064 3300033179 Bacteria 161226
296 Ga0307510_10000328 3300033180 Bacteria 44214
297 Ga0395899_0000033 3300037312 Bacteria 306589
298 Ga0395899_0000435 3300037312 Bacteria 47985
299 Ga0395899_0001077 3300037312 Bacteria 24592
300 Ga0395899_0047826 3300037312 Bacteria 3184
301 Ga0395900_0001393 3300037418 Bacteria 28920
302 Ga0395900_0003225 3300037418 Bacteria 17664
303 Ga0395900_0259867 3300037418 Bacteria 1735
304 Ga0395898_0013831 3300037466 Bacteria 8295
305 Ga0395905_0001914 3300037471 Bacteria 23897
306 Ga0395905_0002241 3300037471 Bacteria 21758
307 Ga0395901_0008879 3300038443 Bacteria 10175
308 Ga0395901_0017854 3300038443 Bacteria 7241
309 Ga0395901_0030985 3300038443 Bacteria 5513
310 Ga0436361_0307685 3300039447 Bacteria 5871
311 Ga0439445_0000024 3300042004 Bacteria 20068
312 Ga0439448_0001740 3300042005 Bacteria 5754
313 Ga0451577_0000042 3300042876 Bacteria 332086
314 Ga0451577_0000418 3300042876 Bacteria 77022
315 Ga0451577_0008464 3300042876 Bacteria 10010
316 Ga0451577_0043525 3300042876 Bacteria 4022
317 Ga0451577_0084405 3300042876 Bacteria 2834
318 Ga0451577_0087277 3300042876 Bacteria 2783
319 Ga0453683_0000572 3300044673 Bacteria 40700
320 Ga0466966_0056842 3300044684 Bacteria 2474
321 Ga0466961_0032510 3300044693 Bacteria 3353
322 Ga0453684_0000148 3300044712 Bacteria 308453
323 Ga0453684_0000452 3300044712 Bacteria 165844
324 Ga0453684_0001009 3300044712 Bacteria 91051
325 Ga0453684_0004934 3300044712 Bacteria 27202
326 Ga0453684_0007816 3300044712 Bacteria 19501
327 Ga0453684_0008001 3300044712 Bacteria 19144
328 Ga0453684_0016398 3300044712 Bacteria 11587
329 Ga0453684_0079435 3300044712 Bacteria 4101
330 Ga0453684_0665676 3300044712 Bacteria 1134
331 Ga0466968_0052929 3300044735 Bacteria 1738
332 Ga0466959_0088026 3300045049 Bacteria 2233
333 Ga0451576_0000002 3300045051 Bacteria 1670975
334 Ga0451576_0000254 3300045051 Bacteria 131595
335 Ga0451576_0011828 3300045051 Bacteria 9878
336 Ga0451576_0035219 3300045051 Bacteria 5312
337 Ga0451576_0038684 3300045051 Bacteria 5049
338 Ga0451576_0091554 3300045051 Bacteria 3163
339 Ga0451576_0288735 3300045051 Unclassified 1715
340 Ga0495627_000034 3300046453 Bacteria 214913
341 Ga0495627_006712 3300046453 Bacteria 4480
342 Ga0495627_023933 3300046453 Bacteria 1996
343 Ga0495638_0047843 3300046460 Bacteria 2680
344 Ga0495638_0128224 3300046460 Bacteria 1493
345 Ga0495651_0213311 3300046462 Bacteria 1342
346 Ga0495650_0000003 3300046471 Bacteria 900730
347 Ga0495650_0019343 3300046471 Bacteria 3356
348 Ga0495585_0000079 3300046492 Bacteria 100159
349 Ga0495585_0000411 3300046492 Bacteria 41565
350 Ga0495596_0000865 3300046500 Bacteria 18244
351 Ga0495596_0038961 3300046500 Bacteria 1878
352 Ga0495583_0072268 3300046506 Bacteria 1514
353 Ga0495606_0000116 3300046507 Bacteria 134901
354 Ga0495606_0020880 3300046507 Bacteria 4812
355 Ga0495606_0026181 3300046507 Bacteria 4160
356 Ga0495606_0041663 3300046507 Bacteria 3078
357 Ga0495606_0066123 3300046507 Bacteria 2294
