metagRoot

F459064

General Info

Members	Datasets	Scaffolds	Average Seq Length
523	278	521	270

Family's Representative Sequence

Representative Sequence	3300050513\|nmdc:mga0rr50_33479_c1\|nmdc:mga0rr50_33479_c1_2506_3348
Length	280
Sequence	VKVDMRIANIWRVAIVFAAGVALAAVTAGQTAKPAPSGNAGLIDDLVVANRILDNENILDGLGHVSVRSLTNPNHFFQSRDLAPGLVTAADILEYDLDGNPVNPKAPPSVRERFIHGSIYKARPDVKSVVHSHMPSVLPYTDVTTPLRAMYHMAAFLVPGVPMFEIRKVAGHIGMLVDDAKSGDALAQALGNKTVVLLRGHGAAIVGSSVPDAVSNAIFLDVNARAQSQAIALGGNISYLTQADLAPPTPNQQPSALPGSQGYYPRSWPIWKAKAMGEKR

Samples

	Sample ID	Description	Type	Environment
1	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
2	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
3	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
4	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
5	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
21	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
27	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
28	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
29	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
32	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
33	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
34	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
35	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
36	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
37	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
38	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
43	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
44	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
45	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
46	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
47	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
48	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
49	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
52	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
53	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
54	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
55	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
56	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
57	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
58	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
59	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
60	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
61	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
62	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
63	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
64	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
65	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
66	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
67	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
68	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
69	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
70	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
71	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
72	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
73	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
77	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
78	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
79	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
80	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
81	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
82	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
83	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
87	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
88	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
90	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
91	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
93	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
94	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
95	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
96	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
97	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
98	3300009986	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG	Metagenome	Rhizosphere
99	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
102	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
103	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
104	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
108	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
109	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
110	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
163	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
167	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
168	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
169	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
170	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
171	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
172	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
173	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
174	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
175	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
176	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
177	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
178	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
179	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
180	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
181	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
182	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
183	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
184	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
185	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
186	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
