F459054

General Info

Members Datasets Scaffolds Average Seq Length
523 403 1046 351

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0031107|Ga0501033_0031107_1682_2860
Length 392
Sequence MSQQPALPPGRSTAYFRNPTHQRVTHDGEMDMTAKAIRTTNGRGRLFDSVLDTIGDTPAIRVNHIGIDGVTMYVKAEYFNPASSVKDRLAIGIIEEAERSGALKPGQTVVEATSGNTGIGLAMVCAQKGYPLVVTMADSFSIERRRLMRMLGAKVVLTPRAEKGFGMYRKAVELAEKHGWFLAHQFEAAANAAIHEATTGREIINDFAGGRLDYFVTGYGTGGTMVGVSRVLRKERPETKIILSEPANAQLIGSGTPQQRTADGEPAAGHPAFEPHPIQGWTPDFIPKVLQEAIDKQYYDELIPIAGPKAIEWAKALAQREGIFTGISGGATFGVARQIAEKASAGSVILCMLPDTGERYLSTPLFDAIPADMDDAEVALSRSTPGYQMPAG

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
241 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
242 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
243 2512875024
244 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
245 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
246 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
247 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
248 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
249 2643221557 Ensifer sp. Root558 Isolate Unclassified
250 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
251 2643221610 Ensifer sp. Root74 Isolate Unclassified
252 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
253 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
254 2643221668 Ensifer sp. Root423 Isolate Unclassified
255 2643221675 Ensifer sp. Root1298 Isolate Unclassified
256 2643221680 Ensifer sp. Root1312 Isolate Unclassified
257 2643221726 Ensifer sp. Root954 Isolate Unclassified
258 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
259 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
260 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
261 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
262 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
263 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
264 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
265 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
266 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
267 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
268 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
269 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
270 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
271 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
272 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
273 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
274 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
275 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
276 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
277 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
278 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
279 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
280 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
281 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
282 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
283 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
284 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
285 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
286 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
287 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
288 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
289 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
290 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
291 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
292 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
293 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
294 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
295 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
296 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
297 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
298 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
299 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
300 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
301 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
302 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
303 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
304 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
305 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
306 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
307 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
308 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
309 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
310 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
311 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
312 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
313 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
314 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
315 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
316 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
317 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
318 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
319 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
320 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
321 2909042592 Labrys sp. LIt4 Isolate Nodule
322 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
323 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
324 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
325 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
326 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
327 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
328 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
329 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
330 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
331 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