358 Ga0495610_0000001 3300046512 Bacteria 1620061
359 Ga0495610_0000992 3300046512 Bacteria 26173
360 Ga0495610_0001007 3300046512 Bacteria 25962
361 Ga0495610_0004188 3300046512 Bacteria 10774
362 Ga0495616_0008226 3300046513 Bacteria 6192
363 Ga0495616_0027711 3300046513 Bacteria 3004
364 Ga0495631_0058444 3300046518 Bacteria 1677
365 Ga0495632_0025163 3300046519 Bacteria 3151
366 Ga0495637_0003326 3300046520 Bacteria 8549
367 Ga0495643_0032463 3300046522 Bacteria 2898
368 Ga0495648_0002877 3300046524 Bacteria 15501
369 Ga0495663_0000406 3300046525 Bacteria 15767
370 Ga0495652_0190061 3300046529 Bacteria 1567
371 Ga0495654_0000001 3300046530 Bacteria 1513197
372 Ga0495654_0063488 3300046530 Bacteria 1768
373 Ga0495609_0000025 3300046538 Bacteria 256898
374 Ga0495609_0063658 3300046538 Bacteria 1628
375 Ga0495622_0068843 3300046557 Bacteria 1635
376 Ga0495633_0000056 3300046558 Bacteria 149334
377 Ga0495633_0000057 3300046558 Bacteria 148536
378 Ga0495633_0005100 3300046558 Bacteria 8155
379 Ga0495633_0012731 3300046558 Bacteria 4461
380 Ga0495668_0000021 3300046616 Bacteria 381308
381 Ga0495625_0000159 3300046660 Bacteria 104355
382 Ga0495625_0001186 3300046660 Bacteria 33408
383 Ga0495625_0002144 3300046660 Bacteria 21944
384 Ga0495625_0058408 3300046660 Bacteria 2741
385 Ga0495625_0071364 3300046660 Bacteria 2437
386 Ga0495625_0111164 3300046660 Bacteria 1872
387 Ga0495625_0203190 3300046660 Bacteria 1306
388 Ga0495661_0001360 3300046665 Bacteria 20657
389 Ga0495661_0009673 3300046665 Bacteria 6604
390 Ga0495661_0100778 3300046665 Bacteria 1626
391 Ga0495661_0191047 3300046665 Bacteria 1078
392 Ga0495658_0028903 3300046683 Bacteria 2996
393 Ga0495671_0031940 3300046692 Bacteria 2690
394 Ga0495649_0000003 3300046694 Bacteria 880817
395 Ga0495600_0026176 3300046809 Bacteria 3763
396 Ga0495660_0006068 3300046810 Bacteria 7175
397 Ga0495687_002367 3300047443 Bacteria 15256
398 Ga0495686_0000160 3300047472 Bacteria 128437
399 Ga0495686_0000489 3300047472 Bacteria 58459
400 Ga0495686_0001122 3300047472 Bacteria 31676
401 Ga0495686_0002126 3300047472 Bacteria 19394
402 Ga0495686_0097503 3300047472 Bacteria 1777
403 Ga0496102_0091250 3300048905 Bacteria 2820
404 Ga0496116_0000266 3300048919 Bacteria 91468
405 Ga0496116_0005535 3300048919 Bacteria 11653
406 Ga0496117_0000365 3300048920 Bacteria 78847
407 Ga0496117_0001863 3300048920 Bacteria 28457
408 Ga0496118_0000672 3300048921 Bacteria 55573
409 Ga0496118_0050394 3300048921 Bacteria 3196
410 Ga0496119_0000227 3300048922 Bacteria 78848
411 Ga0496120_0077904 3300048923 Bacteria 1803
412 Ga0496122_0000045 3300048925 Bacteria 279912
413 Ga0496122_0000277 3300048925 Bacteria 114200
414 Ga0496122_0000668 3300048925 Bacteria 69054
415 Ga0496122_0000698 3300048925 Bacteria 66677
416 Ga0496122_0004620 3300048925 Bacteria 16941
417 Ga0496122_0006922 3300048925 Bacteria 12808
418 Ga0496123_0000728 3300048926 Bacteria 53516
419 Ga0496123_0011044 3300048926 Bacteria 7885