187	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
188	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
189	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
190	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
191	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
192	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
193	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
194	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
195	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
196	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
197	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
198	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
199	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
200	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
201	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
202	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
203	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
204	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
205	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
206	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
207	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
208	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
209	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
210	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
211	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
212	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
213	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
214	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
215	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
216	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
217	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
218	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
219	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
220	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
221	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
222	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
223	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
224	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
225	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
226	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
227	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
228	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
229	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
230	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
231	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
232	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
233	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
234	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
235	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
236	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
237	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
238	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
239	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
240	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
241	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
242	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
243	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
244	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
245	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
246	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
247	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
248	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
249	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
250	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
251	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
252	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
253	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
258	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
259	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
260	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
261	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
262	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
263	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
264	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
265	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
266	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
267	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
268	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
269	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
270	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
271	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
272	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
273	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
274	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
275	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
276	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
277	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
278	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.62
Metatranscriptomes	0
Isolates	0.38

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.06
Nodule	0.19
Rhizoplane	3.44
Rhizosphere	89.1
Stem	0
Stem Tuber	0
Unclassified	4.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065714_10112926	3300005288	Unclassified	1420
2	Ga0065704_10002378	3300005289	Bacteria	8903
3	Ga0065704_10011409	3300005289	Unclassified	2626
4	Ga0065712_10069840	3300005290	Bacteria	6628
5	Ga0065715_10023726	3300005293	Bacteria	1560
6	Ga0065707_10003055	3300005295	Bacteria	5390
7	Ga0065707_10098854	3300005295	Unclassified	3051
8	Ga0070676_10018607	3300005328	Bacteria	3852
9	Ga0070676_10137908	3300005328	Bacteria	1549