332 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
333 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
334 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
335 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
336 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
337 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
338 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
339 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
340 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
341 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
342 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
343 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
344 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
345 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
346 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
347 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
348 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
349 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
350 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
351 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
352 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
353 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
354 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
355 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
356 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
357 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
358 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
359 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
360 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
361 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
362 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
363 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
364 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
365 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
366 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
367 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
368 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
369 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
370 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
371 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
372 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
373 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
374 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
375 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
376 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
377 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
378 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
379 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
380 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
381 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
382 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
383 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
384 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
385 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
386 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
387 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
388 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
389 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
390 3004167301 Mesorhizobium loti 582 Isolate Unclassified
391 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
392 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
393 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
394 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
395 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
396 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
397 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
398 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
399 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
400 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
401 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
402 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
403 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.07
Metatranscriptomes 0.19
Isolates 31.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 26.2
Rhizoplane 1.91
Rhizosphere 60.23
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0031107 3300049570 Bacteria 4013
2 JGI24741J21665_1000320 3300001915 Bacteria 14354
3 JGI24740J21852_10006522 3300001979 Bacteria 4822
4 JGI24740J21852_10011038 3300001979 Bacteria 3454
5 JGI24739J22299_10008028 3300001989 Unclassified 3946
6 JGI24737J22298_10005828 3300001990 Bacteria 4243
7 JGI24737J22298_10016764 3300001990 Bacteria 2364
8 JGI24735J21928_10003322 3300002067 Bacteria 5487
9 JGI24735J21928_10008208 3300002067 Bacteria 3386
10 JGI24744J21845_10000310 3300002077 Bacteria 8186
11 JGI25157J39369_1000368 3300002741 Bacteria 30978
12 JGI25165J46597_1000006 3300003214 Bacteria 529784
13 rootH1_10136782 3300003323 Bacteria 2847
14 Ga0055526_1000113 3300003771 Bacteria 71581
15 Ga0055526_1000189 3300003771 Bacteria 53387
16 Ga0055524_1000630 3300003775 Bacteria 25107
17 Ga0065715_10146266 3300005293 Bacteria 1773
18 Ga0070658_10026373 3300005327 Bacteria 4661
19 Ga0070658_10026524 3300005327 Bacteria 4648
20 Ga0070658_10033177 3300005327 Unclassified 4153
21 Ga0070676_10078399 3300005328 Bacteria 1998
22 Ga0070683_100017991 3300005329 Bacteria 6250
23 Ga0070683_100020324 3300005329 Bacteria 5909
24 Ga0070683_100022712 3300005329 Bacteria 5610
25 Ga0070680_100004400 3300005336 Bacteria 10603
26 Ga0070680_100148973 3300005336 Bacteria 1964
27 Ga0070682_100022989 3300005337 Bacteria 3699
28 Ga0070691_10002731 3300005341 Bacteria 7858
29 Ga0070687_100028291 3300005343 Bacteria 2717
30 Ga0070661_100035064 3300005344 Bacteria 3642
31 Ga0070661_100047836 3300005344 Bacteria 3130
