F459061

General Info

Members Datasets Scaffolds Average Seq Length
523 274 1046 124

Family's Representative Sequence

Representative Sequence 3300049659|Ga0501214_093722|Ga0501214_093722_74_508
Length 144
Sequence MRPIIAFDANTIIGRASAMPATILIIDDDESIRELLRLHLSAAGYEVRMAEDAIRAGYLVLRSPPDLIVCDVNMPHMDGFEFIAALKADTALPPIPVIFLTSHGGGDERGKELGAVGYLLKPVRADKLLQLVAKHVTGGALPIG

Samples

Sample ID Description Type Environment
1 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
191 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.96
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501214_093722 3300049659 Bacteria 521
2 Ga0065704_10213250 3300005289 Bacteria 1089
3 Ga0065704_10444722 3300005289 Bacteria 711
4 Ga0065707_10247798 3300005295 Bacteria 1135
5 Ga0070676_11109754 3300005328 Archaea 598
6 Ga0070690_100001754 3300005330 Bacteria 11471
7 Ga0070690_100718528 3300005330 Bacteria 769
8 Ga0070690_101400525 3300005330 Unclassified 562
9 Ga0070677_10122329 3300005333 Bacteria 1177
10 Ga0068869_100001435 3300005334 Bacteria 14129
11 Ga0068869_100009438 3300005334 Bacteria 6331
12 Ga0068869_101748048 3300005334 Bacteria 556
13 Ga0070666_10038287 3300005335 Bacteria 3190
14 Ga0070680_100000789 3300005336 Bacteria 22263
15 Ga0070680_100218666 3300005336 Bacteria 1608
16 Ga0068868_100001331 3300005338 Bacteria 17036
17 Ga0068868_101166696 3300005338 Bacteria 711
18 Ga0070689_100000776 3300005340 Bacteria 19580
19 Ga0070689_100305726 3300005340 Bacteria 1325
20 Ga0070689_100351418 3300005340 Bacteria 1237
21 Ga0070691_10011311 3300005341 Bacteria 4073
22 Ga0070691_10041643 3300005341 Bacteria 2172
23 Ga0070687_100000436 3300005343 Bacteria 14119
24 Ga0070687_101001072 3300005343 Bacteria 606
25 Ga0070692_10000910 3300005345 Bacteria 10019
26 Ga0070692_10100935 3300005345 Bacteria 1581
27 Ga0070692_10165293 3300005345 Bacteria 1271
28 Ga0070692_10423216 3300005345 Bacteria 846
29 Ga0070668_100038083 3300005347 Bacteria 3673
30 Ga0070668_100926024 3300005347 Bacteria 780
31 Ga0070668_101218423 3300005347 Unclassified 682
32 Ga0070669_100006558 3300005353 Bacteria 8376
33 Ga0070669_100043117 3300005353 Bacteria 3285
34 Ga0070675_100024891 3300005354 Bacteria 4796
35 Ga0070671_100032920 3300005355 Bacteria 4285
36 Ga0070674_100063364 3300005356 Bacteria 2587
37 Ga0070674_100115346 3300005356 Bacteria 1980
38 Ga0070674_100442819 3300005356 Bacteria 1071
39 Ga0070674_100965287 3300005356 Bacteria 746
40 Ga0070673_100019737 3300005364 Bacteria 4845
41 Ga0070673_100305571 3300005364 Bacteria 1401
42 Ga0070673_100378249 3300005364 Bacteria 1262
43 Ga0070673_100751595 3300005364 Bacteria 898
44 Ga0070688_100079694 3300005365 Bacteria 2116
45 Ga0070688_100723787 3300005365 Archaea 772
46 Ga0070688_100808659 3300005365 Bacteria 734
47 Ga0070659_100999141 3300005366 Unclassified 734
48 Ga0070667_100004944 3300005367 Bacteria 11167
49 Ga0070703_10094130 3300005406 Bacteria 1044
50 Ga0070703_10218312 3300005406 Bacteria 758
51 Ga0070710_10274415 3300005437 Bacteria 1092
52 Ga0070701_10002594 3300005438 Bacteria 7001
53 Ga0070701_10068092 3300005438 Bacteria 1896
54 Ga0070701_10170740 3300005438 Unclassified 1266
55 Ga0070701_10272395 3300005438 Bacteria 1030
56 Ga0070705_100001008 3300005440 Bacteria 15668
57 Ga0070705_100156167 3300005440 Bacteria 1519
58 Ga0070705_100688235 3300005440 Unclassified 802
59 Ga0070700_100000666 3300005441 Bacteria 16998
60 Ga0070700_100013963 3300005441 Bacteria 4526
61 Ga0070700_100158498 3300005441 Bacteria 1555
62 Ga0070700_100972761 3300005441 Archaea 696
63 Ga0070700_102001026 3300005441 Bacteria 503
64 Ga0070694_100001273 3300005444 Bacteria 14642
65 Ga0070694_100018906 3300005444 Bacteria 4378
66 Ga0070694_100097758 3300005444 Bacteria 2071
67 Ga0070694_100546612 3300005444 Bacteria 927
68 Ga0070662_100127753 3300005457 Bacteria 1956
69 Ga0070662_100199210 3300005457 Bacteria 1588
70 Ga0070681_10023162 3300005458 Bacteria 6247
71 Ga0068867_100000292 3300005459 Bacteria 32858
72 Ga0068867_100001386 3300005459 Bacteria 16761
73 Ga0068867_101765923 3300005459 Bacteria 581
74 Ga0070685_10329298 3300005466 Unclassified 1038
75 Ga0070685_10353154 3300005466 Bacteria 1006
76 Ga0070707_100465035 3300005468 Bacteria 1226
77 Ga0070699_100146025 3300005518 Bacteria 2090
78 Ga0070699_100799461 3300005518 Archaea 863
79 Ga0070679_100034557 3300005530 Bacteria 5011
80 Ga0070679_101222502 3300005530 Bacteria 697
81 Ga0070697_100004285 3300005536 Bacteria 10940
82 Ga0070697_100097891 3300005536 Bacteria 2435
83 Ga0070697_100108087 3300005536 Bacteria 2315
84 Ga0070697_100359198 3300005536 Bacteria 1259
85 Ga0070697_101294971 3300005536 Bacteria 650
86 Ga0068853_100168736 3300005539 Bacteria 1979
87 Ga0070672_100060439 3300005543 Bacteria 2983
88 Ga0070672_100966113 3300005543 Unclassified 754
89 Ga0070686_100002450 3300005544 Bacteria 10226
90 Ga0070686_100217459 3300005544 Bacteria 1379