420 Ga0496123_0012974 3300048926 Bacteria 7041
421 Ga0496124_0015557 3300048927 Bacteria 7285
422 Ga0496125_0001313 3300048928 Bacteria 36792
423 Ga0496125_0022662 3300048928 Bacteria 5826
424 Ga0496125_0069186 3300048928 Bacteria 2772
425 Ga0496125_0158810 3300048928 Bacteria 1539
426 Ga0496126_0002717 3300048929 Bacteria 23390
427 Ga0495678_010545 3300049459 Bacteria 4486
428 Ga0501223_000355 3300049663 Bacteria 11289
429 Ga0501241_017154 3300049758 Bacteria 1323
430 nmdc:mga0k408_2327_c1 3300050493 Bacteria 10111
431 nmdc:mga0k408_23886_c1 3300050493 Bacteria 3453
432 nmdc:mga0k408_28958_c1 3300050493 Bacteria 3150
433 nmdc:mga0k408_51_c1 3300050493 Bacteria 15009
434 Ga0500635_0000678 3300053080 Bacteria 8618
435 Ga0500635_0063854 3300053080 Bacteria 1292
436 Ga0500647_0188926 3300053091 Bacteria 941
437 Ga0500651_0000230 3300053093 Bacteria 34750
438 Ga0500608_005011 3300053122 Bacteria 5204
439 Ga0500608_027037 3300053122 Bacteria 2701
440 Ga0500618_000003 3300053125 Bacteria 338706
441 Ga0500642_0043618 3300053130 Bacteria 1949
442 Ga0500561_0021696 3300053137 Bacteria 1516
443 Ga0500568_0129445 3300053139 Bacteria 939
444 Ga0500622_0020108 3300053156 Bacteria 3545
445 Ga0500624_000167 3300053157 Bacteria 26625
446 Ga0500634_0108836 3300053161 Bacteria 1372
447 2511234601 2511231000 Bacteria 4488346
448 2585144547 2582581278 Bacteria 5296881
449 2585159125 2582581281 Bacteria 4487904
450 2585163413 2582581282 Bacteria 4495830
451 2585425258 2582581873 Bacteria 3032664
452 2586210428 2585427687 Bacteria 5544917
453 2587677208 2585428045 Bacteria 5203023
454 2587749735 2585428060 Bacteria 5304711
455 2587751802 2585428061 Bacteria 3939663
456 2587865770 2585428095 Bacteria 3789702
457 2587943931 2585428115 Bacteria 4420269
458 2588208741 2585428182 Bacteria 5007281
459 2588212549 2585428183 Bacteria 5166119
460 2588220117 2585428184 Bacteria 4978681
461 2588224914 2585428185 Bacteria 4969476
462 2588231808 2585428187 Bacteria 4629388
463 2588445876 2588253712 Bacteria 5403181
464 2590602167 2588254255 Bacteria 5014294
465 2590611469 2588254257 Bacteria 5436094
466 2599478627 2599185184 Bacteria 6430550
467 2722726194 2721755487 Bacteria 6357185
468 2729201885 2728369107 Bacteria 5082720
469 2738698527 2738541273 Bacteria 4048577
470 2738755881 2738541283 Bacteria 7222293
471 2738761459 2738541284 Bacteria 5199923
472 2738854142 2738541302 Bacteria 5944758
473 2739252853 2738543014 Bacteria 4048139
474 2739303030 2738543023 Bacteria 6767879
475 2739587623 2739367651 Bacteria 6359826
476 2739614662 2739367656 Bacteria 5152243
477 2739648071 2739367663 Bacteria 5040914
478 2740057092 2739367874 Bacteria 4872888
479 2753672120 2751185877 Bacteria 4921427
480 2765572121 2765235839 Bacteria 5314748
481 2772603927 2772190705 Bacteria 4666226
482 2776615910 2775506987 Bacteria 5373360
483 2816872332 2816332188 Bacteria 5133218
484 2819545532 2818991437 Bacteria 5805520
485 2842086514 2842083920 Bacteria 4857652
486 2842724589 2842722452 Bacteria 6263924