32 Ga0070692_10004755 3300005345 Bacteria 5703
33 Ga0070668_100038811 3300005347 Bacteria 3642
34 Ga0070668_100070254 3300005347 Bacteria 2725
35 Ga0070675_100029345 3300005354 Bacteria 4435
36 Ga0070675_100069511 3300005354 Bacteria 2917
37 Ga0070671_100064814 3300005355 Bacteria 3043
38 Ga0070674_100003067 3300005356 Bacteria 9298
39 Ga0070674_100101438 3300005356 Bacteria 2098
40 Ga0070674_100109662 3300005356 Bacteria 2024
41 Ga0070659_100018390 3300005366 Bacteria 5274
42 Ga0070659_100147797 3300005366 Bacteria 1915
43 Ga0070709_10282855 3300005434 Bacteria 1206
44 Ga0070714_100014160 3300005435 Bacteria 6404
45 Ga0070713_100008452 3300005436 Bacteria 7301
46 Ga0070713_100044672 3300005436 Bacteria 3627
47 Ga0070711_100006916 3300005439 Bacteria 6877
48 Ga0070700_100257549 3300005441 Bacteria 1255
49 Ga0070708_100063709 3300005445 Bacteria 3301
50 Ga0070708_100112942 3300005445 Bacteria 2498
51 Ga0070663_100002557 3300005455 Bacteria 10272
52 Ga0070663_100045666 3300005455 Bacteria 3096
53 Ga0070678_100005197 3300005456 Bacteria 7487
54 Ga0070678_100009821 3300005456 Bacteria 5817
55 Ga0070678_100036058 3300005456 Bacteria 3458
56 Ga0070662_100033293 3300005457 Bacteria 3627
57 Ga0068867_100010633 3300005459 Bacteria 6492
58 Ga0068867_100021809 3300005459 Bacteria 4573
59 Ga0070706_100002200 3300005467 Bacteria 19848
60 Ga0070706_100012306 3300005467 Bacteria 7929
61 Ga0070698_100000016 3300005471 Bacteria 110961
62 Ga0070698_100150639 3300005471 Bacteria 2274
63 Ga0070679_100199240 3300005530 Bacteria 1969
64 Ga0070679_100224503 3300005530 Bacteria 1839
65 Ga0070684_100007464 3300005535 Bacteria 8503
66 Ga0070684_100050104 3300005535 Bacteria 3626
67 Ga0070697_100003509 3300005536 Bacteria 12047
68 Ga0068853_100006807 3300005539 Bacteria 9114
69 Ga0068853_100050190 3300005539 Bacteria 3589
70 Ga0068853_100090743 3300005539 Bacteria 2686
71 Ga0070672_100131391 3300005543 Bacteria 2058
72 Ga0070672_100240507 3300005543 Bacteria 1522
73 Ga0070672_100387928 3300005543 Bacteria 1196
74 Ga0070665_100131593 3300005548 Bacteria 2504
75 Ga0070665_100297380 3300005548 Bacteria 1617
76 Ga0070665_100558018 3300005548 Bacteria 1157
77 Ga0068855_100111933 3300005563 Bacteria 3133
78 Ga0068855_100281472 3300005563 Bacteria 1847
79 Ga0070664_100009414 3300005564 Bacteria 7921
80 Ga0070664_100013597 3300005564 Bacteria 6631
81 Ga0070664_100015774 3300005564 Bacteria 6183
82 Ga0068857_100008187 3300005577 Bacteria 9033
83 Ga0068854_100003391 3300005578 Bacteria 9927
84 Ga0068854_100031845 3300005578 Bacteria 3666
85 Ga0068854_100053476 3300005578 Bacteria 2900
86 Ga0068856_100018038 3300005614 Bacteria 6844
87 Ga0068856_100026868 3300005614 Bacteria 5613
88 Ga0068856_100032198 3300005614 Bacteria 5133
89 Ga0068856_100202448 3300005614 Bacteria 2000
90 Ga0068856_100274135 3300005614 Bacteria 1703
91 Ga0068852_100034797 3300005616 Bacteria 4195
92 Ga0068852_100070841 3300005616 Bacteria 3059
93 Ga0068864_100125267 3300005618 Bacteria 2301
94 Ga0068864_100185552 3300005618 Bacteria 1904
95 Ga0068862_100075569 3300005844 Bacteria 2914
96 Ga0081455_10006643 3300005937 Bacteria 12367
97 Ga0070717_10019493 3300006028 Bacteria 5319
98 Ga0075365_10001409 3300006038 Bacteria 10858
99 Ga0075363_100042064 3300006048 Bacteria 2412
100 Ga0075364_10057027 3300006051 Bacteria 2558
101 Ga0070716_100030931 3300006173 Bacteria 2909
102 Ga0070716_100214240 3300006173 Bacteria 1289
103 Ga0070712_100132280 3300006175 Bacteria 1892
104 Ga0075367_10018485 3300006178 Bacteria 3847
105 Ga0075433_10002453 3300006852 Bacteria 14107
106 Ga0075434_100001214 3300006871 Bacteria 21400
107 Ga0075435_100004449 3300007076 Bacteria 9631
108 Ga0075435_100100671 3300007076 Bacteria 2394
109 Ga0105240_10032039 3300009093 Bacteria 6807
110 Ga0111539_10232358 3300009094 Bacteria 2147
111 Ga0105245_10154361 3300009098 Bacteria 2173
112 Ga0114129_10005205 3300009147 Bacteria 18325
113 Ga0105241_10360341 3300009174 Bacteria 1265
114 Ga0105248_10001194 3300009177 Bacteria 29026
115 Ga0105248_10020072 3300009177 Bacteria 7402
116 Ga0105237_10059551 3300009545 Bacteria 3820
117 Ga0105237_10343998 3300009545 Bacteria 1496
118 Ga0105238_10002480 3300009551 Bacteria 18475
119 Ga0105238_10016863 3300009551 Bacteria 7408
120 Ga0105238_10315965 3300009551 Bacteria 1547
121 Ga0105239_10059103 3300010375 Bacteria 4208
122 Ga0105239_10324972 3300010375 Bacteria 1735
123 Ga0105239_10456609 3300010375 Bacteria 1450
124 Ga0157373_10012137 3300013100 Bacteria 6333
125 Ga0157373_10094583 3300013100 Bacteria 2104
126 Ga0157371_10014961 3300013102 Bacteria 5836
127 Ga0157371_10061031 3300013102 Bacteria 2673
128 Ga0157369_10134895 3300013105 Bacteria 2614
129 Ga0157369_10145795 3300013105 Bacteria 2503
130 Ga0157374_10029808 3300013296 Bacteria 4948
131 Ga0157378_10016193 3300013297 Bacteria 6531
132 Ga0157378_10054530 3300013297 Bacteria 3559
133 Ga0163162_10145457 3300013306 Bacteria 2486
134 Ga0157372_10251572 3300013307 Bacteria 2051
135 Ga0163163_10268199 3300014325 Bacteria 1758
136 Ga0157380_10098485 3300014326 Bacteria 2430
137 Ga0157377_10051383 3300014745 Bacteria 2325
138 Ga0206353_11210551 3300020082 Bacteria 1598
139 Ga0214544_1000029 3300021320 Bacteria 153924
140 Ga0214542_1000092 3300021321 Bacteria 117288
141 Ga0214543_1000045 3300021327 Bacteria 152699
142 Ga0209026_1000089 3300025250 Bacteria 175907
143 Ga0209148_1000738 3300025254 Bacteria 25396
144 Ga0209759_1000040 3300025256 Bacteria 254501
145 Ga0209233_1000010 3300025261 Bacteria 1194329
146 Ga0209455_1000638 3300025272 Bacteria 21512
147 Ga0209564_1000017 3300025295 Bacteria 594063
148 Ga0209256_1000089 3300025299 Bacteria 214426
149 Ga0207697_10006980 3300025315 Bacteria 5064
150 Ga0207682_10007417 3300025893 Bacteria 4369
151 Ga0207688_10066302 3300025901 Bacteria 2041
152 Ga0207647_10004002 3300025904 Bacteria 10991