91 Ga0070686_100564427 3300005544 Bacteria 892
92 Ga0070686_101927099 3300005544 Bacteria 505
93 Ga0070695_100000113 3300005545 Bacteria 35966
94 Ga0070695_100002628 3300005545 Bacteria 10382
95 Ga0070695_100165127 3300005545 Bacteria 1558
96 Ga0070695_100389354 3300005545 Bacteria 1054
97 Ga0070696_100002261 3300005546 Bacteria 12697
98 Ga0070696_100034483 3300005546 Unclassified 3482
99 Ga0070696_100078429 3300005546 Bacteria 2335
100 Ga0070696_100166966 3300005546 Bacteria 1625
101 Ga0070696_100323897 3300005546 Bacteria 1187
102 Ga0070693_100000209 3300005547 Bacteria 27275
103 Ga0070693_101138593 3300005547 Bacteria 597
104 Ga0070704_100001744 3300005549 Bacteria 11877
105 Ga0070704_100003913 3300005549 Bacteria 8571
106 Ga0070704_100113708 3300005549 Bacteria 2064
107 Ga0070704_100567495 3300005549 Bacteria 993
108 Ga0068855_100014327 3300005563 Bacteria 9547
109 Ga0068854_100001665 3300005578 Bacteria 13528
110 Ga0068856_100070663 3300005614 Bacteria 3454
111 Ga0068856_100135199 3300005614 Bacteria 2471
112 Ga0068856_100440844 3300005614 Bacteria 1323
113 Ga0070702_100000240 3300005615 Bacteria 18563
114 Ga0070702_100031664 3300005615 Bacteria 2896
115 Ga0070702_100073132 3300005615 Bacteria 2030
116 Ga0070702_100688813 3300005615 Bacteria 777
117 Ga0068852_100140045 3300005616 Bacteria 2238
118 Ga0068859_100004628 3300005617 Bacteria 14018
119 Ga0068859_100159282 3300005617 Bacteria 2336
120 Ga0068859_100416577 3300005617 Bacteria 1440
121 Ga0068864_100490317 3300005618 Bacteria 1181
122 Ga0068866_10000744 3300005718 Bacteria 14729
123 Ga0068861_100000550 3300005719 Bacteria 22119
124 Ga0068861_100001659 3300005719 Bacteria 14237
125 Ga0068861_100499307 3300005719 Archaea 1099
126 Ga0068870_10057119 3300005840 Bacteria 2085
127 Ga0068870_10170900 3300005840 Bacteria 1297
128 Ga0068863_100770182 3300005841 Unclassified 959
129 Ga0068858_100004085 3300005842 Bacteria 14380
130 Ga0068858_100084871 3300005842 Bacteria 2946
131 Ga0068860_100004596 3300005843 Bacteria 14092
132 Ga0068860_100122367 3300005843 Bacteria 2492
133 Ga0068860_100534974 3300005843 Bacteria 1173
134 Ga0068862_100001897 3300005844 Bacteria 18976
135 Ga0068862_100002571 3300005844 Bacteria 16031
136 Ga0068862_100007318 3300005844 Bacteria 9165
137 Ga0068862_100083900 3300005844 Bacteria 2767
138 Ga0068862_100898646 3300005844 Bacteria 870
139 Ga0081455_10080904 3300005937 Bacteria 2662
140 Ga0075432_10348834 3300006058 Bacteria 627
141 Ga0070715_10009689 3300006163 Bacteria 3405
142 Ga0070715_10582365 3300006163 Bacteria 653
143 Ga0075366_10336007 3300006195 Bacteria 926
144 Ga0097621_100003980 3300006237 Bacteria 10238
145 Ga0097621_101340656 3300006237 Bacteria 676
146 Ga0068871_100000788 3300006358 Bacteria 21290
147 Ga0068871_100579429 3300006358 Bacteria 1019
148 Ga0075428_100227532 3300006844 Bacteria 2013
149 Ga0075428_100779822 3300006844 Bacteria 1016
150 Ga0075428_101641537 3300006844 Bacteria 671
151 Ga0075430_100214798 3300006846 Bacteria 1596
152 Ga0075431_100432535 3300006847 Bacteria 1314
153 Ga0075433_11690207 3300006852 Bacteria 545
154 Ga0075434_100012898 3300006871 Bacteria 7937
155 Ga0075434_100294327 3300006871 Bacteria 1643
156 Ga0075429_100000051 3300006880 Bacteria 55896
157 Ga0075429_100213915 3300006880 Bacteria 1689
158 Ga0068865_100001146 3300006881 Bacteria 15365
159 Ga0068865_100039652 3300006881 Bacteria 3196
160 Ga0068865_101112961 3300006881 Bacteria 696
161 Ga0075436_101490758 3300006914 Bacteria 514
162 Ga0097620_100004627 3300006931 Bacteria 14018
163 Ga0097620_100159277 3300006931 Bacteria 2336
164 Ga0097620_100416560 3300006931 Bacteria 1440
165 Ga0075435_100164270 3300007076 Bacteria 1872
166 Ga0075435_101336463 3300007076 Bacteria 628
167 Ga0075435_101949097 3300007076 Bacteria 516
168 Ga0099795_10531727 3300007788 Bacteria 552
169 Ga0105240_11226309 3300009093 Unclassified 793
170 Ga0111539_10013139 3300009094 Bacteria 10357
171 Ga0111539_10046832 3300009094 Bacteria 5171
172 Ga0111539_10249782 3300009094 Bacteria 2065
173 Ga0111539_10705943 3300009094 Bacteria 1174
174 Ga0111539_11350204 3300009094 Bacteria 827
175 Ga0111539_12117011 3300009094 Bacteria 653
176 Ga0105245_10002454 3300009098 Bacteria 16760
177 Ga0105247_10781059 3300009101 Bacteria 727
178 Ga0105247_11365462 3300009101 Unclassified 572
179 Ga0114129_10000337 3300009147 Bacteria 54884
180 Ga0114129_10008224 3300009147 Bacteria 14873
181 Ga0114129_10016630 3300009147 Bacteria 10476
182 Ga0114129_10029268 3300009147 Bacteria 7801
183 Ga0114129_10145159 3300009147 Bacteria 3251
184 Ga0114129_10242639 3300009147 Bacteria 2422
185 Ga0114129_10384669 3300009147 Bacteria 1852
186 Ga0114129_11176212 3300009147 Bacteria 956
187 Ga0114129_12008340 3300009147 Bacteria 699
188 Ga0105243_10000915 3300009148 Bacteria 27703
189 Ga0105243_10027923 3300009148 Bacteria 4329
190 Ga0105243_10631440 3300009148 Bacteria 1035
191 Ga0105241_10091058 3300009174 Bacteria 2405