487 2842907169 2842903701 Bacteria 6986368
488 2842911917 2842909656 Bacteria 6185908
489 2849283556 2849281842 Bacteria 6065644
490 2852623535 2852623160 Bacteria 4376875
491 2852628112 2852627209 Bacteria 5896285
492 2857630506 2857627736 Bacteria 5625397
493 2871722949 2871720351 Bacteria 4862476
494 2884635193 2884634485 Bacteria 3928637
495 2884937563 2884933994 Bacteria 4535041
496 2889292407 2889290771 Bacteria 5530962
497 2890740620 2890737413 Bacteria 4269751
498 2895503062 2895498888 Bacteria 5283788
499 2896320820 2896317667 Bacteria 4606601
500 2896346887 2896344016 Bacteria 3811746
501 2898716228 2898713307 Bacteria 4110805
502 2904448026 2904445276 Bacteria 5310396
503 2904782805 2904780799 Bacteria 5840761
504 2906000615 2905999023 Bacteria 4591259
505 2911142604 2911138879 Bacteria 5811561
506 2919180416 2919177583 Bacteria 5641607
507 2919188476 2919186247 Bacteria 6244071
508 2919400615 2919399522 Bacteria 5164947
509 2919441319 2919437846 Bacteria 6199444
510 2919693350 2919692658 Bacteria 5943958
511 2928080315 2928078545 Bacteria 6534839
512 2928149510 2928147474 Bacteria 6512076
513 2932083341 2932082852 Bacteria 6563563
514 2939667439 2939664404 Bacteria 6364494
515 2945927616 2945924605 Bacteria 4296724
516 2945998553 2945997725 Bacteria 6404843
517 2954021019 2954016120 Bacteria 6446024
518 2977232891 2977232053 Bacteria 5485925
519 2977246615 2977243572 Bacteria 4374394
520 2984575559 2984572630 Bacteria 4186940
521 2984609012 2984606641 Bacteria 4186971
522 2993373947 2993372514 Bacteria 4214139
523 2993480848 2993480792 Bacteria 4022225
524 Ga0495606_0084976
525 SwRhRL2b_contig_1316395
526 SwRhRL2b_contig_999397
527 JGI24739J22299_10012505
528 JGI24737J22298_10002537
529 JGI24735J21928_10000002
530 JGI25162J39368_1000024
531 JGI25162J39368_1001318
532 JGI25164J39214_1000855
533 JGI25152J39213_1000007
534 JGI25150J39212_1000013
535 JGI25151J46595_10000004
536 JGI25165J46597_1001051
537 JGI25153J46596_10000004
538 rootH1_10034282
539 rootH2_10005719
540 rootH2_10034253
541 rootH2_10199718
542 rootL2_10188325
543 rootH1_10002666
544 rootH1_10062121
545 rootH1_10164695
546 Ga0055536_1000010
547 Ga0055530_10002214
548 Ga0058863_11862405
549 Ga0065714_10003996
550 Ga0065714_10008508
551 Ga0065714_10019517
552 Ga0065714_10064770
553 Ga0065714_10078396
554 Ga0065714_10091473
555 Ga0065704_10070374
556 Ga0065704_10073279
557 Ga0065704_10074546
558 Ga0065704_10074685
559 Ga0065704_10075281
560 Ga0070658_10000011
561 Ga0070658_10310988
562 Ga0070676_10000277
563 Ga0070683_100003504
564 Ga0070680_100010203
565 Ga0068868_100005721
566 Ga0068868_100046851
567 Ga0070660_100279327
568 Ga0070668_100281915
569 Ga0070673_100003782
570 Ga0070659_100000449
571 Ga0070659_100002083
572 Ga0070659_100096749
573 Ga0070663_100033364
574 Ga0070678_100006236
575 Ga0070662_100000032
576 Ga0068867_100009759
577 Ga0070679_100071406
578 Ga0070684_100026406
579 Ga0070684_100140169
580 Ga0068853_100008727
581 Ga0070665_100000003