153 Ga0207647_10008715 3300025904 Bacteria 7246
154 Ga0207647_10114139 3300025904 Bacteria 1596
155 Ga0207699_10009626 3300025906 Bacteria 4821
156 Ga0207643_10044734 3300025908 Bacteria 2500
157 Ga0207705_10004960 3300025909 Bacteria 9993
158 Ga0207684_10002191 3300025910 Bacteria 19974
159 Ga0207684_10071088 3300025910 Bacteria 2957
160 Ga0207707_10004841 3300025912 Bacteria 11810
161 Ga0207695_10005231 3300025913 Bacteria 17342
162 Ga0207671_10027555 3300025914 Bacteria 4248
163 Ga0207671_10049202 3300025914 Bacteria 3120
164 Ga0207663_10103178 3300025916 Bacteria 1920
165 Ga0207660_10004828 3300025917 Bacteria 8774
166 Ga0207657_10004234 3300025919 Bacteria 15204
167 Ga0207657_10020620 3300025919 Bacteria 6223
168 Ga0207649_10002339 3300025920 Bacteria 10625
169 Ga0207649_10010209 3300025920 Bacteria 5155
170 Ga0207652_10277675 3300025921 Bacteria 1511
171 Ga0207646_10014653 3300025922 Bacteria 7427
172 Ga0207681_10215022 3300025923 Bacteria 1484
173 Ga0207694_10021922 3300025924 Bacteria 4843
174 Ga0207700_10059882 3300025928 Bacteria 2881
175 Ga0207700_10160897 3300025928 Bacteria 1864
176 Ga0207700_10532531 3300025928 Bacteria 1041
177 Ga0207664_10070122 3300025929 Bacteria 2820
178 Ga0207644_10000548 3300025931 Bacteria 24411
179 Ga0207690_10109734 3300025932 Bacteria 1985
180 Ga0207706_10001668 3300025933 Bacteria 21954
181 Ga0207706_10080112 3300025933 Bacteria 2872
182 Ga0207669_10049928 3300025937 Bacteria 2497
183 Ga0207669_10060594 3300025937 Bacteria 2321
184 Ga0207669_10146624 3300025937 Bacteria 1647
185 Ga0207704_10046708 3300025938 Bacteria 2583
186 Ga0207704_10123067 3300025938 Bacteria 1780
187 Ga0207665_10011677 3300025939 Bacteria 5772
188 Ga0207665_10117369 3300025939 Bacteria 1876
189 Ga0207691_10021446 3300025940 Bacteria 6099
190 Ga0207711_10021479 3300025941 Bacteria 5393
191 Ga0207711_10179664 3300025941 Bacteria 1924
192 Ga0207661_10014566 3300025944 Bacteria 5768
193 Ga0207679_10006438 3300025945 Bacteria 7420
194 Ga0207679_10208254 3300025945 Bacteria 1638
195 Ga0207667_10014964 3300025949 Bacteria 8824
196 Ga0207651_10055165 3300025960 Bacteria 2727
197 Ga0207668_10221458 3300025972 Bacteria 1520
198 Ga0207640_10023335 3300025981 Bacteria 3716
199 Ga0207677_10096486 3300026023 Bacteria 2163
200 Ga0207639_10002939 3300026041 Bacteria 11454
201 Ga0207678_10002277 3300026067 Bacteria 17374
202 Ga0207678_10124888 3300026067 Bacteria 2196
203 Ga0207708_10090495 3300026075 Bacteria 2359
204 Ga0207702_10004166 3300026078 Bacteria 12952
205 Ga0207702_10148038 3300026078 Bacteria 2133
206 Ga0207702_10160253 3300026078 Bacteria 2054
207 Ga0207702_10178994 3300026078 Bacteria 1951
208 Ga0207702_10181559 3300026078 Bacteria 1938
209 Ga0207702_10480755 3300026078 Bacteria 1209
210 Ga0207648_10004785 3300026089 Bacteria 13827
211 Ga0207648_10057515 3300026089 Bacteria 3393
212 Ga0207648_10276737 3300026089 Bacteria 1500
213 Ga0207676_10056327 3300026095 Bacteria 3090
214 Ga0207674_10010013 3300026116 Bacteria 10788
215 Ga0207674_10024513 3300026116 Bacteria 6445
216 Ga0207674_10086038 3300026116 Bacteria 3138
217 Ga0207683_10017813 3300026121 Bacteria 6058
218 Ga0207683_10026890 3300026121 Bacteria 4971
219 Ga0207698_10002323 3300026142 Bacteria 11262
220 Ga0207698_10187509 3300026142 Bacteria 1838
221 Ga0268266_10100215 3300028379 Bacteria 2551
222 Ga0268266_10162151 3300028379 Bacteria 2024
223 Ga0307511_10001052 3300030521 Bacteria 29394
224 Ga0265332_10051868 3300031238 Bacteria 1761
225 Ga0265328_10010998 3300031239 Bacteria 3627
226 Ga0265339_10028172 3300031249 Bacteria 3197
227 Ga0265331_10073399 3300031250 Bacteria 1597
228 Ga0265316_10039325 3300031344 Bacteria 3799
229 Ga0307513_10206985 3300031456 Bacteria 1797
230 Ga0316575_10047370 3300031665 Bacteria 1708
231 Ga0316579_10001843 3300031691 Bacteria 7838
232 Ga0265342_10033437 3300031712 Bacteria 3162
233 Ga0316576_10029361 3300031727 Bacteria 3886
234 Ga0316578_10021357 3300031728 Bacteria 3591
235 Ga0316577_10009894 3300031733 Bacteria 5143
236 Ga0316577_10079278 3300031733 Bacteria 1835
237 Ga0307414_10267489 3300032004 Bacteria 1430
238 Ga0316583_10002501 3300032133 Bacteria 6391
239 Ga0316585_10017024 3300032137 Bacteria 2194
240 Ga0316580_10002035 3300032139 Bacteria 5482
241 Ga0373934_0004494 3300035086 Bacteria 5152
242 Ga0373953_0001644 3300035117 Bacteria 6560
243 Ga0373954_0000313 3300035118 Bacteria 17689
244 Ga0373956_0049320 3300035119 Bacteria 1888
245 Ga0373957_0001531 3300035120 Bacteria 6287
246 Ga0373955_0000495 3300035172 Bacteria 16716
247 Ga0316574_0087246 3300035398 Bacteria 1986
248 Ga0373937_0001044 3300036401 Bacteria 23401
249 Ga0373937_0049624 3300036401 Bacteria 3843
250 Ga0316582_0004006 3300036647 Bacteria 7361
251 Ga0316582_0335636 3300036647 Bacteria 1039
252 Ga0316584_0081555 3300036712 Bacteria 2423
253 Ga0316584_0111148 3300036712 Bacteria 2050
254 Ga0395899_0009434 3300037312 Bacteria 7494
255 Ga0395899_0037434 3300037312 Bacteria 3636
256 Ga0395899_0136997 3300037312 Bacteria 1745
257 Ga0395899_0180672 3300037312 Bacteria 1481
258 Ga0395900_0001861 3300037418 Bacteria 24035
259 Ga0395900_0025630 3300037418 Bacteria 6035
260 Ga0395900_0027782 3300037418 Bacteria 5797
261 Ga0395900_0054936 3300037418 Bacteria 4100
262 Ga0395900_0065929 3300037418 Bacteria 3720
263 Ga0395898_0011471 3300037466 Bacteria 9202
264 Ga0395898_0197112 3300037466 Bacteria 1923
265 Ga0395905_0025930 3300037471 Bacteria 5525
266 Ga0395905_0045007 3300037471 Bacteria 4140
267 Ga0395905_0063571 3300037471 Bacteria 3453
268 Ga0395905_0144871 3300037471 Archaea 2235
269 Ga0316581_0013577 3300037588 Bacteria 2311
270 Ga0436364_0756344 3300037853 Bacteria 5243
271 Ga0436364_1240449 3300037853 Bacteria 4124
272 Ga0395901_0008476 3300038443 Bacteria 10390
273 Ga0395901_0040412 3300038443 Bacteria 4831
274 Ga0395901_0043658 3300038443 Bacteria 4649