192 Ga0105242_10000945 3300009176 Bacteria 22671
193 Ga0105242_10007393 3300009176 Bacteria 8458
194 Ga0105242_10640729 3300009176 Bacteria 1032
195 Ga0105242_11189667 3300009176 Bacteria 781
196 Ga0105242_12465367 3300009176 Bacteria 568
197 Ga0105248_10050849 3300009177 Bacteria 4649
198 Ga0105248_10080932 3300009177 Bacteria 3651
199 Ga0105248_10911856 3300009177 Bacteria 992
200 Ga0105249_10006665 3300009553 Bacteria 10054
201 Ga0105249_10033579 3300009553 Bacteria 4646
202 Ga0105239_10771332 3300010375 Bacteria 1101
203 Ga0105246_11746875 3300011119 Unclassified 593
204 Ga0105246_11947206 3300011119 Bacteria 566
205 Ga0157378_10000844 3300013297 Bacteria 28388
206 Ga0157378_10062390 3300013297 Bacteria 3328
207 Ga0163162_10065931 3300013306 Bacteria 3669
208 Ga0163162_12211759 3300013306 Bacteria 631
209 Ga0157372_10434022 3300013307 Bacteria 1531
210 Ga0157375_10065702 3300013308 Bacteria 3617
211 Ga0157375_12956834 3300013308 Archaea 568
212 Ga0157375_13630239 3300013308 Bacteria 513
213 Ga0157380_10890859 3300014326 Bacteria 915
214 Ga0157377_10414999 3300014745 Bacteria 920
215 Ga0157377_10658710 3300014745 Bacteria 755
216 Ga0157377_11712981 3300014745 Bacteria 507
217 Ga0157379_10049256 3300014968 Bacteria 3761
218 Ga0157376_10053591 3300014969 Bacteria 3359
219 Ga0157376_10979121 3300014969 Bacteria 867
220 Ga0163161_10556441 3300017792 Bacteria 941
221 Ga0207697_10210957 3300025315 Bacteria 856
222 Ga0207653_10007211 3300025885 Bacteria 3468
223 Ga0207653_10092895 3300025885 Bacteria 1059
224 Ga0207682_10095506 3300025893 Bacteria 1294
225 Ga0207642_10001528 3300025899 Bacteria 7114
226 Ga0207688_10027951 3300025901 Bacteria 3103
227 Ga0207688_10145827 3300025901 Bacteria 1395
228 Ga0207685_10001526 3300025905 Bacteria 4901
229 Ga0207685_10411615 3300025905 Bacteria 695
230 Ga0207685_10659995 3300025905 Unclassified 566
231 Ga0207645_10673881 3300025907 Archaea 703
232 Ga0207643_10034630 3300025908 Bacteria 2830
233 Ga0207643_10155091 3300025908 Bacteria 1375
234 Ga0207654_10024587 3300025911 Bacteria 3240
235 Ga0207707_10386858 3300025912 Bacteria 1202
236 Ga0207660_10029337 3300025917 Bacteria 3772
237 Ga0207660_10869457 3300025917 Bacteria 736
238 Ga0207660_11398934 3300025917 Bacteria 567
239 Ga0207662_10000233 3300025918 Bacteria 25755
240 Ga0207662_10193908 3300025918 Bacteria 1312
241 Ga0207652_10026298 3300025921 Bacteria 4845
242 Ga0207646_10550898 3300025922 Bacteria 1037
243 Ga0207646_10768360 3300025922 Bacteria 859
244 Ga0207681_10002997 3300025923 Bacteria 10612
245 Ga0207681_10091473 3300025923 Bacteria 2173
246 Ga0207659_10097270 3300025926 Bacteria 2211
247 Ga0207659_11347585 3300025926 Bacteria 612
248 Ga0207687_10002722 3300025927 Bacteria 11964
249 Ga0207706_10101552 3300025933 Bacteria 2531
250 Ga0207706_10294554 3300025933 Bacteria 1414
251 Ga0207686_10001496 3300025934 Bacteria 13174
252 Ga0207686_10114447 3300025934 Unclassified 1825
253 Ga0207709_10001980 3300025935 Bacteria 13355
254 Ga0207709_10003455 3300025935 Bacteria 9382
255 Ga0207670_10003031 3300025936 Bacteria 8859
256 Ga0207670_10184361 3300025936 Bacteria 1574
257 Ga0207670_10282656 3300025936 Bacteria 1294
258 Ga0207670_10556959 3300025936 Bacteria 937
259 Ga0207669_10351915 3300025937 Bacteria 1138
260 Ga0207704_10000745 3300025938 Bacteria 14317
261 Ga0207704_10246739 3300025938 Bacteria 1338
262 Ga0207704_10689930 3300025938 Bacteria 844
263 Ga0207704_11328562 3300025938 Bacteria 615
264 Ga0207665_10409824 3300025939 Bacteria 1034
265 Ga0207691_10022258 3300025940 Bacteria 5979
266 Ga0207691_10080707 3300025940 Bacteria 2925
267 Ga0207691_10518247 3300025940 Bacteria 1012
268 Ga0207711_10033949 3300025941 Bacteria 4319
269 Ga0207711_10177079 3300025941 Bacteria 1938
270 Ga0207711_10845774 3300025941 Bacteria 852
271 Ga0207689_10002282 3300025942 Bacteria 17945
272 Ga0207689_10416242 3300025942 Bacteria 1121
273 Ga0207667_10013499 3300025949 Bacteria 9341
274 Ga0207651_10214063 3300025960 Bacteria 1553
275 Ga0207651_10466100 3300025960 Unclassified 1086
276 Ga0207712_10006407 3300025961 Bacteria 7426
277 Ga0207712_10009194 3300025961 Bacteria 6259
278 Ga0207668_10030024 3300025972 Bacteria 3569
279 Ga0207640_10009018 3300025981 Bacteria 5564
280 Ga0207640_10490096 3300025981 Bacteria 1021
281 Ga0207658_10149606 3300025986 Bacteria 1900
282 Ga0207677_10188724 3300026023 Bacteria 1628
283 Ga0207677_12026912 3300026023 Bacteria 535
284 Ga0207703_10004183 3300026035 Bacteria 11897
285 Ga0207703_10686224 3300026035 Bacteria 973
286 Ga0207639_10138199 3300026041 Bacteria 2027
287 Ga0207708_10000625 3300026075 Bacteria 27213
288 Ga0207708_10688402 3300026075 Archaea 873
289 Ga0207702_10104812 3300026078 Bacteria 2503
290 Ga0207702_11280694 3300026078 Unclassified 727
291 Ga0207702_11428816 3300026078 Bacteria 685
292 Ga0207641_10538503 3300026088 Bacteria 1137
293 Ga0207641_11194217 3300026088 Bacteria 760