582 Ga0070665_100005248
583 Ga0068855_100000508
584 Ga0068855_100010454
585 Ga0068855_100183762
586 Ga0068855_100515878
587 Ga0068857_100072451
588 Ga0068854_100082162
589 Ga0068856_100001512
590 Ga0068856_100035627
591 Ga0068856_100401438
592 Ga0068852_100002452
593 Ga0068858_100016470
594 Ga0075366_10000804
595 Ga0075366_10001072
596 Ga0075366_10026341
597 Ga0097621_100000165
598 Ga0068871_100000018
599 Ga0068865_100000396
600 Ga0105244_10000011
601 Ga0105244_10015993
602 Ga0105240_10000237
603 Ga0105240_10022011
604 Ga0105240_10029393
605 Ga0105240_10080973
606 Ga0105240_10105597
607 Ga0105240_10193574
608 Ga0105240_10322811
609 Ga0105240_10612145
610 Ga0105245_10332035
611 Ga0105243_10000009
612 Ga0105243_10000145
613 Ga0105243_10132757
614 Ga0105241_10003076
615 Ga0105241_10007004
616 Ga0105241_10021319
617 Ga0105241_10535386
618 Ga0105242_10005497
619 Ga0105237_10000224
620 Ga0105237_10000952
621 Ga0105237_10000963
622 Ga0105237_10001604
623 Ga0105237_10001948
624 Ga0105237_10057582
625 Ga0105237_10089685
626 Ga0105237_10140955
627 Ga0105237_10381019
628 Ga0105238_10054337
629 Ga0105238_10121567
630 Ga0105249_10021227
631 Ga0105239_10000002
632 Ga0105239_10000013
633 Ga0105239_10001207
634 Ga0105239_10004436
635 Ga0105239_10006888
636 Ga0105239_10014078
637 Ga0105239_10016396
638 Ga0105239_10122009
639 Ga0105239_10139806
640 Ga0157373_10000005
641 Ga0157373_10000256
642 Ga0157373_10000936
643 Ga0157373_10001025
644 Ga0157373_10001318
645 Ga0157373_10016309
646 Ga0157373_10025856
647 Ga0157373_10087000
648 Ga0157371_10000046
649 Ga0157371_10000079
650 Ga0157371_10000216
651 Ga0157371_10002552
652 Ga0157371_10017592
653 Ga0157371_10017639
654 Ga0157371_10022991
655 Ga0157371_10061989
656 Ga0157371_10116522
657 Ga0157370_10001014
658 Ga0157370_10002361
659 Ga0157370_10014349
660 Ga0157370_10020909
661 Ga0157370_10021398
662 Ga0157370_10030370
663 Ga0157370_10052066
664 Ga0157370_10204819
665 Ga0157370_10224061
666 Ga0157370_10239703
667 Ga0157369_10000046
668 Ga0157369_10002118
669 Ga0157369_10002502
670 Ga0157369_10051465
671 Ga0157369_10070760
672 Ga0157374_10000348
673 Ga0157374_10010541
674 Ga0157374_10084201
675 Ga0163162_10000031
676 Ga0163162_10000037
677 Ga0163162_10006339
678 Ga0163162_10009851
679 Ga0157372_10000001
680 Ga0157372_10000196
681 Ga0157372_10023256
682 Ga0157372_10032550
683 Ga0157372_10084127
684 Ga0157372_10348795
685 Ga0157375_10000722
686 Ga0157375_10012838
687 Ga0157375_10017987
688 Ga0157375_10204731
689 Ga0182008_10000025
690 Ga0182008_10000037
691 Ga0182008_10000058
692 Ga0182008_10000208
693 Ga0182006_1000039
694 Ga0182006_1000333
695 Ga0182006_1000576
696 Ga0182006_1002025
697 Ga0182006_1003058
698 Ga0182006_1003255
699 Ga0182007_10000009
700 Ga0183373_1008
701 Ga0163161_10000343
702 Ga0163161_10000628
703 Ga0163161_10001101
704 Ga0163161_10002195
705 Ga0163161_10005715
706 Ga0163161_10062075
707 Ga0206351_10804740
708 Ga0207427_100103
709 Ga0209437_100017
710 Ga0209437_100101
711 Ga0207425_1000008