275 Ga0395901_0074012 3300038443 Bacteria 3553
276 Ga0395901_0099929 3300038443 Bacteria 3043
277 Ga0439435_0002165 3300042436 Bacteria 3834
278 Ga0466972_0029331 3300044658 Bacteria 2708
279 Ga0466957_0026703 3300044842 Bacteria 3427
280 Ga0466957_0209375 3300044842 Bacteria 1283
281 Ga0466967_0004316 3300045976 Bacteria 9559
282 Ga0466967_0073043 3300045976 Bacteria 3076
283 Ga0495592_0004486 3300046454 Bacteria 10215
284 Ga0495629_0005200 3300046459 Bacteria 9744
285 Ga0495638_0000416 3300046460 Bacteria 51791
286 Ga0495638_0031765 3300046460 Bacteria 3390
287 Ga0495651_0001257 3300046462 Bacteria 19640
288 Ga0495651_0028903 3300046462 Bacteria 4323
289 Ga0495653_0000881 3300046463 Bacteria 23166
290 Ga0495608_0000687 3300046511 Bacteria 23407
291 Ga0495628_0013293 3300046516 Bacteria 6925
292 Ga0495652_0004854 3300046529 Bacteria 12771
293 Ga0495654_0098841 3300046530 Bacteria 1346
294 Ga0495640_0021536 3300046533 Bacteria 4729
295 Ga0495586_0105612 3300046535 Bacteria 1566
296 Ga0495587_0000799 3300046536 Bacteria 20999
297 Ga0495667_0001241 3300046559 Bacteria 16709
298 Ga0495625_0127577 3300046660 Bacteria 1726
299 Ga0495635_0019926 3300046663 Bacteria 4673
300 Ga0495657_0009057 3300046675 Bacteria 7567
301 Ga0495599_0000559 3300046678 Bacteria 21250
302 Ga0495599_0045149 3300046678 Bacteria 2763
303 Ga0495623_0008450 3300046679 Bacteria 6686
304 Ga0495646_0015958 3300046680 Bacteria 4767
305 Ga0495647_0169814 3300046681 Bacteria 944
306 Ga0495600_0000253 3300046809 Bacteria 29204
307 Ga0495604_0001029 3300047317 Bacteria 23248
308 Ga0495674_0239581 3300047319 Bacteria 1495
309 Ga0495680_0001875 3300047322 Bacteria 22125
310 Ga0495675_0000610 3300047444 Bacteria 23039
311 Ga0495675_0054153 3300047444 Bacteria 2547
312 Ga0495684_0001161 3300047471 Bacteria 21170
313 Ga0495593_0030293 3300047673 Bacteria 2962
314 Ga0495602_0009531 3300048088 Bacteria 10091
315 Ga0496102_0073856 3300048905 Bacteria 3134
316 Ga0496102_0168462 3300048905 Bacteria 2062
317 Ga0496102_0266316 3300048905 Bacteria 1616
318 Ga0496106_0272156 3300048909 Bacteria 1356
319 Ga0496107_0105794 3300048910 Bacteria 2066
320 Ga0496109_0381607 3300048912 Bacteria 1331
321 Ga0496110_0292149 3300048913 Bacteria 1485
322 Ga0496114_0302093 3300048917 Bacteria 1413
323 Ga0496118_0172402 3300048921 Bacteria 1320
324 Ga0496120_0001080 3300048923 Bacteria 35851
325 Ga0496120_0008180 3300048923 Bacteria 7666
326 Ga0496125_0120415 3300048928 Bacteria 1874
327 Ga0496125_0181265 3300048928 Bacteria 1403
328 Ga0501032_0104787 3300049569 Bacteria 1874
329 Ga0501034_0001717 3300049571 Bacteria 28196
330 Ga0501038_0070289 3300049574 Bacteria 2973
331 Ga0501068_0019866 3300049584 Bacteria 3907
332 Ga0501072_0181302 3300049588 Bacteria 1680
333 Ga0501073_0085434 3300049589 Bacteria 2195
334 Ga0501080_0085581 3300049742 Bacteria 2929
335 Ga0501080_0148310 3300049742 Bacteria 2169
336 Ga0501083_0031874 3300049744 Bacteria 3616
337 Ga0501044_0207480 3300049823 Bacteria 1915
338 Ga0501044_0272388 3300049823 Bacteria 1628
339 nmdc:mga0yw44_48230_c1 3300050492 Bacteria 2568
340 nmdc:mga0yw44_87865_c1 3300050492 Bacteria 1960
341 nmdc:mga06z11_54661_c1 3300050494 Bacteria 2059
342 nmdc:mga04h51_26638_c1 3300050495 Bacteria 1789
343 nmdc:mga07m45_117713_c1 3300050496 Bacteria 1533
344 nmdc:mga05p37_10892_c1 3300050507 Bacteria 10798
345 nmdc:mga08y16_107112_c1 3300050511 Bacteria 2909
346 nmdc:mga0n895_3048_c1 3300050512 Bacteria 13334
347 nmdc:mga0rr50_12834_c1 3300050513 Bacteria 5430
348 nmdc:mga0rr50_88135_c1 3300050513 Bacteria 2410
349 nmdc:mga0a205_7791_c1 3300050515 Bacteria 9724
350 nmdc:mga0sz30_58864_c1 3300050516 Bacteria 1638
351 Ga0495601_0176451 3300053077 Bacteria 1397
352 Ga0495601_0242604 3300053077 Bacteria 1176
353 Ga0495619_0000685 3300053085 Bacteria 22151
354 Ga0500620_000143 3300053155 Bacteria 14481
355 Ga0500627_0012724 3300053158 Bacteria 3164
356 Ga0500627_0104745 3300053158 Bacteria 1271
357 Ga0500637_0043632 3300053178 Bacteria 2539
358 2509145282 2508501127 Bacteria 7037543
359 2509393671 2509276022 Bacteria 6200534
360 2512933829 2512875016 Bacteria 6529530
361 2512962011 2512875024 Bacteria 7195110
362 2513608486 2513237090 Bacteria 7096802
363 2514038843 2513237164 Bacteria 7563725
364 2588519923 2588253730 Bacteria 6881675
365 2597810813 2597489875 Bacteria 7010078
366 2599936251 2599185301 Bacteria 6161860
367 2643808879 2643221557 Bacteria 7184309
368 2643985840 2643221595 Bacteria 6565519
369 2644064316 2643221610 Bacteria 7480339
370 2644157100 2643221627 Bacteria 6761570
371 2644238179 2643221643 Bacteria 5749658
372 2644376483 2643221668 Bacteria 7306521
373 2644416147 2643221675 Bacteria 7473456
374 2644449188 2643221680 Bacteria 7473610
375 2644691987 2643221726 Bacteria 7455827
376 2694628519 2693429783 Bacteria 7019804
377 2694637568 2693429784 Bacteria 7241525
378 2723574667 2721755686 Bacteria 7343952
379 2765469192 2765235802 Bacteria 5618596
380 2839995986 2839993093 Bacteria 5512535
381 2841736538 2841734538 Bacteria 6784580
382 2847675175 2847670302 Bacteria 6165597
383 2847691351 2847686936 Bacteria 6278406
384 2856315015 2856314179 Bacteria 6477897
385 2856323843 2856320880 Bacteria 7263508
386 2856348091 2856342000 Bacteria 7176905
387 2856363526 2856356410 Bacteria 6297484
388 2856368233 2856364286 Bacteria 6939991
389 2857351576 2857349434 Bacteria 7926032
390 2869166766 2869162929 Bacteria 6399702
391 2869284814 2869278585 Bacteria 7077053
392 2869290148 2869285874 Bacteria 6901219
393 2871432432 2871429161 Bacteria 6547891
394 2871481288 2871474448 Bacteria 6806570
395 2871493054 2871488783 Bacteria 6929816
396 2871502488 2871495908 Bacteria 6935695
397 2874126971 2874123672 Bacteria 7238285
398 2874142866 2874139085 Bacteria 7021506
399 2874152397 2874146452 Bacteria 7533118
400 2874159799 2874155637 Bacteria 6724144
401 2876363915 2876363079 Bacteria 6544991