294 Ga0207648_10003871 3300026089 Bacteria 15628
295 Ga0207648_10004982 3300026089 Bacteria 13500
296 Ga0207648_11703565 3300026089 Bacteria 592
297 Ga0207676_11102285 3300026095 Bacteria 785
298 Ga0207674_10213543 3300026116 Bacteria 1878
299 Ga0207675_100001604 3300026118 Bacteria 22664
300 Ga0207675_100002069 3300026118 Bacteria 19988
301 Ga0207675_100097784 3300026118 Bacteria 2764
302 Ga0207675_100839793 3300026118 Bacteria 933
303 Ga0209967_1020812 3300027364 Unclassified 957
304 Ga0209981_1002960 3300027378 Bacteria 2185
305 Ga0209996_1024135 3300027395 Bacteria 865
306 Ga0210000_1038727 3300027462 Unclassified 754
307 Ga0209995_1004280 3300027471 Bacteria 2282
308 Ga0209995_1023258 3300027471 Unclassified 1030
309 Ga0209970_1103662 3300027614 Bacteria 545
310 Ga0210002_1077501 3300027617 Bacteria 590
311 Ga0209983_1069202 3300027665 Unclassified 785
312 Ga0209966_1151721 3300027695 Bacteria 539
313 Ga0209974_10023467 3300027876 Unclassified 2041
314 Ga0207428_10000610 3300027907 Bacteria 42207
315 Ga0207428_10047365 3300027907 Bacteria 3452
316 Ga0207428_10095606 3300027907 Bacteria 2302
317 Ga0207428_10245354 3300027907 Bacteria 1337
318 Ga0268265_10001521 3300028380 Bacteria 19348
319 Ga0268265_10002486 3300028380 Bacteria 13842
320 Ga0268265_10004770 3300028380 Bacteria 9351
321 Ga0268264_10004412 3300028381 Bacteria 12005
322 Ga0268264_10275621 3300028381 Bacteria 1573
323 Ga0307408_100300641 3300031548 Bacteria 1344
324 Ga0307406_10123781 3300031901 Bacteria 1803
325 Ga0373930_0183752 3300034816 Bacteria 538
326 Ga0373948_0001182 3300034817 Bacteria 3541
327 Ga0373950_0114217 3300034818 Unclassified 592
328 Ga0373950_0143363 3300034818 Bacteria 542
329 Ga0373958_0002972 3300034819 Bacteria 2422
330 Ga0373958_0021349 3300034819 Bacteria 1201
331 Ga0373928_0038561 3300035084 Bacteria 1088
332 Ga0373928_0097254 3300035084 Bacteria 763
333 Ga0373929_0145227 3300035085 Unclassified 632
334 Ga0373934_0168014 3300035086 Bacteria 900
335 Ga0373940_0008562 3300035088 Bacteria 2352
336 Ga0373940_0092763 3300035088 Bacteria 907
337 Ga0373949_0006617 3300035090 Bacteria 2547
338 Ga0373923_0127811 3300035111 Bacteria 1140
339 Ga0373932_0002590 3300035112 Bacteria 4516
340 Ga0373936_0072974 3300035113 Bacteria 1417
341 Ga0373936_0276211 3300035113 Bacteria 754
342 Ga0373939_0101169 3300035114 Bacteria 989
343 Ga0373941_0038699 3300035115 Bacteria 1461
344 Ga0373941_0093406 3300035115 Bacteria 1036
345 Ga0373945_0048380 3300035116 Unclassified 1557
346 Ga0373956_0433589 3300035119 Bacteria 627
347 Ga0373960_0009548 3300035121 Bacteria 2353
348 Ga0373960_0053196 3300035121 Bacteria 1208
349 Ga0373943_0103007 3300035170 Unclassified 1495
350 Ga0373943_0151264 3300035170 Bacteria 1257
351 Ga0373946_0004556 3300035171 Bacteria 4967
352 Ga0373946_0689960 3300035171 Bacteria 533
353 Ga0373955_0678402 3300035172 Bacteria 632
354 Ga0373942_0012936 3300035207 Bacteria 2000
355 Ga0373942_0138632 3300035207 Bacteria 773
356 Ga0373961_0021955 3300035241 Bacteria 1702
357 Ga0373961_0425653 3300035241 Bacteria 514
358 Ga0373961_0429553 3300035241 Bacteria 512
359 Ga0373962_0009735 3300035242 Bacteria 2386
360 Ga0373962_0065241 3300035242 Bacteria 1077
361 Ga0373924_0133866 3300035410 Bacteria 1079
362 Ga0373924_0195043 3300035410 Bacteria 892
363 Ga0373931_0000627 3300035691 Bacteria 14664
364 Ga0373931_0022311 3300035691 Bacteria 3185
365 Ga0373931_0080221 3300035691 Bacteria 1799
366 Ga0373931_0346852 3300035691 Bacteria 929
367 Ga0373931_0387493 3300035691 Bacteria 882
368 Ga0373935_0005441 3300035692 Bacteria 7501
369 Ga0373935_0117702 3300035692 Bacteria 1771
370 Ga0373935_0262439 3300035692 Bacteria 1212
371 Ga0373935_0863158 3300035692 Bacteria 669
372 Ga0373927_0011212 3300035695 Bacteria 5971
373 Ga0373927_0083958 3300035695 Bacteria 2065
374 Ga0373933_0295614 3300035724 Bacteria 1048
375 Ga0373947_0097050 3300035725 Bacteria 1846
376 Ga0373947_0101406 3300035725 Bacteria 1809
377 Ga0373947_0941177 3300035725 Bacteria 590
378 Ga0373937_0052125 3300036401 Bacteria 3751
379 Ga0373937_0663120 3300036401 Bacteria 989
380 Ga0373937_0791207 3300036401 Bacteria 896
381 Ga0373937_1679232 3300036401 Bacteria 582
382 Ga0373937_1692074 3300036401 Bacteria 579
383 Ga0373925_0066291 3300037068 Bacteria 2721
384 Ga0373925_0088900 3300037068 Bacteria 2359
385 Ga0373925_0100516 3300037068 Bacteria 2222
386 Ga0439439_0092466 3300041406 Unclassified 827
387 Ga0439453_0003408 3300041408 Bacteria 2286
388 Ga0451845_0410294 3300041501 Bacteria 547
389 Ga0439441_001976 3300042001 Bacteria 2816
390 Ga0439441_013001 3300042001 Bacteria 1438
391 Ga0439443_001992 3300042003 Unclassified 2378
392 Ga0439456_108030 3300042013 Unclassified 633
393 Ga0439435_0013240 3300042436 Unclassified 2013
394 Ga0439435_0090734 3300042436 Bacteria 928
395 Ga0439444_0003782 3300042437 Unclassified 2160
396 Ga0439444_0004604 3300042437 Unclassified 2013