712 Ga0209026_1001716
713 Ga0209026_1002049
714 Ga0209026_1009429
715 Ga0209129_1000042
716 Ga0209233_1000124
717 Ga0209233_1012541
718 Ga0209233_1028619
719 Ga0209455_1004555
720 Ga0209675_1000935
721 Ga0209676_1000009
722 Ga0209025_1000020
723 Ga0209758_1000022
724 Ga0209050_1000103
725 Ga0207655_1000242
726 Ga0207647_10000104
727 Ga0207647_10016843
728 Ga0207647_10028212
729 Ga0207645_10000650
730 Ga0207705_10000015
731 Ga0207654_10007717
732 Ga0207654_10040210
733 Ga0207654_10108830
734 Ga0207654_10262008
735 Ga0207695_10000013
736 Ga0207695_10005995
737 Ga0207695_10012058
738 Ga0207695_10063612
739 Ga0207695_10185392
740 Ga0207695_10279223
741 Ga0207671_10000257
742 Ga0207671_10001649
743 Ga0207671_10002707
744 Ga0207671_10005976
745 Ga0207671_10010699
746 Ga0207671_10011508
747 Ga0207671_10015114
748 Ga0207671_10027878
749 Ga0207671_10050884
750 Ga0207657_10115063
751 Ga0207652_10127751
752 Ga0207652_10230376
753 Ga0207694_10030177
754 Ga0207687_10306053
755 Ga0207644_10004079
756 Ga0207690_10003150
757 Ga0207690_10038065
758 Ga0207706_10000191
759 Ga0207709_10000026
760 Ga0207709_10000365
761 Ga0207669_10074946
762 Ga0207704_10000053
763 Ga0207661_10011433
764 Ga0207667_10009017
765 Ga0207667_10066475
766 Ga0207667_10085157
767 Ga0207667_10219017
768 Ga0207667_10438960
769 Ga0207651_10063426
770 Ga0207668_10218805
771 Ga0207640_10175836
772 Ga0207677_10005788
773 Ga0207703_10255426
774 Ga0207639_10006469
775 Ga0207678_10051050
776 Ga0207702_10018455
777 Ga0207648_10000175
778 Ga0207674_10470008
779 Ga0207683_10019929
780 Ga0207698_10004722
781 Ga0268266_10000018
782 Ga0268266_10005285
783 Ga0307517_10002197
784 Ga0307515_10000927
785 Ga0307515_10001771
786 Ga0316177_1066667
787 Ga0316181_1280954
788 Ga0265327_10015148
789 Ga0265316_10126691
790 Ga0307408_100000534
791 Ga0307408_100000564
792 Ga0307408_100000881
793 Ga0307408_100006316
794 Ga0307405_10000016
795 Ga0307407_10000006
796 Ga0307412_10000001
797 Ga0307412_10000034
798 Ga0307412_10000154
799 Ga0307412_10003359
800 Ga0307412_10235421
801 Ga0307409_100093935
802 Ga0307416_100000030
803 Ga0307416_100000032
804 Ga0307416_100282595
805 Ga0307414_10000127
806 Ga0307414_10000392
807 Ga0307414_10001064
808 Ga0307414_10001471
809 Ga0307414_10003449
810 Ga0307414_10012506
811 Ga0307414_10015489
812 Ga0307414_10017742
813 Ga0307414_10088776
814 Ga0307414_10134861
815 Ga0307414_10159976
816 Ga0307414_10199158
817 Ga0307411_10122547
818 Ga0307507_10000064
819 Ga0307510_10000328
820 Ga0395899_0000033
821 Ga0395899_0000435
822 Ga0395899_0001077
823 Ga0395899_0047826
824 Ga0395900_0001393
825 Ga0395900_0003225
826 Ga0395900_0259867
827 Ga0395898_0013831
828 Ga0395905_0001914
829 Ga0395905_0002241
830 Ga0395901_0008879
831 Ga0395901_0017854
832 Ga0395901_0030985
833 Ga0436361_0307685
834 Ga0439445_0000024
835 Ga0439448_0001740
836 Ga0451577_0000042
837 Ga0451577_0000418
838 Ga0451577_0008464
839 Ga0451577_0043525
840 Ga0451577_0084405
841 Ga0451577_0087277
842 Ga0453683_0000572