10	Ga0070676_10245569	3300005328	Bacteria	1192
11	Ga0070676_10282685	3300005328	Unclassified	1119
12	Ga0070683_100074962	3300005329	Bacteria	3160
13	Ga0070690_100016465	3300005330	Bacteria	4430
14	Ga0070690_100088734	3300005330	Bacteria	2033
15	Ga0070670_100001336	3300005331	Bacteria	19711
16	Ga0070670_100005344	3300005331	Bacteria	10832
17	Ga0070670_100209886	3300005331	Unclassified	1693
18	Ga0070677_10010767	3300005333	Unclassified	3137
19	Ga0068869_100003353	3300005334	Bacteria	9776
20	Ga0070666_10006616	3300005335	Bacteria	7128
21	Ga0070666_10159659	3300005335	Bacteria	1575
22	Ga0070680_100327467	3300005336	Unclassified	1301
23	Ga0070682_100113588	3300005337	Bacteria	1809
24	Ga0068868_100036291	3300005338	Unclassified	3815
25	Ga0068868_100054587	3300005338	Unclassified	3149
26	Ga0068868_100097123	3300005338	Bacteria	2380
27	Ga0068868_100530561	3300005338	Unclassified	1035
28	Ga0070689_100032612	3300005340	Unclassified	3963
29	Ga0070689_100065953	3300005340	Bacteria	2820
30	Ga0070691_10046446	3300005341	Unclassified	2063
31	Ga0070691_10285744	3300005341	Bacteria	896
32	Ga0070661_100043765	3300005344	Bacteria	3271
33	Ga0070661_100089313	3300005344	Unclassified	2282
34	Ga0070661_100242922	3300005344	Unclassified	1387
35	Ga0070692_10073426	3300005345	Unclassified	1827
36	Ga0070668_100033764	3300005347	Bacteria	3898
37	Ga0070668_100241342	3300005347	Bacteria	1497
38	Ga0070669_100014926	3300005353	Bacteria	5535
39	Ga0070669_100020876	3300005353	Unclassified	4679
40	Ga0070669_100064214	3300005353	Bacteria	2703
41	Ga0070669_100121269	3300005353	Bacteria	1995
42	Ga0070675_100014055	3300005354	Bacteria	6305
43	Ga0070675_100033041	3300005354	Unclassified	4191
44	Ga0070675_100074393	3300005354	Unclassified	2822
45	Ga0070671_100026766	3300005355	Bacteria	4743
46	Ga0070674_100000614	3300005356	Bacteria	17962
47	Ga0070674_100058469	3300005356	Unclassified	2680
48	Ga0070674_100166204	3300005356	Bacteria	1678
49	Ga0070674_100457103	3300005356	Bacteria	1055
50	Ga0070673_100096389	3300005364	Bacteria	2427
51	Ga0070673_100168584	3300005364	Unclassified	1867
52	Ga0070673_100201678	3300005364	Unclassified	1713
53	Ga0070673_100268579	3300005364	Unclassified	1492
54	Ga0070688_100002318	3300005365	Bacteria	9620
55	Ga0070688_100148005	3300005365	Bacteria	1602
56	Ga0070688_100273700	3300005365	Bacteria	1210
57	Ga0070659_100090666	3300005366	Unclassified	2450
58	Ga0070667_100060012	3300005367	Bacteria	3218
59	Ga0070667_100248611	3300005367	Bacteria	1589
60	Ga0070714_100102303	3300005435	Bacteria	2525
61	Ga0070714_100573010	3300005435	Bacteria	1082
62	Ga0070710_10004142	3300005437	Bacteria	6882
63	Ga0070710_10069455	3300005437	Bacteria	2027
64	Ga0070701_10006752	3300005438	Bacteria	4851
65	Ga0070701_10097406	3300005438	Unclassified	1623
66	Ga0070711_100016762	3300005439	Bacteria	4657
67	Ga0070711_100316676	3300005439	Bacteria	1245
68	Ga0070705_100000037	3300005440	Bacteria	66783
69	Ga0070705_100031991	3300005440	Bacteria	2918
70	Ga0070705_100152755	3300005440	Bacteria	1533
71	Ga0070705_100338152	3300005440	Bacteria	1093
72	Ga0070700_100048565	3300005441	Unclassified	2630
73	Ga0070700_100078304	3300005441	Unclassified	2128
74	Ga0070700_100154916	3300005441	Bacteria	1571
75	Ga0070694_100001849	3300005444	Bacteria	12544
76	Ga0070694_100005053	3300005444	Bacteria	7961
77	Ga0070694_100027930	3300005444	Unclassified	3668
78	Ga0070708_100167535	3300005445	Bacteria	2049
79	Ga0070708_100485821	3300005445	Bacteria	1165
80	Ga0070663_100336267	3300005455	Bacteria	1218
81	Ga0070678_100061141	3300005456	Unclassified	2775
82	Ga0070678_100156526	3300005456	Bacteria	1841
83	Ga0070678_100437023	3300005456	Bacteria	1144
84	Ga0070662_100042047	3300005457	Bacteria	3263
85	Ga0070662_100403486	3300005457	Bacteria	1128
86	Ga0070681_10011610	3300005458	Bacteria	8721
87	Ga0070681_10156767	3300005458	Bacteria	2201
88	Ga0068867_100000265	3300005459	Bacteria	34503
89	Ga0068867_100057417	3300005459	Bacteria	2882
90	Ga0070685_10006396	3300005466	Bacteria	6004
91	Ga0070706_100426553	3300005467	Bacteria	1234
92	Ga0070707_100296031	3300005468	Bacteria	1572
93	Ga0070707_100732935	3300005468	Bacteria	952
94	Ga0070698_100007050	3300005471	Bacteria	12172
95	Ga0070699_100067257	3300005518	Bacteria	3111
96	Ga0070699_100073374	3300005518	Bacteria	2977
97	Ga0070699_100326259	3300005518	Bacteria	1380
98	Ga0070697_100075437	3300005536	Bacteria	2772
99	Ga0070697_100100631	3300005536	Bacteria	2401
100	Ga0070672_100109070	3300005543	Unclassified	2254
101	Ga0070672_100125057	3300005543	Unclassified	2108
102	Ga0070672_100270637	3300005543	Bacteria	1434
103	Ga0070672_100285072	3300005543	Bacteria	1397
104	Ga0070686_100006852	3300005544	Bacteria	6344
105	Ga0070686_100041422	3300005544	Unclassified	2879
106	Ga0070695_100000076	3300005545	Bacteria	40234
107	Ga0070695_100021913	3300005545	Bacteria	3915
108	Ga0070695_100133466	3300005545	Bacteria	1713
109	Ga0070696_100037438	3300005546	Bacteria	3347
110	Ga0070696_100043387	3300005546	Bacteria	3111
111	Ga0070696_100049400	3300005546	Bacteria	2922
112	Ga0070665_100412238	3300005548	Bacteria	1359
113	Ga0070665_100536359	3300005548	Unclassified	1182
114	Ga0070704_100003219	3300005549	Bacteria	9338
115	Ga0070704_100146612	3300005549	Bacteria	1850
116	Ga0068855_100187274	3300005563	Bacteria	2337
117	Ga0068855_100231546	3300005563	Bacteria	2068
118	Ga0070664_100003417	3300005564	Bacteria	12825
119	Ga0070664_100020709	3300005564	Bacteria	5417
120	Ga0070664_100051014	3300005564	Bacteria	3503
121	Ga0068857_100058120	3300005577	Bacteria	3433
122	Ga0068857_100251964	3300005577	Unclassified	1619
123	Ga0070702_100008870	3300005615	Bacteria	4893
124	Ga0070702_100240380	3300005615	Bacteria	1222
125	Ga0068852_100035006	3300005616	Bacteria	4184
126	Ga0068859_100051229	3300005617	Bacteria	4149
127	Ga0068859_100074549	3300005617	Bacteria	3432