402 2876393902 2876392853 Bacteria 6660880
403 2876418315 2876413966 Bacteria 6831344
404 2878042258 2878035449 Bacteria 6555736
405 2878741065 2878738818 Bacteria 7136951
406 2878750045 2878745973 Bacteria 6867388
407 2878757100 2878753008 Bacteria 6922523
408 2878766380 2878760144 Bacteria 6823465
409 2878773576 2878767105 Bacteria 6898628
410 2881150174 2881147464 Bacteria 7779814
411 2881161284 2881155292 Bacteria 6461656
412 2881167014 2881161766 Bacteria 7127907
413 2881848811 2881845957 Bacteria 6611900
414 2881858799 2881853255 Bacteria 6698367
415 2881861205 2881861095 Bacteria 7128710
416 2882919289 2882912400 Bacteria 6801539
417 2885308526 2885305155 Bacteria 7348390
418 2885313974 2885312484 Bacteria 6415165
419 2885322166 2885318864 Bacteria 6729568
420 2885331284 2885326080 Bacteria 7134805
421 2885339396 2885334103 Bacteria 7216818
422 2888343328 2888337043 Bacteria 6629336
423 2888344518 2888343758 Bacteria 6611049
424 2888355331 2888350351 Bacteria 7372807
425 2889010310 2889010040 Bacteria 6749192
426 2889018025 2889016732 Bacteria 6700763
427 2903454003 2903448605 Bacteria 7357801
428 2903500826 2903492973 Bacteria 13473544
429 2903505106 2903492973 Bacteria 13473544
430 2903525926 2903521522 Bacteria 6525694
431 2903532528 2903528002 Bacteria 6586099
432 2903547529 2903540706 Bacteria 7062119
433 2904581277 2904578770 Bacteria 5302906
434 2904660233 2904659560 Bacteria 6685615
435 2906312404 2906308376 Bacteria 6841989
436 2906325113 2906321335 Bacteria 6579571
437 2906330462 2906328253 Bacteria 6585166
438 2906355298 2906354277 Bacteria 6991324
439 2906419659 2906414383 Bacteria 6580790
440 2909046055 2909042592 Bacteria 6499737
441 2919122516 2919119836 Bacteria 5208557
442 2919451122 2919450847 Bacteria 5631160
443 2922135765 2922130491 Bacteria 7173936
444 2922163966 2922158528 Bacteria 6573167
445 2922185997 2922185730 Bacteria 7113964
446 2924722214 2924718760 Bacteria 6331356
447 2924729003 2924726620 Bacteria 6271473
448 2924759031 2924754689 Bacteria 6774424
449 2924766233 2924762789 Bacteria 6561353
450 2924778666 2924776078 Bacteria 7492003
451 2924786403 2924784321 Bacteria 7416538
452 2937819453 2937813078 Bacteria 7783518
453 2937825203 2937822353 Bacteria 7290551
454 2937838886 2937836603 Bacteria 6811263
455 2937878435 2937877337 Bacteria 7246526
456 2937897646 2937891427 Bacteria 6357007
457 2937974335 2937972304 Bacteria 7532020
458 2938001404 2937994558 Bacteria 7036190
459 2958041331 2958034702 Bacteria 6989922
460 2958042305 2958041894 Bacteria 13082850
461 2958057906 2958041894 Bacteria 13082850
462 2958072317 2958071322 Bacteria 6815895
463 2958085708 2958084443 Bacteria 7312792
464 2958105914 2958100919 Bacteria 6800575
465 2958116495 2958115193 Bacteria 6923548
466 2958134535 2958130278 Bacteria 6897202
467 2958146683 2958144490 Bacteria 6677056
468 2958171558 2958165035 Bacteria 6906348
469 2958173946 2958172287 Bacteria 6716688
470 2958181016 2958179912 Bacteria 6874908
471 2961078853 2961077736 Bacteria 7079850
472 2961115557 2961114664 Bacteria 6680456
473 2961169999 2961163497 Bacteria 6901077
474 2961175572 2961170736 Bacteria 7072258
475 2963645373 2963644680 Bacteria 6530403
476 2965024750 2965018300 Bacteria 6883036
477 2965063486 2965062239 Bacteria 7412989
478 2967999372 2967996073 Bacteria 6787468
479 2968007784 2968003550 Bacteria 6929263
480 2968019159 2968016561 Bacteria 7022047
481 2968089729 2968083720 Bacteria 7351627
482 2968094992 2968091066 Bacteria 6052692
483 2968102548 2968097103 Bacteria 6107094
484 2968111290 2968110612 Bacteria 6814636
485 2968119560 2968117919 Bacteria 6536078
486 2968130551 2968128360 Bacteria 6270294
487 2968178391 2968171901 Bacteria 6894245
488 2970472523 2970469710 Bacteria 6969209
489 2970508160 2970503327 Bacteria 7099517
490 2970526238 2970524798 Bacteria 6840927
491 2970561236 2970554993 Bacteria 6814252
492 2970599425 2970593180 Bacteria 7073582
493 2977826259 2977821940 Bacteria 6906439
494 2977848192 2977843712 Bacteria 6753583
495 2977869012 2977864932 Bacteria 7534097
496 2977944561 2977942078 Bacteria 7570577
497 2977973331 2977971508 Bacteria 7472917
498 2977992132 2977986579 Bacteria 6581278
499 2979717479 2979710463 Bacteria 6785254
500 2979748059 2979742915 Bacteria 7301278
501 2979784201 2979779861 Bacteria 6219781
502 2979813344 2979808191 Bacteria 7179355
503 2987638760 2987636660 Bacteria 8088555
504 2987658823 2987652177 Bacteria 6969023
505 2987666240 2987659509 Bacteria 6966464
506 2987670842 2987666974 Bacteria 6509233
507 2996343764 2996341866 Bacteria 6643098
508 2996349427 2996348954 Bacteria 7239054
509 3000137437 3000135777 Bacteria 6891109
510 3004173367 3004167301 Bacteria 8330599
511 3004195246 3004188549 Bacteria 6952365
512 3004204997 3004203850 Bacteria 7307914
513 3004276135 3004275668 Bacteria 7114440
514 3004337214 3004334049 Bacteria 8449246
515 637076940 637000159 Bacteria 7596297
516 8004378675 8004374579 Bacteria 6898112
517 8004392353 8004387939 Bacteria 7049250
518 8004399711 8004395343 Bacteria 6620908
519 8004638951 8004633249 Bacteria 6723080
520 8004641200 8004640170 Bacteria 6723001
521 8004705428 8004703790 Bacteria 8006957
522 8004718663 8004714634 Bacteria 6776161
523 8055618095 8055617313 Bacteria 7548464
524 Ga0501033_0031107
525 JGI24741J21665_1000320
526 JGI24740J21852_10006522
527 JGI24740J21852_10011038
528 JGI24739J22299_10008028
529 JGI24737J22298_10005828
530 JGI24737J22298_10016764
531 JGI24735J21928_10003322
532 JGI24735J21928_10008208
533 JGI24744J21845_10000310
534 JGI25157J39369_1000368
535 JGI25165J46597_1000006
536 rootH1_10136782
537 Ga0055526_1000113
538 Ga0055526_1000189
539 Ga0055524_1000630
540 Ga0065715_10146266
541 Ga0070658_10026373
542 Ga0070658_10026524
543 Ga0070658_10033177
544 Ga0070676_10078399
545 Ga0070683_100017991
546 Ga0070683_100020324
547 Ga0070683_100022712