843 Ga0466966_0056842
844 Ga0466961_0032510
845 Ga0453684_0000148
846 Ga0453684_0000452
847 Ga0453684_0001009
848 Ga0453684_0004934
849 Ga0453684_0007816
850 Ga0453684_0008001
851 Ga0453684_0016398
852 Ga0453684_0079435
853 Ga0453684_0665676
854 Ga0466968_0052929
855 Ga0466959_0088026
856 Ga0451576_0000002
857 Ga0451576_0000254
858 Ga0451576_0011828
859 Ga0451576_0035219
860 Ga0451576_0038684
861 Ga0451576_0091554
862 Ga0451576_0288735
863 Ga0495627_000034
864 Ga0495627_006712
865 Ga0495627_023933
866 Ga0495638_0047843
867 Ga0495638_0128224
868 Ga0495651_0213311
869 Ga0495650_0000003
870 Ga0495650_0019343
871 Ga0495585_0000079
872 Ga0495585_0000411
873 Ga0495596_0000865
874 Ga0495596_0038961
875 Ga0495583_0072268
876 Ga0495606_0000116
877 Ga0495606_0020880
878 Ga0495606_0026181
879 Ga0495606_0041663
880 Ga0495606_0066123
881 Ga0495610_0000001
882 Ga0495610_0000992
883 Ga0495610_0001007
884 Ga0495610_0004188
885 Ga0495616_0008226
886 Ga0495616_0027711
887 Ga0495631_0058444
888 Ga0495632_0025163
889 Ga0495637_0003326
890 Ga0495643_0032463
891 Ga0495648_0002877
892 Ga0495663_0000406
893 Ga0495652_0190061
894 Ga0495654_0000001
895 Ga0495654_0063488
896 Ga0495609_0000025
897 Ga0495609_0063658
898 Ga0495622_0068843
899 Ga0495633_0000056
900 Ga0495633_0000057
901 Ga0495633_0005100
902 Ga0495633_0012731
903 Ga0495668_0000021
904 Ga0495625_0000159
905 Ga0495625_0001186
906 Ga0495625_0002144
907 Ga0495625_0058408
908 Ga0495625_0071364
909 Ga0495625_0111164
910 Ga0495625_0203190
911 Ga0495661_0001360
912 Ga0495661_0009673
913 Ga0495661_0100778
914 Ga0495661_0191047
915 Ga0495658_0028903
916 Ga0495671_0031940
917 Ga0495649_0000003
918 Ga0495600_0026176
919 Ga0495660_0006068
920 Ga0495687_002367
921 Ga0495686_0000160
922 Ga0495686_0000489
923 Ga0495686_0001122
924 Ga0495686_0002126
925 Ga0495686_0097503
926 Ga0496102_0091250
927 Ga0496116_0000266
928 Ga0496116_0005535
929 Ga0496117_0000365
930 Ga0496117_0001863
931 Ga0496118_0000672
932 Ga0496118_0050394
933 Ga0496119_0000227
934 Ga0496120_0077904
935 Ga0496122_0000045
936 Ga0496122_0000277
937 Ga0496122_0000668
938 Ga0496122_0000698
939 Ga0496122_0004620
940 Ga0496122_0006922
941 Ga0496123_0000728
942 Ga0496123_0011044
943 Ga0496123_0012974
944 Ga0496124_0015557
945 Ga0496125_0001313
946 Ga0496125_0022662
947 Ga0496125_0069186
948 Ga0496125_0158810
949 Ga0496126_0002717
950 Ga0495678_010545
951 Ga0501223_000355
952 Ga0501241_017154
953 nmdc:mga0k408_2327_c1
954 nmdc:mga0k408_23886_c1
955 nmdc:mga0k408_28958_c1
956 nmdc:mga0k408_51_c1
957 Ga0500635_0000678
958 Ga0500635_0063854
959 Ga0500647_0188926
960 Ga0500651_0000230
961 Ga0500608_005011
962 Ga0500608_027037
963 Ga0500618_000003
964 Ga0500642_0043618
965 Ga0500561_0021696
966 Ga0500568_0129445
967 Ga0500622_0020108
968 Ga0500624_000167
969 Ga0500634_0108836
970 2511234601
971 2585144547
972 2585159125
973 2585163413
974 2585425258
975 2586210428
976 2587677208
977 2587749735
978 2587751802
979 2587865770
980 2587943931
981 2588208741
982 2588212549