128	Ga0068859_100754861	3300005617	Bacteria	1062
129	Ga0068864_100065047	3300005618	Unclassified	3163
130	Ga0068864_100075761	3300005618	Bacteria	2938
131	Ga0068864_100193411	3300005618	Bacteria	1866
132	Ga0068861_100241181	3300005719	Bacteria	1537
133	Ga0068861_100597081	3300005719	Bacteria	1013
134	Ga0068870_10008466	3300005840	Bacteria	4629
135	Ga0068870_10117562	3300005840	Unclassified	1527
136	Ga0068870_10152229	3300005840	Bacteria	1363
137	Ga0068863_100015735	3300005841	Bacteria	7264
138	Ga0068863_100025240	3300005841	Bacteria	5664
139	Ga0068858_100023625	3300005842	Bacteria	5727
140	Ga0068858_100355084	3300005842	Bacteria	1404
141	Ga0068860_100018406	3300005843	Bacteria	6795
142	Ga0068860_100036929	3300005843	Bacteria	4677
143	Ga0068860_100479937	3300005843	Bacteria	1239
144	Ga0068862_100001025	3300005844	Bacteria	26893
145	Ga0068862_100448039	3300005844	Bacteria	1216
146	Ga0081540_1016009	3300005983	Bacteria	4721
147	Ga0070717_10033937	3300006028	Bacteria	4121
148	Ga0070717_10428911	3300006028	Bacteria	1190
149	Ga0075432_10035624	3300006058	Bacteria	1729
150	Ga0070715_10002667	3300006163	Bacteria	5523
151	Ga0070716_100004527	3300006173	Bacteria	6657
152	Ga0075367_10066667	3300006178	Bacteria	2157
153	Ga0097621_100064661	3300006237	Bacteria	3009
154	Ga0097621_100116303	3300006237	Unclassified	2264
155	Ga0075370_10013444	3300006353	Bacteria	4351
156	Ga0068871_100102738	3300006358	Unclassified	2396
157	Ga0068871_100123264	3300006358	Bacteria	2191
158	Ga0075428_100019153	3300006844	Bacteria	7569
159	Ga0075428_100039174	3300006844	Bacteria	5216
160	Ga0075428_100078094	3300006844	Unclassified	3614
161	Ga0075428_100116582	3300006844	Bacteria	2909
162	Ga0075428_100169318	3300006844	Bacteria	2369
163	Ga0075430_100000037	3300006846	Bacteria	68528
164	Ga0075430_100000604	3300006846	Bacteria	27382
165	Ga0075431_100000232	3300006847	Bacteria	41755
166	Ga0075431_100148663	3300006847	Bacteria	2413
167	Ga0075433_10012346	3300006852	Bacteria	6895
168	Ga0075433_10013114	3300006852	Bacteria	6725
169	Ga0075433_10088952	3300006852	Bacteria	2729
170	Ga0075433_10159964	3300006852	Unclassified	2004
171	Ga0075433_10373170	3300006852	Unclassified	1260
172	Ga0075434_100017521	3300006871	Bacteria	6904
173	Ga0075434_100023969	3300006871	Bacteria	5958
174	Ga0075434_100078375	3300006871	Bacteria	3300
175	Ga0075434_100114540	3300006871	Bacteria	2709
176	Ga0075434_100170780	3300006871	Bacteria	2194
177	Ga0075434_100379450	3300006871	Bacteria	1434
178	Ga0075429_100001102	3300006880	Bacteria	21773
179	Ga0075429_100077536	3300006880	Bacteria	2895
180	Ga0075429_100233093	3300006880	Unclassified	1613
181	Ga0068865_100517303	3300006881	Bacteria	997
182	Ga0068865_100521801	3300006881	Bacteria	993
183	Ga0097620_100051227	3300006931	Bacteria	4149
184	Ga0097620_100074547	3300006931	Bacteria	3432
185	Ga0097620_100754846	3300006931	Bacteria	1062
186	Ga0075435_100005212	3300007076	Bacteria	9043
187	Ga0075435_100315241	3300007076	Bacteria	1338
188	Ga0099795_10026918	3300007788	Bacteria	1942
189	Ga0111539_10005645	3300009094	Bacteria	16180
190	Ga0111539_10007666	3300009094	Bacteria	13794
191	Ga0111539_10066749	3300009094	Bacteria	4249
192	Ga0111539_10156777	3300009094	Bacteria	2664
193	Ga0111539_10266775	3300009094	Bacteria	1993
194	Ga0105245_10391500	3300009098	Unclassified	1387
195	Ga0105247_10020369	3300009101	Bacteria	3988
196	Ga0114129_10000483	3300009147	Bacteria	48067
197	Ga0114129_10021628	3300009147	Bacteria	9130
198	Ga0114129_10158477	3300009147	Bacteria	3094
199	Ga0105243_10071592	3300009148	Bacteria	2804
200	Ga0105242_10018046	3300009176	Bacteria	5511
201	Ga0105248_10020793	3300009177	Bacteria	7271
202	Ga0105248_10145618	3300009177	Bacteria	2673
203	Ga0105237_10004145	3300009545	Bacteria	16891
204	Ga0105237_10043919	3300009545	Bacteria	4501
205	Ga0105238_10473242	3300009551	Bacteria	1251
206	Ga0105249_10005393	3300009553	Bacteria	11040
207	Ga0105249_10018155	3300009553	Bacteria	6253
208	Ga0105249_10111392	3300009553	Bacteria	2588
209	Ga0105033_107582	3300009986	Bacteria	942
210	Ga0099796_10085425	3300010159	Bacteria	1165
211	Ga0105239_10071160	3300010375	Bacteria	3821
212	Ga0105239_10302197	3300010375	Bacteria	1802
213	Ga0105239_10448818	3300010375	Bacteria	1463
214	Ga0105246_10015527	3300011119	Bacteria	4813
215	Ga0105246_10277466	3300011119	Bacteria	1343
216	Ga0157374_10167524	3300013296	Bacteria	2142
217	Ga0157374_10222027	3300013296	Bacteria	1854
218	Ga0157378_10181781	3300013297	Bacteria	1979
219	Ga0163162_10224156	3300013306	Unclassified	2009
220	Ga0157375_10011988	3300013308	Bacteria	7675
221	Ga0157375_10108593	3300013308	Bacteria	2870
222	Ga0157375_10136026	3300013308	Unclassified	2581
223	Ga0157375_10440717	3300013308	Bacteria	1468
224	Ga0157375_10574640	3300013308	Bacteria	1288
225	Ga0163163_10268313	3300014325	Unclassified	1758
226	Ga0157380_10047463	3300014326	Unclassified	3378
227	Ga0157380_10063372	3300014326	Bacteria	2964
228	Ga0157380_10332909	3300014326	Bacteria	1413
229	Ga0157380_10762236	3300014326	Bacteria	980
230	Ga0157377_10068215	3300014745	Unclassified	2049
231	Ga0157379_10064141	3300014968	Bacteria	3283
232	Ga0157379_10141236	3300014968	Unclassified	2171
233	Ga0157376_10054043	3300014969	Unclassified	3347
234	Ga0157376_10308367	3300014969	Bacteria	1501
235	Ga0157376_10343829	3300014969	Bacteria	1425
236	Ga0163161_10071905	3300017792	Unclassified	2532
237	Ga0209233_1028356	3300025261	Bacteria	1344
238	Ga0209758_1002552	3300025297	Bacteria	18364
239	Ga0207697_10001877	3300025315	Bacteria	11222
240	Ga0207697_10047687	3300025315	Unclassified	1766
241	Ga0207682_10018125	3300025893	Unclassified	2750
242	Ga0207688_10005219	3300025901	Bacteria	7060
243	Ga0207688_10015101	3300025901	Unclassified	4189
244	Ga0207688_10193378	3300025901	Bacteria	1218