397 Ga0439460_0162420 3300042461 Bacteria 749
398 Ga0451577_0461457 3300042876 Bacteria 1154
399 Ga0451577_0772751 3300042876 Bacteria 868
400 Ga0451576_0004679 3300045051 Bacteria 17624
401 Ga0451576_0079235 3300045051 Bacteria 3418
402 Ga0451576_0143433 3300045051 Bacteria 2490
403 Ga0451576_0301925 3300045051 Bacteria 1675
404 Ga0451576_0370364 3300045051 Bacteria 1501
405 Ga0495592_0004958 3300046454 Bacteria 9797
406 Ga0495603_0163393 3300046455 Bacteria 1291
407 Ga0495603_0331685 3300046455 Bacteria 873
408 Ga0495651_0142375 3300046462 Bacteria 1737
409 Ga0495653_0073978 3300046463 Bacteria 2541
410 Ga0495580_0103150 3300046472 Bacteria 1982
411 Ga0495582_0067392 3300046473 Bacteria 1978
412 Ga0495639_0024386 3300046475 Bacteria 2663
413 Ga0495662_0059908 3300046476 Bacteria 1838
414 Ga0495585_0534491 3300046492 Unclassified 555
415 Ga0495608_0029943 3300046511 Bacteria 3688
416 Ga0495628_0036773 3300046516 Bacteria 3927
417 Ga0495628_0225804 3300046516 Bacteria 1405
418 Ga0495630_0039500 3300046517 Bacteria 3528
419 Ga0495630_0336171 3300046517 Bacteria 1155
420 Ga0495663_0071379 3300046525 Bacteria 1106
421 Ga0495666_0042293 3300046526 Bacteria 2204
422 Ga0495642_0476505 3300046528 Unclassified 552
423 Ga0495652_0071755 3300046529 Bacteria 2889
424 Ga0495665_0298293 3300046531 Bacteria 825
425 Ga0495640_0059080 3300046533 Bacteria 2613
426 Ga0495586_0070899 3300046535 Bacteria 1903
427 Ga0495586_0203209 3300046535 Bacteria 1123
428 Ga0495587_0174816 3300046536 Bacteria 1219
429 Ga0495587_0484392 3300046536 Bacteria 684
430 Ga0495598_0089958 3300046537 Bacteria 999
431 Ga0495645_0648278 3300046543 Bacteria 645
432 Ga0495667_0044481 3300046559 Bacteria 2941
433 Ga0495634_0064732 3300046642 Bacteria 2423
434 Ga0495635_0315410 3300046663 Bacteria 1047
435 Ga0495588_0151713 3300046674 Bacteria 1225
436 Ga0495657_0337072 3300046675 Unclassified 894
437 Ga0495647_0042309 3300046681 Bacteria 1739
438 Ga0495658_0002184 3300046683 Bacteria 9894
439 Ga0495658_0087247 3300046683 Bacteria 1842
440 Ga0495669_0252055 3300046684 Archaea 848
441 Ga0495613_0027966 3300046689 Bacteria 4197
442 Ga0495624_0053184 3300046690 Bacteria 2557
443 Ga0495670_0121169 3300046691 Bacteria 1359
444 Ga0495581_0743580 3300047315 Bacteria 564
445 Ga0495604_0046624 3300047317 Bacteria 3379
446 Ga0495674_0406187 3300047319 Bacteria 1099
447 Ga0495672_0177855 3300047320 Bacteria 1080
448 Ga0495676_0400187 3300047321 Unclassified 911
449 Ga0495680_0004970 3300047322 Bacteria 12565
450 Ga0495684_0155527 3300047471 Bacteria 1708
451 Ga0496102_0394218 3300048905 Bacteria 1302
452 Ga0496106_0610468 3300048909 Bacteria 873
453 Ga0496107_0173133 3300048910 Bacteria 1602
454 Ga0496109_1158446 3300048912 Bacteria 710
455 Ga0496111_0931316 3300048914 Bacteria 625
456 Ga0501292_012482 3300049515 Bacteria 1297
457 Ga0501032_0995575 3300049569 Bacteria 527
458 Ga0501033_0019722 3300049570 Bacteria 5096
459 Ga0501037_0107942 3300049573 Bacteria 2006
460 Ga0501038_0127723 3300049574 Bacteria 2091
461 Ga0501040_0089116 3300049576 Bacteria 2143
462 Ga0501040_0809609 3300049576 Unclassified 678
463 Ga0501040_1102030 3300049576 Bacteria 576
464 Ga0501041_0075140 3300049577 Bacteria 2077
465 Ga0501041_0100714 3300049577 Bacteria 1788
466 Ga0501042_0826692 3300049578 Bacteria 674
467 Ga0501042_1307774 3300049578 Bacteria 529
468 Ga0501046_0463238 3300049580 Bacteria 911
469 Ga0501048_0175945 3300049582 Bacteria 1517
470 Ga0501048_0302475 3300049582 Bacteria 1138
471 Ga0501071_0207990 3300049587 Bacteria 1471
472 Ga0501071_0341519 3300049587 Bacteria 1139
473 Ga0501072_0060414 3300049588 Bacteria 2989
474 Ga0501072_1498270 3300049588 Bacteria 521
475 Ga0501073_1012578 3300049589 Bacteria 571
476 Ga0501073_1157548 3300049589 Bacteria 531
477 Ga0501074_0359116 3300049590 Bacteria 1034
478 Ga0501075_0144523 3300049591 Bacteria 1813
479 Ga0501075_0911581 3300049591 Bacteria 668
480 Ga0501076_0140321 3300049592 Bacteria 1963
481 Ga0501077_0562071 3300049593 Bacteria 732
482 Ga0501080_0403340 3300049742 Bacteria 1230
483 Ga0501081_0072347 3300049743 Bacteria 2404
484 Ga0501045_0003239 3300049824 Bacteria 11116
485 Ga0501045_0177728 3300049824 Bacteria 1586
486 Ga0501045_0210579 3300049824 Bacteria 1448
487 nmdc:mga0k408_319778_c1 3300050493 Bacteria 926
488 nmdc:mga05p37_108104_c1 3300050507 Bacteria 3422
489 nmdc:mga05p37_243270_c1 3300050507 Bacteria 2162
490 nmdc:mga05p37_30475_c1 3300050507 Bacteria 6582
491 nmdc:mga05p37_305570_c1 3300050507 Bacteria 1888
492 nmdc:mga05p37_30864_c1 3300050507 Bacteria 6541
493 nmdc:mga05p37_660898_c1 3300050507 Bacteria 1168
494 nmdc:mga05p37_758_c1 3300050507 Bacteria 35839
495 nmdc:mga09592_1050_c1 3300050508 Bacteria 21887
496 nmdc:mga09592_1090108_c1 3300050508 Bacteria 664
497 nmdc:mga09592_608954_c1 3300050508 Bacteria 935
498 nmdc:mga09592_87370_c1 3300050508 Bacteria 2662