983 2588220117
984 2588224914
985 2588231808
986 2588445876
987 2590602167
988 2590611469
989 2599478627
990 2722726194
991 2729201885
992 2738698527
993 2738755881
994 2738761459
995 2738854142
996 2739252853
997 2739303030
998 2739587623
999 2739614662
1000 2739648071
1001 2740057092
1002 2753672120
1003 2765572121
1004 2772603927
1005 2776615910
1006 2816872332
1007 2819545532
1008 2842086514
1009 2842724589
1010 2842907169
1011 2842911917
1012 2849283556
1013 2852623535
1014 2852628112
1015 2857630506
1016 2871722949
1017 2884635193
1018 2884937563
1019 2889292407
1020 2890740620
1021 2895503062
1022 2896320820
1023 2896346887
1024 2898716228
1025 2904448026
1026 2904782805
1027 2906000615
1028 2911142604
1029 2919180416
1030 2919188476
1031 2919400615
1032 2919441319
1033 2919693350
1034 2928080315
1035 2928149510
1036 2932083341
1037 2939667439
1038 2945927616
1039 2945998553
1040 2954021019
1041 2977232891
1042 2977246615
1043 2984575559
1044 2984609012
1045 2993373947
1046 2993480848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00185

OTCace

Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain

226

357

0.9

PF02729

OTCace_N

Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain

42

200

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fg6-assembly1.cif.gz_X n-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline 0.9642 1 318
2g7m-assembly2.cif.gz_E crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline 0.964 1 320
1js1-assembly1.cif.gz_Z crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution 0.9502 1 318
2fg6-assembly1.cif.gz_X n-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with sulfate and n-succinyl-l-norvaline 0.9495 1 318
1js1-assembly1.cif.gz_Z crystal structure of a new transcarbamylase from the anaerobic bacterium bacteroides fragilis at 2.0 a resolution 0.9415 1 318
ID Description Score Start End Superfamily
2fg6C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.95 151 302 3.40.50.1370
2fg6C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9316 151 302 3.40.50.1370
1js1Z01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9178 1 147 3.40.50.1370
3kzcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.8337 1 159 3.40.50.1370
3grfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.8334 2 158 3.40.50.1370
ID Description Score Start End GO Terms
AF-A0A519Z7M0-F1-model_v4 Acetylornithine carbamoyltransferase 0.9903 148 320 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A3N5R374-F1-model_v4 Acetylornithine carbamoyltransferase 0.9892 97 320 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A519XSZ0-F1-model_v4 Acetylornithine carbamoyltransferase 0.9887 223 318 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A3M1IZX5-F1-model_v4 Acetylornithine carbamoyltransferase 0.9839 158 317 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A4Q5R0A7-F1-model_v4 Acetylornithine carbamoyltransferase 0.9813 166 316 GO:0004585
GO:0016597
GO:0019240
GO:0042450

Map