245	Ga0207680_10073648	3300025903	Bacteria	2124
246	Ga0207680_10098959	3300025903	Unclassified	1870
247	Ga0207685_10020890	3300025905	Bacteria	2185
248	Ga0207699_10023876	3300025906	Bacteria	3335
249	Ga0207699_10093791	3300025906	Bacteria	1890
250	Ga0207645_10071313	3300025907	Unclassified	2223
251	Ga0207645_10249806	3300025907	Bacteria	1173
252	Ga0207643_10002552	3300025908	Bacteria	9861
253	Ga0207643_10004182	3300025908	Bacteria	7780
254	Ga0207643_10105377	3300025908	Bacteria	1657
255	Ga0207654_10029157	3300025911	Bacteria	3017
256	Ga0207654_10211790	3300025911	Bacteria	1281
257	Ga0207707_10129670	3300025912	Bacteria	2206
258	Ga0207707_10136080	3300025912	Bacteria	2148
259	Ga0207695_10000029	3300025913	Bacteria	548364
260	Ga0207671_10031647	3300025914	Bacteria	3942
261	Ga0207693_10007270	3300025915	Bacteria	9110
262	Ga0207663_10000731	3300025916	Bacteria	14688
263	Ga0207663_10359125	3300025916	Bacteria	1105
264	Ga0207649_10068451	3300025920	Bacteria	2257
265	Ga0207649_10323510	3300025920	Unclassified	1134
266	Ga0207646_10347398	3300025922	Bacteria	1340
267	Ga0207646_10604757	3300025922	Bacteria	984
268	Ga0207681_10005813	3300025923	Bacteria	7568
269	Ga0207681_10147813	3300025923	Bacteria	1757
270	Ga0207681_10184263	3300025923	Unclassified	1592
271	Ga0207694_10372916	3300025924	Bacteria	1184
272	Ga0207650_10006928	3300025925	Bacteria	7725
273	Ga0207650_10008598	3300025925	Bacteria	6971
274	Ga0207659_10067902	3300025926	Unclassified	2592
275	Ga0207700_10143467	3300025928	Bacteria	1965
276	Ga0207664_10022136	3300025929	Bacteria	4741
277	Ga0207664_10147900	3300025929	Bacteria	1993
278	Ga0207690_10175116	3300025932	Bacteria	1610
279	Ga0207706_10016592	3300025933	Bacteria	6648
280	Ga0207706_10025923	3300025933	Bacteria	5250
281	Ga0207706_10241305	3300025933	Bacteria	1580
282	Ga0207670_10096596	3300025936	Unclassified	2102
283	Ga0207669_10025533	3300025937	Unclassified	3195
284	Ga0207669_10113700	3300025937	Bacteria	1820
285	Ga0207669_10167035	3300025937	Bacteria	1562
286	Ga0207704_10095340	3300025938	Unclassified	1967
287	Ga0207704_10234692	3300025938	Bacteria	1366
288	Ga0207665_10004550	3300025939	Bacteria	9202
289	Ga0207691_10033747	3300025940	Unclassified	4765
290	Ga0207691_10148934	3300025940	Bacteria	2059
291	Ga0207711_10062488	3300025941	Unclassified	3212
292	Ga0207711_10085701	3300025941	Bacteria	2761
293	Ga0207711_10109061	3300025941	Bacteria	2460
294	Ga0207711_10382737	3300025941	Bacteria	1306
295	Ga0207689_10066789	3300025942	Bacteria	2956
296	Ga0207661_10277868	3300025944	Unclassified	1496
297	Ga0207679_10003661	3300025945	Bacteria	9525
298	Ga0207679_10012066	3300025945	Bacteria	5620
299	Ga0207679_10072067	3300025945	Unclassified	2608
300	Ga0207651_10053246	3300025960	Unclassified	2765
301	Ga0207651_10425704	3300025960	Unclassified	1134
302	Ga0207712_10006078	3300025961	Bacteria	7622
303	Ga0207712_10009260	3300025961	Bacteria	6231
304	Ga0207712_10089425	3300025961	Bacteria	2264
305	Ga0207668_10024291	3300025972	Bacteria	3909
306	Ga0207668_10479641	3300025972	Bacteria	1066
307	Ga0207658_10281130	3300025986	Unclassified	1426
308	Ga0207677_10121968	3300026023	Unclassified	1963
309	Ga0207703_10015407	3300026035	Bacteria	5963
310	Ga0207703_10046067	3300026035	Bacteria	3511
311	Ga0207703_10305591	3300026035	Bacteria	1452
312	Ga0207678_10119851	3300026067	Bacteria	2245
313	Ga0207678_10277261	3300026067	Bacteria	1438
314	Ga0207708_10002543	3300026075	Bacteria	13415
315	Ga0207708_10088347	3300026075	Unclassified	2387
316	Ga0207641_10024838	3300026088	Bacteria	4939
317	Ga0207641_10053151	3300026088	Bacteria	3432
318	Ga0207648_10000844	3300026089	Bacteria	34567
319	Ga0207648_10073503	3300026089	Bacteria	2979
320	Ga0207648_10088523	3300026089	Bacteria	2703
321	Ga0207648_10306987	3300026089	Bacteria	1424
322	Ga0207676_10016083	3300026095	Bacteria	5411
323	Ga0207676_10158312	3300026095	Bacteria	1959
324	Ga0207676_10200900	3300026095	Unclassified	1761
325	Ga0207676_10485555	3300026095	Bacteria	1171
326	Ga0207674_10009268	3300026116	Bacteria	11279
327	Ga0207674_10066320	3300026116	Bacteria	3636
328	Ga0207674_10233959	3300026116	Unclassified	1785
329	Ga0207675_100133171	3300026118	Bacteria	2357
330	Ga0207675_100255905	3300026118	Bacteria	1696
331	Ga0207675_100413538	3300026118	Unclassified	1331
332	Ga0207675_100437562	3300026118	Bacteria	1294
333	Ga0207683_10018975	3300026121	Bacteria	5868
334	Ga0207683_10033254	3300026121	Bacteria	4479
335	Ga0207683_10060983	3300026121	Unclassified	3317
336	Ga0207683_10568742	3300026121	Bacteria	1048
337	Ga0207698_10369266	3300026142	Bacteria	1361
338	Ga0207428_10000562	3300027907	Bacteria	43846
339	Ga0207428_10000756	3300027907	Bacteria	36837
340	Ga0207428_10056723	3300027907	Bacteria	3111
341	Ga0268266_10278242	3300028379	Bacteria	1555
342	Ga0268266_10749533	3300028379	Unclassified	942
343	Ga0268265_10000103	3300028380	Bacteria	106177
344	Ga0268265_10401505	3300028380	Bacteria	1267
345	Ga0268265_10571173	3300028380	Bacteria	1076
346	Ga0268264_10008258	3300028381	Bacteria	8646
347	Ga0307517_10000125	3300028786	Bacteria	115466
348	Ga0307515_10049435	3300028794	Bacteria	6327
349	Ga0265339_10111015	3300031249	Bacteria	1418
350	Ga0307508_10083434	3300031616	Bacteria	2778
351	Ga0307508_10201672	3300031616	Bacteria	1590
352	Ga0265314_10032234	3300031711	Bacteria	3856
353	Ga0265342_10007251	3300031712	Bacteria	8147
354	Ga0307516_10008146	3300031730	Bacteria	11905
355	Ga0307516_10182629	3300031730	Bacteria	1830
356	Ga0307416_100165470	3300032002	Unclassified	2051
357	Ga0307510_10019179	3300033180	Bacteria	8025
358	Ga0307510_10019844	3300033180	Bacteria	7872
359	Ga0307510_10278546	3300033180	Bacteria	1144
360	Ga0373930_0023712	3300034816	Bacteria	1222
361	Ga0373958_0042321	3300034819	Bacteria	935
362	Ga0373928_0017903	3300035084	Bacteria	1463