499 nmdc:mga0qj67_206290_c1 3300050509 Bacteria 1596
500 nmdc:mga0qj67_40672_c1 3300050509 Bacteria 3654
501 nmdc:mga06r32_220600_c1 3300050510 Bacteria 1884
502 nmdc:mga06r32_811582_c1 3300050510 Bacteria 896
503 nmdc:mga08y16_125446_c1 3300050511 Bacteria 2671
504 nmdc:mga08y16_389539_c1 3300050511 Archaea 1428
505 nmdc:mga08y16_40431_c1 3300050511 Bacteria 4889
506 nmdc:mga08y16_486955_c1 3300050511 Bacteria 1255
507 nmdc:mga08y16_7868_c1 3300050511 Bacteria 11161
508 nmdc:mga0n895_1194990_c1 3300050512 Bacteria 735
509 nmdc:mga0n895_125846_c1 3300050512 Bacteria 2586
510 nmdc:mga0n895_150077_c1 3300050512 Bacteria 2361
511 nmdc:mga0n895_1553681_c1 3300050512 Bacteria 627
512 nmdc:mga0n895_923479_c1 3300050512 Bacteria 857
513 nmdc:mga0rr50_532351_c1 3300050513 Bacteria 1000
514 nmdc:mga08x19_1227486_c1 3300050514 Bacteria 531
515 nmdc:mga0a205_1352501_c1 3300050515 Bacteria 560
516 nmdc:mga0a205_143110_c1 3300050515 Bacteria 2291
517 nmdc:mga0a205_169742_c1 3300050515 Bacteria 2077
518 nmdc:mga0a205_209807_c1 3300050515 Bacteria 1836
519 nmdc:mga0a205_41762_c1 3300050515 Bacteria 4418
520 nmdc:mga0a205_448244_c1 3300050515 Bacteria 1151
521 Ga0495601_0046389 3300053077 Bacteria 2735
522 Ga0501084_1436056 3300054114 Bacteria 578
523 Ga0501082_0971388 3300060353 Bacteria 743
524 Ga0501214_093722
525 Ga0065704_10213250
526 Ga0065704_10444722
527 Ga0065707_10247798
528 Ga0070676_11109754
529 Ga0070690_100001754
530 Ga0070690_100718528
531 Ga0070690_101400525
532 Ga0070677_10122329
533 Ga0068869_100001435
534 Ga0068869_100009438
535 Ga0068869_101748048
536 Ga0070666_10038287
537 Ga0070680_100000789
538 Ga0070680_100218666
539 Ga0068868_100001331
540 Ga0068868_101166696
541 Ga0070689_100000776
542 Ga0070689_100305726
543 Ga0070689_100351418
544 Ga0070691_10011311
545 Ga0070691_10041643
546 Ga0070687_100000436
547 Ga0070687_101001072
548 Ga0070692_10000910
549 Ga0070692_10100935
550 Ga0070692_10165293
551 Ga0070692_10423216
552 Ga0070668_100038083
553 Ga0070668_100926024
554 Ga0070668_101218423
555 Ga0070669_100006558
556 Ga0070669_100043117
557 Ga0070675_100024891
558 Ga0070671_100032920
559 Ga0070674_100063364
560 Ga0070674_100115346
561 Ga0070674_100442819
562 Ga0070674_100965287
563 Ga0070673_100019737
564 Ga0070673_100305571
565 Ga0070673_100378249
566 Ga0070673_100751595
567 Ga0070688_100079694
568 Ga0070688_100723787
569 Ga0070688_100808659
570 Ga0070659_100999141
571 Ga0070667_100004944
572 Ga0070703_10094130
573 Ga0070703_10218312
574 Ga0070710_10274415
575 Ga0070701_10002594
576 Ga0070701_10068092
577 Ga0070701_10170740
578 Ga0070701_10272395
579 Ga0070705_100001008
580 Ga0070705_100156167
581 Ga0070705_100688235
582 Ga0070700_100000666
583 Ga0070700_100013963
584 Ga0070700_100158498
585 Ga0070700_100972761
586 Ga0070700_102001026
587 Ga0070694_100001273
588 Ga0070694_100018906
589 Ga0070694_100097758
590 Ga0070694_100546612
591 Ga0070662_100127753
592 Ga0070662_100199210
593 Ga0070681_10023162
594 Ga0068867_100000292
595 Ga0068867_100001386
596 Ga0068867_101765923
597 Ga0070685_10329298
598 Ga0070685_10353154
599 Ga0070707_100465035
600 Ga0070699_100146025
601 Ga0070699_100799461
602 Ga0070679_100034557
603 Ga0070679_101222502
604 Ga0070697_100004285
605 Ga0070697_100097891
606 Ga0070697_100108087
607 Ga0070697_100359198
608 Ga0070697_101294971
609 Ga0068853_100168736
610 Ga0070672_100060439
611 Ga0070672_100966113
612 Ga0070686_100002450
613 Ga0070686_100217459
614 Ga0070686_100564427
615 Ga0070686_101927099
616 Ga0070695_100000113
617 Ga0070695_100002628
618 Ga0070695_100165127
619 Ga0070695_100389354
620 Ga0070696_100002261
621 Ga0070696_100034483
622 Ga0070696_100078429
623 Ga0070696_100166966
624 Ga0070696_100323897
625 Ga0070693_100000209
626 Ga0070693_101138593
627 Ga0070704_100001744
628 Ga0070704_100003913
629 Ga0070704_100113708
630 Ga0070704_100567495
631 Ga0068855_100014327
632 Ga0068854_100001665
633 Ga0068856_100070663
634 Ga0068856_100135199
635 Ga0068856_100440844
636 Ga0070702_100000240
637 Ga0070702_100031664
638 Ga0070702_100073132
639 Ga0070702_100688813
640 Ga0068852_100140045
641 Ga0068859_100004628
642 Ga0068859_100159282
643 Ga0068859_100416577
644 Ga0068864_100490317
645 Ga0068866_10000744
646 Ga0068861_100000550
647 Ga0068861_100001659
648 Ga0068861_100499307
649 Ga0068870_10057119
650 Ga0068870_10170900
651 Ga0068863_100770182
652 Ga0068858_100004085
653 Ga0068858_100084871
654 Ga0068860_100004596
655 Ga0068860_100122367
656 Ga0068860_100534974
657 Ga0068862_100001897
658 Ga0068862_100002571
659 Ga0068862_100007318
660 Ga0068862_100083900
661 Ga0068862_100898646
662 Ga0081455_10080904
663 Ga0075432_10348834
664 Ga0070715_10009689
665 Ga0070715_10582365
666 Ga0075366_10336007
667 Ga0097621_100003980
668 Ga0097621_101340656
669 Ga0068871_100000788
670 Ga0068871_100579429
671 Ga0075428_100227532
672 Ga0075428_100779822
673 Ga0075428_101641537
674 Ga0075430_100214798
675 Ga0075431_100432535