548 Ga0070680_100004400
549 Ga0070680_100148973
550 Ga0070682_100022989
551 Ga0070691_10002731
552 Ga0070687_100028291
553 Ga0070661_100035064
554 Ga0070661_100047836
555 Ga0070692_10004755
556 Ga0070668_100038811
557 Ga0070668_100070254
558 Ga0070675_100029345
559 Ga0070675_100069511
560 Ga0070671_100064814
561 Ga0070674_100003067
562 Ga0070674_100101438
563 Ga0070674_100109662
564 Ga0070659_100018390
565 Ga0070659_100147797
566 Ga0070709_10282855
567 Ga0070714_100014160
568 Ga0070713_100008452
569 Ga0070713_100044672
570 Ga0070711_100006916
571 Ga0070700_100257549
572 Ga0070708_100063709
573 Ga0070708_100112942
574 Ga0070663_100002557
575 Ga0070663_100045666
576 Ga0070678_100005197
577 Ga0070678_100009821
578 Ga0070678_100036058
579 Ga0070662_100033293
580 Ga0068867_100010633
581 Ga0068867_100021809
582 Ga0070706_100002200
583 Ga0070706_100012306
584 Ga0070698_100000016
585 Ga0070698_100150639
586 Ga0070679_100199240
587 Ga0070679_100224503
588 Ga0070684_100007464
589 Ga0070684_100050104
590 Ga0070697_100003509
591 Ga0068853_100006807
592 Ga0068853_100050190
593 Ga0068853_100090743
594 Ga0070672_100131391
595 Ga0070672_100240507
596 Ga0070672_100387928
597 Ga0070665_100131593
598 Ga0070665_100297380
599 Ga0070665_100558018
600 Ga0068855_100111933
601 Ga0068855_100281472
602 Ga0070664_100009414
603 Ga0070664_100013597
604 Ga0070664_100015774
605 Ga0068857_100008187
606 Ga0068854_100003391
607 Ga0068854_100031845
608 Ga0068854_100053476
609 Ga0068856_100018038
610 Ga0068856_100026868
611 Ga0068856_100032198
612 Ga0068856_100202448
613 Ga0068856_100274135
614 Ga0068852_100034797
615 Ga0068852_100070841
616 Ga0068864_100125267
617 Ga0068864_100185552
618 Ga0068862_100075569
619 Ga0081455_10006643
620 Ga0070717_10019493
621 Ga0075365_10001409
622 Ga0075363_100042064
623 Ga0075364_10057027
624 Ga0070716_100030931
625 Ga0070716_100214240
626 Ga0070712_100132280
627 Ga0075367_10018485
628 Ga0075433_10002453
629 Ga0075434_100001214
630 Ga0075435_100004449
631 Ga0075435_100100671
632 Ga0105240_10032039
633 Ga0111539_10232358
634 Ga0105245_10154361
635 Ga0114129_10005205
636 Ga0105241_10360341
637 Ga0105248_10001194
638 Ga0105248_10020072
639 Ga0105237_10059551
640 Ga0105237_10343998
641 Ga0105238_10002480
642 Ga0105238_10016863
643 Ga0105238_10315965
644 Ga0105239_10059103
645 Ga0105239_10324972
646 Ga0105239_10456609
647 Ga0157373_10012137
648 Ga0157373_10094583
649 Ga0157371_10014961
650 Ga0157371_10061031
651 Ga0157369_10134895
652 Ga0157369_10145795
653 Ga0157374_10029808
654 Ga0157378_10016193
655 Ga0157378_10054530
656 Ga0163162_10145457
657 Ga0157372_10251572
658 Ga0163163_10268199
659 Ga0157380_10098485
660 Ga0157377_10051383
661 Ga0206353_11210551
662 Ga0214544_1000029
663 Ga0214542_1000092
664 Ga0214543_1000045
665 Ga0209026_1000089
666 Ga0209148_1000738
667 Ga0209759_1000040
668 Ga0209233_1000010
669 Ga0209455_1000638
670 Ga0209564_1000017
671 Ga0209256_1000089
672 Ga0207697_10006980
673 Ga0207682_10007417
674 Ga0207688_10066302
675 Ga0207647_10004002
676 Ga0207647_10008715
677 Ga0207647_10114139
678 Ga0207699_10009626
679 Ga0207643_10044734
680 Ga0207705_10004960
681 Ga0207684_10002191
682 Ga0207684_10071088
683 Ga0207707_10004841
684 Ga0207695_10005231
685 Ga0207671_10027555
686 Ga0207671_10049202
687 Ga0207663_10103178
688 Ga0207660_10004828
689 Ga0207657_10004234
690 Ga0207657_10020620
691 Ga0207649_10002339
692 Ga0207649_10010209
693 Ga0207652_10277675
694 Ga0207646_10014653
695 Ga0207681_10215022
696 Ga0207694_10021922
697 Ga0207700_10059882
698 Ga0207700_10160897
699 Ga0207700_10532531
700 Ga0207664_10070122
701 Ga0207644_10000548
702 Ga0207690_10109734
703 Ga0207706_10001668
704 Ga0207706_10080112
705 Ga0207669_10049928
706 Ga0207669_10060594
707 Ga0207669_10146624
708 Ga0207704_10046708
709 Ga0207704_10123067
710 Ga0207665_10011677
711 Ga0207665_10117369
712 Ga0207691_10021446
713 Ga0207711_10021479
714 Ga0207711_10179664
715 Ga0207661_10014566
716 Ga0207679_10006438
717 Ga0207679_10208254
718 Ga0207667_10014964
719 Ga0207651_10055165
720 Ga0207668_10221458
721 Ga0207640_10023335
722 Ga0207677_10096486
723 Ga0207639_10002939
724 Ga0207678_10002277
725 Ga0207678_10124888
726 Ga0207708_10090495
727 Ga0207702_10004166
728 Ga0207702_10148038
729 Ga0207702_10160253
730 Ga0207702_10178994
731 Ga0207702_10181559
732 Ga0207702_10480755
733 Ga0207648_10004785
734 Ga0207648_10057515
735 Ga0207648_10276737
736 Ga0207676_10056327
737 Ga0207674_10010013
738 Ga0207674_10024513
739 Ga0207674_10086038
740 Ga0207683_10017813
741 Ga0207683_10026890
742 Ga0207698_10002323
743 Ga0207698_10187509
744 Ga0268266_10100215
745 Ga0268266_10162151
746 Ga0307511_10001052
747 Ga0265332_10051868
748 Ga0265328_10010998
749 Ga0265339_10028172
750 Ga0265331_10073399
751 Ga0265316_10039325
752 Ga0307513_10206985
753 Ga0316575_10047370
754 Ga0316579_10001843
755 Ga0265342_10033437
756 Ga0316576_10029361
757 Ga0316578_10021357
758 Ga0316577_10009894
759 Ga0316577_10079278
760 Ga0307414_10267489
761 Ga0316583_10002501
762 Ga0316585_10017024
763 Ga0316580_10002035
764 Ga0373934_0004494
765 Ga0373953_0001644
766 Ga0373954_0000313
767 Ga0373956_0049320
768 Ga0373957_0001531
769 Ga0373955_0000495
770 Ga0316574_0087246
771 Ga0373937_0001044
772 Ga0373937_0049624
773 Ga0316582_0004006
774 Ga0316582_0335636
775 Ga0316584_0081555
776 Ga0316584_0111148
777 Ga0395899_0009434
778 Ga0395899_0037434
779 Ga0395899_0136997
780 Ga0395899_0180672
781 Ga0395900_0001861
782 Ga0395900_0025630
783 Ga0395900_0027782
784 Ga0395900_0054936
785 Ga0395900_0065929
786 Ga0395898_0011471
787 Ga0395898_0197112
788 Ga0395905_0025930
789 Ga0395905_0045007
790 Ga0395905_0063571
791 Ga0395905_0144871
792 Ga0316581_0013577
793 Ga0436364_0756344
794 Ga0436364_1240449
795 Ga0395901_0008476
796 Ga0395901_0040412
797 Ga0395901_0043658
798 Ga0395901_0074012
799 Ga0395901_0099929
800 Ga0439435_0002165
801 Ga0466972_0029331