363	Ga0373934_0028565	3300035086	Bacteria	2175
364	Ga0373932_0034164	3300035112	Bacteria	1431
365	Ga0373953_0024593	3300035117	Bacteria	2291
366	Ga0373943_0065628	3300035170	Bacteria	1826
367	Ga0373962_0051217	3300035242	Bacteria	1191
368	Ga0373931_0094086	3300035691	Unclassified	1675
369	Ga0373927_0031030	3300035695	Bacteria	3486
370	Ga0373933_0049929	3300035724	Bacteria	2495
371	Ga0373937_0006601	3300036401	Bacteria	10020
372	Ga0466966_0035594	3300044684	Bacteria	3216
373	Ga0466966_0281191	3300044684	Bacteria	1001
374	Ga0466970_0053814	3300044765	Bacteria	2150
375	Ga0466959_0112372	3300045049	Bacteria	1943
376	Ga0451576_0021043	3300045051	Bacteria	7096
377	Ga0451576_0021972	3300045051	Bacteria	6928
378	Ga0451576_0059191	3300045051	Unclassified	4000
379	Ga0451576_0136179	3300045051	Bacteria	2561
380	Ga0451576_0390189	3300045051	Bacteria	1459
381	Ga0495617_009998	3300046452	Bacteria	3252
382	Ga0495592_0019278	3300046454	Bacteria	5189
383	Ga0495603_0010168	3300046455	Bacteria	5693
384	Ga0495641_0018213	3300046461	Bacteria	3630
385	Ga0495651_0000472	3300046462	Bacteria	30989
386	Ga0495651_0053977	3300046462	Bacteria	3092
387	Ga0495651_0074512	3300046462	Bacteria	2575
388	Ga0495653_0033579	3300046463	Bacteria	4064
389	Ga0495585_0184660	3300046492	Bacteria	1070
390	Ga0495594_0126512	3300046499	Bacteria	1446
391	Ga0495594_0170452	3300046499	Bacteria	1238
392	Ga0495606_0005996	3300046507	Bacteria	11391
393	Ga0495608_0015545	3300046511	Bacteria	5276
394	Ga0495608_0038875	3300046511	Bacteria	3192
395	Ga0495618_0052860	3300046514	Bacteria	2568
396	Ga0495628_0094894	3300046516	Bacteria	2305
397	Ga0495644_0088742	3300046523	Bacteria	1166
398	Ga0495648_0003979	3300046524	Bacteria	12789
399	Ga0495652_0001339	3300046529	Bacteria	27421
400	Ga0495654_0169849	3300046530	Bacteria	951
401	Ga0495640_0021032	3300046533	Bacteria	4796
402	Ga0495586_0157641	3300046535	Bacteria	1279
403	Ga0495598_0019496	3300046537	Bacteria	1780
404	Ga0495598_0147010	3300046537	Bacteria	820
405	Ga0495621_0002267	3300046539	Bacteria	5148
406	Ga0495621_0044774	3300046539	Bacteria	1565
407	Ga0495621_0088085	3300046539	Bacteria	1167
408	Ga0495645_0053286	3300046543	Bacteria	2941
409	Ga0495633_0050936	3300046558	Bacteria	1951
410	Ga0495667_0007621	3300046559	Bacteria	7343
411	Ga0495656_0047080	3300046615	Bacteria	1827
412	Ga0495656_0197761	3300046615	Unclassified	996
413	Ga0495668_0089715	3300046616	Bacteria	1684
414	Ga0495668_0194190	3300046616	Bacteria	1112
415	Ga0495611_0040804	3300046648	Bacteria	2069
416	Ga0495625_0043521	3300046660	Bacteria	3256
417	Ga0495659_0003429	3300046664	Bacteria	5062
418	Ga0495659_0007709	3300046664	Bacteria	3413
419	Ga0495659_0009795	3300046664	Bacteria	3066
420	Ga0495657_0017708	3300046675	Bacteria	5168
421	Ga0495599_0065194	3300046678	Bacteria	2275
422	Ga0495599_0077133	3300046678	Bacteria	2080
423	Ga0495623_0014703	3300046679	Bacteria	5062
424	Ga0495623_0024183	3300046679	Bacteria	3918
425	Ga0495646_0019648	3300046680	Bacteria	4274
426	Ga0495646_0068097	3300046680	Bacteria	2102
427	Ga0495649_0142508	3300046694	Bacteria	1261
428	Ga0495600_0006605	3300046809	Bacteria	7066
429	Ga0495600_0014498	3300046809	Bacteria	4967
430	Ga0495604_0000953	3300047317	Bacteria	24133
431	Ga0495604_0003783	3300047317	Bacteria	12039
432	Ga0495636_0015814	3300047318	Unclassified	3008
433	Ga0495636_0026672	3300047318	Unclassified	2351
434	Ga0495674_0028690	3300047319	Bacteria	5069
435	Ga0495674_0035224	3300047319	Bacteria	4517
436	Ga0495674_0195936	3300047319	Bacteria	1678
437	Ga0495672_0182354	3300047320	Bacteria	1062
438	Ga0495680_0001642	3300047322	Bacteria	23759
439	Ga0495680_0018296	3300047322	Bacteria	5953
440	Ga0495677_0054590	3300047445	Bacteria	1474
441	Ga0495677_0063963	3300047445	Bacteria	1367
442	Ga0495685_027770	3300047447	Bacteria	1947
443	Ga0495673_0096999	3300047469	Bacteria	1197
444	Ga0495684_0154186	3300047471	Bacteria	1716
445	Ga0495593_0097084	3300047673	Bacteria	1514
446	Ga0495602_0040712	3300048088	Bacteria	4255
447	Ga0496100_0348243	3300048903	Bacteria	1118
448	Ga0496102_0298867	3300048905	Bacteria	1517
449	Ga0496106_0018582	3300048909	Bacteria	5144
450	Ga0496106_0705915	3300048909	Unclassified	804
451	Ga0496107_0141865	3300048910	Bacteria	1776
452	Ga0496109_0015451	3300048912	Bacteria	6654
453	Ga0496110_0071507	3300048913	Bacteria	3076
454	Ga0496110_0233300	3300048913	Bacteria	1674
455	Ga0496112_0004436	3300048915	Bacteria	11886
456	Ga0496112_0191766	3300048915	Bacteria	2005
457	Ga0496113_0007091	3300048916	Bacteria	7174
458	Ga0496113_0055207	3300048916	Bacteria	2977
459	Ga0496114_0007466	3300048917	Bacteria	8643
460	Ga0496114_0174689	3300048917	Bacteria	1874
461	Ga0496114_0250148	3300048917	Bacteria	1560
462	Ga0496115_0175551	3300048918	Bacteria	1771
463	Ga0496115_0304641	3300048918	Bacteria	1305
464	Ga0496115_0501167	3300048918	Bacteria	976
465	Ga0496117_0104561	3300048920	Bacteria	1782
466	Ga0496118_0028123	3300048921	Bacteria	4743
467	Ga0496118_0113712	3300048921	Bacteria	1787
468	Ga0496118_0116302	3300048921	Bacteria	1758
469	Ga0496119_0165914	3300048922	Bacteria	1170
470	Ga0496121_0004775	3300048924	Bacteria	17874
471	Ga0496121_0270362	3300048924	Bacteria	1168
472	Ga0496125_0169709	3300048928	Bacteria	1469
473	Ga0496126_0013618	3300048929	Bacteria	8256
474	Ga0496126_0051233	3300048929	Bacteria	3759
475	Ga0496126_0117017	3300048929	Bacteria	2316
476	Ga0496126_0198682	3300048929	Bacteria	1694
477	Ga0501067_0057288	3300049583	Bacteria	2158
478	Ga0501068_0037779	3300049584	Bacteria	2891
479	Ga0501073_0121214	3300049589	Bacteria	1812
480	Ga0501083_0168819	3300049744	Bacteria	1431
481	Ga0501044_0093205	3300049823	Bacteria	3037
482	nmdc:mga03n38_22382_c1	3300050490	Bacteria	2557
483	nmdc:mga0k408_362463_c1	3300050493	Bacteria	864
484	nmdc:mga06z11_76103_c1	3300050494	Bacteria	1789