676 Ga0075433_11690207
677 Ga0075434_100012898
678 Ga0075434_100294327
679 Ga0075429_100000051
680 Ga0075429_100213915
681 Ga0068865_100001146
682 Ga0068865_100039652
683 Ga0068865_101112961
684 Ga0075436_101490758
685 Ga0097620_100004627
686 Ga0097620_100159277
687 Ga0097620_100416560
688 Ga0075435_100164270
689 Ga0075435_101336463
690 Ga0075435_101949097
691 Ga0099795_10531727
692 Ga0105240_11226309
693 Ga0111539_10013139
694 Ga0111539_10046832
695 Ga0111539_10249782
696 Ga0111539_10705943
697 Ga0111539_11350204
698 Ga0111539_12117011
699 Ga0105245_10002454
700 Ga0105247_10781059
701 Ga0105247_11365462
702 Ga0114129_10000337
703 Ga0114129_10008224
704 Ga0114129_10016630
705 Ga0114129_10029268
706 Ga0114129_10145159
707 Ga0114129_10242639
708 Ga0114129_10384669
709 Ga0114129_11176212
710 Ga0114129_12008340
711 Ga0105243_10000915
712 Ga0105243_10027923
713 Ga0105243_10631440
714 Ga0105241_10091058
715 Ga0105242_10000945
716 Ga0105242_10007393
717 Ga0105242_10640729
718 Ga0105242_11189667
719 Ga0105242_12465367
720 Ga0105248_10050849
721 Ga0105248_10080932
722 Ga0105248_10911856
723 Ga0105249_10006665
724 Ga0105249_10033579
725 Ga0105239_10771332
726 Ga0105246_11746875
727 Ga0105246_11947206
728 Ga0157378_10000844
729 Ga0157378_10062390
730 Ga0163162_10065931
731 Ga0163162_12211759
732 Ga0157372_10434022
733 Ga0157375_10065702
734 Ga0157375_12956834
735 Ga0157375_13630239
736 Ga0157380_10890859
737 Ga0157377_10414999
738 Ga0157377_10658710
739 Ga0157377_11712981
740 Ga0157379_10049256
741 Ga0157376_10053591
742 Ga0157376_10979121
743 Ga0163161_10556441
744 Ga0207697_10210957
745 Ga0207653_10007211
746 Ga0207653_10092895
747 Ga0207682_10095506
748 Ga0207642_10001528
749 Ga0207688_10027951
750 Ga0207688_10145827
751 Ga0207685_10001526
752 Ga0207685_10411615
753 Ga0207685_10659995
754 Ga0207645_10673881
755 Ga0207643_10034630
756 Ga0207643_10155091
757 Ga0207654_10024587
758 Ga0207707_10386858
759 Ga0207660_10029337
760 Ga0207660_10869457
761 Ga0207660_11398934
762 Ga0207662_10000233
763 Ga0207662_10193908
764 Ga0207652_10026298
765 Ga0207646_10550898
766 Ga0207646_10768360
767 Ga0207681_10002997
768 Ga0207681_10091473
769 Ga0207659_10097270
770 Ga0207659_11347585
771 Ga0207687_10002722
772 Ga0207706_10101552
773 Ga0207706_10294554
774 Ga0207686_10001496
775 Ga0207686_10114447
776 Ga0207709_10001980
777 Ga0207709_10003455
778 Ga0207670_10003031
779 Ga0207670_10184361
780 Ga0207670_10282656
781 Ga0207670_10556959
782 Ga0207669_10351915
783 Ga0207704_10000745
784 Ga0207704_10246739
785 Ga0207704_10689930
786 Ga0207704_11328562
787 Ga0207665_10409824
788 Ga0207691_10022258
789 Ga0207691_10080707
790 Ga0207691_10518247
791 Ga0207711_10033949
792 Ga0207711_10177079
793 Ga0207711_10845774
794 Ga0207689_10002282
795 Ga0207689_10416242
796 Ga0207667_10013499
797 Ga0207651_10214063
798 Ga0207651_10466100
799 Ga0207712_10006407
800 Ga0207712_10009194
801 Ga0207668_10030024
802 Ga0207640_10009018
803 Ga0207640_10490096
804 Ga0207658_10149606
805 Ga0207677_10188724
806 Ga0207677_12026912
807 Ga0207703_10004183
808 Ga0207703_10686224
809 Ga0207639_10138199
810 Ga0207708_10000625
811 Ga0207708_10688402
812 Ga0207702_10104812
813 Ga0207702_11280694
814 Ga0207702_11428816
815 Ga0207641_10538503
816 Ga0207641_11194217
817 Ga0207648_10003871
818 Ga0207648_10004982
819 Ga0207648_11703565
820 Ga0207676_11102285
821 Ga0207674_10213543
822 Ga0207675_100001604
823 Ga0207675_100002069
824 Ga0207675_100097784
825 Ga0207675_100839793
826 Ga0209967_1020812
827 Ga0209981_1002960
828 Ga0209996_1024135
829 Ga0210000_1038727
830 Ga0209995_1004280
831 Ga0209995_1023258
832 Ga0209970_1103662
833 Ga0210002_1077501
834 Ga0209983_1069202
835 Ga0209966_1151721
836 Ga0209974_10023467
837 Ga0207428_10000610
838 Ga0207428_10047365
839 Ga0207428_10095606
840 Ga0207428_10245354
841 Ga0268265_10001521
842 Ga0268265_10002486
843 Ga0268265_10004770
844 Ga0268264_10004412
845 Ga0268264_10275621
846 Ga0307408_100300641
847 Ga0307406_10123781
848 Ga0373930_0183752
849 Ga0373948_0001182
850 Ga0373950_0114217
851 Ga0373950_0143363
852 Ga0373958_0002972
853 Ga0373958_0021349
854 Ga0373928_0038561
855 Ga0373928_0097254
856 Ga0373929_0145227
857 Ga0373934_0168014
858 Ga0373940_0008562
859 Ga0373940_0092763
860 Ga0373949_0006617
861 Ga0373923_0127811
862 Ga0373932_0002590
863 Ga0373936_0072974
864 Ga0373936_0276211
865 Ga0373939_0101169
866 Ga0373941_0038699
867 Ga0373941_0093406
868 Ga0373945_0048380
869 Ga0373956_0433589
870 Ga0373960_0009548
871 Ga0373960_0053196
872 Ga0373943_0103007
873 Ga0373943_0151264
874 Ga0373946_0004556
875 Ga0373946_0689960
876 Ga0373955_0678402
877 Ga0373942_0012936
878 Ga0373942_0138632
879 Ga0373961_0021955
880 Ga0373961_0425653
881 Ga0373961_0429553
882 Ga0373962_0009735
883 Ga0373962_0065241
884 Ga0373924_0133866
885 Ga0373924_0195043
886 Ga0373931_0000627
887 Ga0373931_0022311
888 Ga0373931_0080221
889 Ga0373931_0346852