802 Ga0466957_0026703
803 Ga0466957_0209375
804 Ga0466967_0004316
805 Ga0466967_0073043
806 Ga0495592_0004486
807 Ga0495629_0005200
808 Ga0495638_0000416
809 Ga0495638_0031765
810 Ga0495651_0001257
811 Ga0495651_0028903
812 Ga0495653_0000881
813 Ga0495608_0000687
814 Ga0495628_0013293
815 Ga0495652_0004854
816 Ga0495654_0098841
817 Ga0495640_0021536
818 Ga0495586_0105612
819 Ga0495587_0000799
820 Ga0495667_0001241
821 Ga0495625_0127577
822 Ga0495635_0019926
823 Ga0495657_0009057
824 Ga0495599_0000559
825 Ga0495599_0045149
826 Ga0495623_0008450
827 Ga0495646_0015958
828 Ga0495647_0169814
829 Ga0495600_0000253
830 Ga0495604_0001029
831 Ga0495674_0239581
832 Ga0495680_0001875
833 Ga0495675_0000610
834 Ga0495675_0054153
835 Ga0495684_0001161
836 Ga0495593_0030293
837 Ga0495602_0009531
838 Ga0496102_0073856
839 Ga0496102_0168462
840 Ga0496102_0266316
841 Ga0496106_0272156
842 Ga0496107_0105794
843 Ga0496109_0381607
844 Ga0496110_0292149
845 Ga0496114_0302093
846 Ga0496118_0172402
847 Ga0496120_0001080
848 Ga0496120_0008180
849 Ga0496125_0120415
850 Ga0496125_0181265
851 Ga0501032_0104787
852 Ga0501034_0001717
853 Ga0501038_0070289
854 Ga0501068_0019866
855 Ga0501072_0181302
856 Ga0501073_0085434
857 Ga0501080_0085581
858 Ga0501080_0148310
859 Ga0501083_0031874
860 Ga0501044_0207480
861 Ga0501044_0272388
862 nmdc:mga0yw44_48230_c1
863 nmdc:mga0yw44_87865_c1
864 nmdc:mga06z11_54661_c1
865 nmdc:mga04h51_26638_c1
866 nmdc:mga07m45_117713_c1
867 nmdc:mga05p37_10892_c1
868 nmdc:mga08y16_107112_c1
869 nmdc:mga0n895_3048_c1
870 nmdc:mga0rr50_12834_c1
871 nmdc:mga0rr50_88135_c1
872 nmdc:mga0a205_7791_c1
873 nmdc:mga0sz30_58864_c1
874 Ga0495601_0176451
875 Ga0495601_0242604
876 Ga0495619_0000685
877 Ga0500620_000143
878 Ga0500627_0012724
879 Ga0500627_0104745
880 Ga0500637_0043632
881 2509145282
882 2509393671
883 2512933829
884 2512962011
885 2513608486
886 2514038843
887 2588519923
888 2597810813
889 2599936251
890 2643808879
891 2643985840
892 2644064316
893 2644157100
894 2644238179
895 2644376483
896 2644416147
897 2644449188
898 2644691987
899 2694628519
900 2694637568
901 2723574667
902 2765469192
903 2839995986
904 2841736538
905 2847675175
906 2847691351
907 2856315015
908 2856323843
909 2856348091
910 2856363526
911 2856368233
912 2857351576
913 2869166766
914 2869284814
915 2869290148
916 2871432432
917 2871481288
918 2871493054
919 2871502488
920 2874126971
921 2874142866
922 2874152397
923 2874159799
924 2876363915
925 2876393902
926 2876418315
927 2878042258
928 2878741065
929 2878750045
930 2878757100
931 2878766380
932 2878773576
933 2881150174
934 2881161284
935 2881167014
936 2881848811
937 2881858799
938 2881861205
939 2882919289
940 2885308526
941 2885313974
942 2885322166
943 2885331284
944 2885339396
945 2888343328
946 2888344518
947 2888355331
948 2889010310
949 2889018025
950 2903454003
951 2903500826
952 2903505106
953 2903525926
954 2903532528
955 2903547529
956 2904581277
957 2904660233
958 2906312404
959 2906325113
960 2906330462
961 2906355298
962 2906419659
963 2909046055
964 2919122516
965 2919451122
966 2922135765
967 2922163966
968 2922185997
969 2924722214
970 2924729003
971 2924759031
972 2924766233
973 2924778666
974 2924786403
975 2937819453
976 2937825203
977 2937838886
978 2937878435
979 2937897646
980 2937974335
981 2938001404
982 2958041331
983 2958042305
984 2958057906
985 2958072317
986 2958085708
987 2958105914
988 2958116495
989 2958134535
990 2958146683
991 2958171558
992 2958173946
993 2958181016
994 2961078853
995 2961115557
996 2961169999
997 2961175572
998 2963645373
999 2965024750
1000 2965063486
1001 2967999372
1002 2968007784
1003 2968019159
1004 2968089729
1005 2968094992
1006 2968102548
1007 2968111290
1008 2968119560
1009 2968130551
1010 2968178391
1011 2970472523
1012 2970508160
1013 2970526238
1014 2970561236
1015 2970599425
1016 2977826259
1017 2977848192
1018 2977869012
1019 2977944561
1020 2977973331
1021 2977992132
1022 2979717479
1023 2979748059
1024 2979784201
1025 2979813344
1026 2987638760
1027 2987658823
1028 2987666240
1029 2987670842
1030 2996343764
1031 2996349427
1032 3000137437
1033 3004173367
1034 3004195246
1035 3004204997
1036 3004276135
1037 3004337214
1038 637076940
1039 8004378675
1040 8004392353
1041 8004399711
1042 8004638951
1043 8004641200
1044 8004705428
1045 8004718663
1046 8055618095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

50

355

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o58-assembly1.cif.gz_A crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9443 20 331
5xeo-assembly1.cif.gz_B crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum 0.9402 16 331
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9382 20 331
5xeo-assembly1.cif.gz_B crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum 0.9372 16 331
3fca-assembly1.cif.gz_A genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe 0.9337 19 331
ID Description Score Start End Superfamily
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9788 58 157 3.40.50.1100
af_A0A1D6JTA1_151_233_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9669 82 129 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.962 57 157 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.96 58 157 3.40.50.1100
af_Q965I8_90_187_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9573 54 152 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7S0JKB7-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9904 71 171 GO:0016020
AF-A0A358MGW6-F1-model_v4 Cysteine synthase 0.987 160 284 GO:0006534
GO:0009069
GO:0044272
AF-A0A524KGS4-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9793 15 309 GO:0004124
GO:0006535
AF-A0A660MEY9-F1-model_v4 cysteine synthase (EC 2.5.1.47) 0.9768 15 177 GO:0006535
GO:0016765
AF-A0A7Y6PL45-F1-model_v4 cysteine synthase (EC 2.5.1.47) 0.9761 15 290 GO:0004124
GO:0006535

Map