485	nmdc:mga05p37_40324_c1	3300050507	Bacteria	5733
486	nmdc:mga05p37_54843_c1	3300050507	Bacteria	4903
487	nmdc:mga05p37_75062_c1	3300050507	Bacteria	4162
488	nmdc:mga09592_317576_c1	3300050508	Bacteria	1350
489	nmdc:mga09592_3746_c1	3300050508	Bacteria	12253
490	nmdc:mga09592_48830_c1	3300050508	Bacteria	3568
491	nmdc:mga0qj67_34_c1	3300050509	Bacteria	96663
492	nmdc:mga0qj67_429_c1	3300050509	Bacteria	28714
493	nmdc:mga06r32_479428_c1	3300050510	Bacteria	1222
494	nmdc:mga06r32_548163_c1	3300050510	Bacteria	1130
495	nmdc:mga06r32_567731_c1	3300050510	Bacteria	1107
496	nmdc:mga06r32_733_c1	3300050510	Bacteria	28793
497	nmdc:mga08y16_1714_c1	3300050511	Bacteria	22252
498	nmdc:mga08y16_547370_c1	3300050511	Bacteria	1171
499	nmdc:mga08y16_7480_c1	3300050511	Bacteria	11440
500	nmdc:mga0n895_113242_c1	3300050512	Bacteria	2730
501	nmdc:mga0n895_1694_c1	3300050512	Bacteria	16655
502	nmdc:mga0n895_217999_c1	3300050512	Bacteria	1938
503	nmdc:mga0n895_2654_c1	3300050512	Bacteria	14111
504	nmdc:mga0rr50_33479_c1	3300050513	Bacteria	3671
505	nmdc:mga0rr50_5638_c1	3300050513	Bacteria	7497
506	nmdc:mga0a205_111658_c1	3300050515	Bacteria	2633
507	nmdc:mga0a205_1435_c1	3300050515	Bacteria	20264
508	nmdc:mga0a205_4288_c2	3300050515	Unclassified	4202
509	nmdc:mga0a205_663800_c1	3300050515	Bacteria	894
510	nmdc:mga0a205_72752_c1	3300050515	Bacteria	3321
511	Ga0495595_0032104	3300053084	Bacteria	2364
512	Ga0495619_0096874	3300053085	Bacteria	2003
513	Ga0500651_0002950	3300053093	Bacteria	9157
514	Ga0500641_0045013	3300053096	Bacteria	1796
515	Ga0500569_023120	3300053109	Bacteria	1666
516	Ga0500594_0065832	3300053118	Bacteria	1055
517	Ga0500595_056467	3300053119	Bacteria	1199
518	Ga0500655_046974	3300053133	Bacteria	855
519	Ga0500634_0183532	3300053161	Bacteria	938
520	Ga0500636_0047538	3300053177	Bacteria	2527
521	Ga0500645_084040	3300053730	Bacteria	907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006880	Ga0075429_100001102	Ga0075429_1000011027	214
2	3300005518	Ga0070699_100326259	Ga0070699_1003262592	229
3	3300006846	Ga0075430_100000037	Ga0075430_10000003711	229
4	3300014326	Ga0157380_10762236	Ga0157380_107622362	229
5	3300028380	Ga0268265_10401505	Ga0268265_104015052	229
6	3300032002	Ga0307416_100165470	Ga0307416_1001654702	229
7	3300035691	Ga0373931_0094086	Ga0373931_0094086_778_1500	229
8	3300046537	Ga0495598_0147010	Ga0495598_0147010_22_750	229
9	3300048909	Ga0496106_0705915	Ga0496106_0705915_42_764	229
10	3300050509	nmdc:mga0qj67_34_c1	nmdc:mga0qj67_34_c1_56171_56893	229
11	3300050510	nmdc:mga06r32_479428_c1	nmdc:mga06r32_479428_c1_227_949	229
12	3300053730	Ga0500645_084040	Ga0500645_084040_86_808	229
13	3300005336	Ga0070680_100327467	Ga0070680_1003274672	231
14	3300026089	Ga0207648_10088523	Ga0207648_100885234	231
15	3300009986	Ga0105033_107582	Ga0105033_1075822	232
16	3300050510	nmdc:mga06r32_548163_c1	nmdc:mga06r32_548163_c1_339_1079	234
17	3300009147	Ga0114129_10000483	Ga0114129_1000048334	241
18	3300034819	Ga0373958_0042321	Ga0373958_0042321_41_775	241
19	3300050507	nmdc:mga05p37_40324_c1	nmdc:mga05p37_40324_c1_2487_3317	241
20	3300005618	Ga0068864_100193411	Ga0068864_1001934113	243
21	3300025922	Ga0207646_10604757	Ga0207646_106047571	243
22	3300046664	Ga0495659_0003429	Ga0495659_0003429_3903_4733	243
23	3300005458	Ga0070681_10011610	Ga0070681_100116104	245
24	3300025912	Ga0207707_10136080	Ga0207707_101360803	245
25	3300049583	Ga0501067_0057288	Ga0501067_0057288_250_1071	245
26	3300049584	Ga0501068_0037779	Ga0501068_0037779_1924_2745	245
27	3300049589	Ga0501073_0121214	Ga0501073_0121214_127_948	245
28	3300049823	Ga0501044_0093205	Ga0501044_0093205_375_1196	245
29	3300005456	Ga0070678_100437023	Ga0070678_1004370232	246
30	3300005616	Ga0068852_100035006	Ga0068852_1000350063	246
31	3300009545	Ga0105237_10004145	Ga0105237_1000414511	246
32	3300010375	Ga0105239_10448818	Ga0105239_104488182	246
33	3300025261	Ga0209233_1028356	Ga0209233_10283561	246
34	3300025911	Ga0207654_10211790	Ga0207654_102117902	246
35	3300025913	Ga0207695_10000029	Ga0207695_1000002942	246
36	3300026142	Ga0207698_10369266	Ga0207698_103692662	246
37	3300044684	Ga0466966_0281191	Ga0466966_0281191_180_977	246
38	3300044765	Ga0466970_0053814	Ga0466970_0053814_835_1632	246
39	3300046507	Ga0495606_0005996	Ga0495606_0005996_2083_2874	246
40	3300046524	Ga0495648_0003979	Ga0495648_0003979_1425_2216	246
41	3300046660	Ga0495625_0043521	Ga0495625_0043521_2313_3104	246
42	3300046694	Ga0495649_0142508	Ga0495649_0142508_354_1145	246
43	3300047469	Ga0495673_0096999	Ga0495673_0096999_331_1122	246
44	3300048929	Ga0496126_0117017	Ga0496126_0117017_1240_2031	246
45	3300005347	Ga0070668_100033764	Ga0070668_1000337645	247
46	3300005548	Ga0070665_100412238	Ga0070665_1004122382	247
47	3300005563	Ga0068855_100231546	Ga0068855_1002315463	247
48	3300005617	Ga0068859_100754861	Ga0068859_1007548612	247
49	3300005618	Ga0068864_100075761	Ga0068864_1000757613	247
50	3300005840	Ga0068870_10152229	Ga0068870_101522292	247
51	3300006178	Ga0075367_10066667	Ga0075367_100666673	247
52	3300006237	Ga0097621_100064661	Ga0097621_1000646612	247
53	3300006358	Ga0068871_100123264	Ga0068871_1001232642	247
54	3300006931	Ga0097620_100754846	Ga0097620_1007548462	247
55	3300010375	Ga0105239_10302197	Ga0105239_103021973	247
56	3300013297	Ga0157378_10181781	Ga0157378_101817812	247
57	3300025911	Ga0207654_10029157	Ga0207654_100291573	247
58	3300025914	Ga0207671_10031647	Ga0207671_100316474	247
59	3300025924	Ga0207694_10372916	Ga0207694_103729162	247
60	3300025937	Ga0207669_10167035	Ga0207669_101670352	247
61	3300025941	Ga0207711_10085701	Ga0207711_100857013	247
62	3300026035	Ga0207703_10015407	Ga0207703_100154075	247
63	3300026067	Ga0207678_10119851	Ga0207678_101198512	247
64	3300026121	Ga0207683_10033254	Ga0207683_100332544	247