890 Ga0373931_0387493
891 Ga0373935_0005441
892 Ga0373935_0117702
893 Ga0373935_0262439
894 Ga0373935_0863158
895 Ga0373927_0011212
896 Ga0373927_0083958
897 Ga0373933_0295614
898 Ga0373947_0097050
899 Ga0373947_0101406
900 Ga0373947_0941177
901 Ga0373937_0052125
902 Ga0373937_0663120
903 Ga0373937_0791207
904 Ga0373937_1679232
905 Ga0373937_1692074
906 Ga0373925_0066291
907 Ga0373925_0088900
908 Ga0373925_0100516
909 Ga0439439_0092466
910 Ga0439453_0003408
911 Ga0451845_0410294
912 Ga0439441_001976
913 Ga0439441_013001
914 Ga0439443_001992
915 Ga0439456_108030
916 Ga0439435_0013240
917 Ga0439435_0090734
918 Ga0439444_0003782
919 Ga0439444_0004604
920 Ga0439460_0162420
921 Ga0451577_0461457
922 Ga0451577_0772751
923 Ga0451576_0004679
924 Ga0451576_0079235
925 Ga0451576_0143433
926 Ga0451576_0301925
927 Ga0451576_0370364
928 Ga0495592_0004958
929 Ga0495603_0163393
930 Ga0495603_0331685
931 Ga0495651_0142375
932 Ga0495653_0073978
933 Ga0495580_0103150
934 Ga0495582_0067392
935 Ga0495639_0024386
936 Ga0495662_0059908
937 Ga0495585_0534491
938 Ga0495608_0029943
939 Ga0495628_0036773
940 Ga0495628_0225804
941 Ga0495630_0039500
942 Ga0495630_0336171
943 Ga0495663_0071379
944 Ga0495666_0042293
945 Ga0495642_0476505
946 Ga0495652_0071755
947 Ga0495665_0298293
948 Ga0495640_0059080
949 Ga0495586_0070899
950 Ga0495586_0203209
951 Ga0495587_0174816
952 Ga0495587_0484392
953 Ga0495598_0089958
954 Ga0495645_0648278
955 Ga0495667_0044481
956 Ga0495634_0064732
957 Ga0495635_0315410
958 Ga0495588_0151713
959 Ga0495657_0337072
960 Ga0495647_0042309
961 Ga0495658_0002184
962 Ga0495658_0087247
963 Ga0495669_0252055
964 Ga0495613_0027966
965 Ga0495624_0053184
966 Ga0495670_0121169
967 Ga0495581_0743580
968 Ga0495604_0046624
969 Ga0495674_0406187
970 Ga0495672_0177855
971 Ga0495676_0400187
972 Ga0495680_0004970
973 Ga0495684_0155527
974 Ga0496102_0394218
975 Ga0496106_0610468
976 Ga0496107_0173133
977 Ga0496109_1158446
978 Ga0496111_0931316
979 Ga0501292_012482
980 Ga0501032_0995575
981 Ga0501033_0019722
982 Ga0501037_0107942
983 Ga0501038_0127723
984 Ga0501040_0089116
985 Ga0501040_0809609
986 Ga0501040_1102030
987 Ga0501041_0075140
988 Ga0501041_0100714
989 Ga0501042_0826692
990 Ga0501042_1307774
991 Ga0501046_0463238
992 Ga0501048_0175945
993 Ga0501048_0302475
994 Ga0501071_0207990
995 Ga0501071_0341519
996 Ga0501072_0060414
997 Ga0501072_1498270
998 Ga0501073_1012578
999 Ga0501073_1157548
1000 Ga0501074_0359116
1001 Ga0501075_0144523
1002 Ga0501075_0911581
1003 Ga0501076_0140321
1004 Ga0501077_0562071
1005 Ga0501080_0403340
1006 Ga0501081_0072347
1007 Ga0501045_0003239
1008 Ga0501045_0177728
1009 Ga0501045_0210579
1010 nmdc:mga0k408_319778_c1
1011 nmdc:mga05p37_108104_c1
1012 nmdc:mga05p37_243270_c1
1013 nmdc:mga05p37_30475_c1
1014 nmdc:mga05p37_305570_c1
1015 nmdc:mga05p37_30864_c1
1016 nmdc:mga05p37_660898_c1
1017 nmdc:mga05p37_758_c1
1018 nmdc:mga09592_1050_c1
1019 nmdc:mga09592_1090108_c1
1020 nmdc:mga09592_608954_c1
1021 nmdc:mga09592_87370_c1
1022 nmdc:mga0qj67_206290_c1
1023 nmdc:mga0qj67_40672_c1
1024 nmdc:mga06r32_220600_c1
1025 nmdc:mga06r32_811582_c1
1026 nmdc:mga08y16_125446_c1
1027 nmdc:mga08y16_389539_c1
1028 nmdc:mga08y16_40431_c1
1029 nmdc:mga08y16_486955_c1
1030 nmdc:mga08y16_7868_c1
1031 nmdc:mga0n895_1194990_c1
1032 nmdc:mga0n895_125846_c1
1033 nmdc:mga0n895_150077_c1
1034 nmdc:mga0n895_1553681_c1
1035 nmdc:mga0n895_923479_c1
1036 nmdc:mga0rr50_532351_c1
1037 nmdc:mga08x19_1227486_c1
1038 nmdc:mga0a205_1352501_c1
1039 nmdc:mga0a205_143110_c1
1040 nmdc:mga0a205_169742_c1
1041 nmdc:mga0a205_209807_c1
1042 nmdc:mga0a205_41762_c1
1043 nmdc:mga0a205_448244_c1
1044 Ga0495601_0046389
1045 Ga0501084_1436056
1046 Ga0501082_0971388

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9678 1 113
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9543 2 113
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9531 1 113
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9514 1 113
4hnr-assembly1.cif.gz_A high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae 0.9513 1 117
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9749 3 80 3.40.50.2300
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.971 2 69 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9649 3 80 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9648 3 80 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9618 2 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8DN48-F1-model_v4 Response regulatory domain-containing protein 0.9873 3 113 GO:0000160
AF-A0A251WKW7-F1-model_v4 Response regulatory domain-containing protein 0.9793 3 116 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W0ZT03-F1-model_v4 DUF4388 domain-containing protein 0.9775 2 109 GO:0000160
GO:0035438
AF-A0A537AFH0-F1-model_v4 Response regulator 0.977 3 113 GO:0000160
AF-A0A5C5YFN1-F1-model_v4 Response regulator MprA 0.976 2 111 GO:0000160

Map