65	3300028380	Ga0268265_10571173	Ga0268265_105711732	247
66	3300046615	Ga0495656_0047080	Ga0495656_0047080_336_1115	247
67	3300048903	Ga0496100_0348243	Ga0496100_0348243_324_1103	247
68	3300048905	Ga0496102_0298867	Ga0496102_0298867_296_1075	247
69	3300048913	Ga0496110_0233300	Ga0496110_0233300_418_1197	247
70	3300048929	Ga0496126_0198682	Ga0496126_0198682_622_1401	247
71	3300050493	nmdc:mga0k408_362463_c1	nmdc:mga0k408_362463_c1_31_810	247
72	3300028786	Ga0307517_10000125	Ga0307517_10000125128	248
73	3300028794	Ga0307515_10049435	Ga0307515_100494352	248
74	3300033180	Ga0307510_10278546	Ga0307510_102785461	248
75	3300045051	Ga0451576_0021972	Ga0451576_0021972_4600_5433	248
76	iso_pu_bacteria	3005710791	3005713553	248
77	3300005983	Ga0081540_1016009	Ga0081540_10160094	249
78	3300009101	Ga0105247_10020369	Ga0105247_100203694	249
79	3300031730	Ga0307516_10008146	Ga0307516_100081464	249
80	3300046452	Ga0495617_009998	Ga0495617_009998_1048_1833	249
81	3300046461	Ga0495641_0018213	Ga0495641_0018213_474_1259	249
82	3300046499	Ga0495594_0126512	Ga0495594_0126512_36_821	249
83	3300046499	Ga0495594_0170452	Ga0495594_0170452_246_1031	249
84	3300046537	Ga0495598_0019496	Ga0495598_0019496_118_903	249
85	3300046539	Ga0495621_0044774	Ga0495621_0044774_244_1029	249
86	3300046558	Ga0495633_0050936	Ga0495633_0050936_247_1032	249
87	3300046616	Ga0495668_0089715	Ga0495668_0089715_634_1419	249
88	3300048917	Ga0496114_0174689	Ga0496114_0174689_675_1460	249
89	3300053096	Ga0500641_0045013	Ga0500641_0045013_424_1209	249
90	3300053118	Ga0500594_0065832	Ga0500594_0065832_91_876	249
91	3300053133	Ga0500655_046974	Ga0500655_046974_42_827	249
92	3300053177	Ga0500636_0047538	Ga0500636_0047538_43_828	249
93	iso_pu_bacteria	2513237104	2513721930	250
94	3300005458	Ga0070681_10156767	Ga0070681_101567671	251
95	3300005563	Ga0068855_100187274	Ga0068855_1001872742	251
96	3300006028	Ga0070717_10428911	Ga0070717_104289112	251
97	3300025912	Ga0207707_10129670	Ga0207707_101296703	251
98	3300026095	Ga0207676_10485555	Ga0207676_104855552	251
99	3300005331	Ga0070670_100005344	Ga0070670_1000053446	252
100	3300005340	Ga0070689_100032612	Ga0070689_1000326125	252
101	3300005344	Ga0070661_100043765	Ga0070661_1000437654	252
102	3300005353	Ga0070669_100121269	Ga0070669_1001212692	252
103	3300005354	Ga0070675_100014055	Ga0070675_1000140551	252
104	3300005364	Ga0070673_100096389	Ga0070673_1000963894	252
105	3300005365	Ga0070688_100148005	Ga0070688_1001480053	252
106	3300005438	Ga0070701_10006752	Ga0070701_100067522	252
107	3300005444	Ga0070694_100027930	Ga0070694_1000279305	252
108	3300005445	Ga0070708_100485821	Ga0070708_1004858211	252
109	3300005459	Ga0068867_100000265	Ga0068867_10000026518	252
110	3300005544	Ga0070686_100041422	Ga0070686_1000414222	252
111	3300005840	Ga0068870_10117562	Ga0068870_101175623	252
112	3300006881	Ga0068865_100521801	Ga0068865_1005218012	252
113	3300009094	Ga0111539_10007666	Ga0111539_100076665	252
114	3300009553	Ga0105249_10018155	Ga0105249_100181555	252
115	3300011119	Ga0105246_10277466	Ga0105246_102774662	252
116	3300013308	Ga0157375_10011988	Ga0157375_100119889	252
117	3300014969	Ga0157376_10343829	Ga0157376_103438292	252
118	3300025933	Ga0207706_10241305	Ga0207706_102413053	252
119	3300025941	Ga0207711_10062488	Ga0207711_100624885	252
120	3300026118	Ga0207675_100133171	Ga0207675_1001331713	252
121	3300045051	Ga0451576_0059191	Ga0451576_0059191_1299_2126	252
122	3300046455	Ga0495603_0010168	Ga0495603_0010168_1054_1875	252
123	3300046664	Ga0495659_0009795	Ga0495659_0009795_773_1603	252
124	3300047318	Ga0495636_0026672	Ga0495636_0026672_1314_2144	252
125	3300050508	nmdc:mga09592_317576_c1	nmdc:mga09592_317576_c1_204_1034	252
126	3300050511	nmdc:mga08y16_1714_c1	nmdc:mga08y16_1714_c1_20035_20865	252
127	3300009094	Ga0111539_10066749	Ga0111539_100667495	253
128	3300046462	Ga0495651_0000472	Ga0495651_0000472_15535_16362	253
129	3300046463	Ga0495653_0033579	Ga0495653_0033579_1342_2169	253
130	3300046511	Ga0495608_0015545	Ga0495608_0015545_1907_2734	253
131	3300046529	Ga0495652_0001339	Ga0495652_0001339_16110_16937	253
132	3300046533	Ga0495640_0021032	Ga0495640_0021032_50_877	253
133	3300046543	Ga0495645_0053286	Ga0495645_0053286_132_959	253
134	3300046559	Ga0495667_0007621	Ga0495667_0007621_5763_6590	253
135	3300046678	Ga0495599_0077133	Ga0495599_0077133_970_1797	253
136	3300046679	Ga0495623_0024183	Ga0495623_0024183_3003_3830	253
137	3300046680	Ga0495646_0068097	Ga0495646_0068097_1170_1997	253
138	3300046809	Ga0495600_0006605	Ga0495600_0006605_5775_6602	253
139	3300047317	Ga0495604_0000953	Ga0495604_0000953_12088_12915	253
140	3300047319	Ga0495674_0035224	Ga0495674_0035224_3178_4005	253
141	3300047322	Ga0495680_0001642	Ga0495680_0001642_21348_22175	253
142	3300048088	Ga0495602_0040712	Ga0495602_0040712_1105_1932	253
143	3300053084	Ga0495595_0032104	Ga0495595_0032104_744_1571	253
144	3300005328	Ga0070676_10245569	Ga0070676_102455691	254
145	3300005353	Ga0070669_100014926	Ga0070669_1000149265	254
146	3300005365	Ga0070688_100273700	Ga0070688_1002737002	254
147	3300005543	Ga0070672_100109070	Ga0070672_1001090703	254
148	3300005549	Ga0070704_100003219	Ga0070704_10000321911	254
149	3300005564	Ga0070664_100051014	Ga0070664_1000510145	254
150	3300005577	Ga0068857_100058120	Ga0068857_1000581202	254
151	3300005617	Ga0068859_100051229	Ga0068859_1000512295	254
152	3300005618	Ga0068864_100065047	Ga0068864_1000650471	254
153	3300005842	Ga0068858_100355084	Ga0068858_1003550842	254
154	3300005843	Ga0068860_100018406	Ga0068860_1000184068	254
155	3300005844	Ga0068862_100448039	Ga0068862_1004480392	254
156	3300006844	Ga0075428_100078094	Ga0075428_1000780944	254
157	3300006880	Ga0075429_100233093	Ga0075429_1002330933	254
158	3300006881	Ga0068865_100517303	Ga0068865_1005173031	254
159	3300006931	Ga0097620_100051227	Ga0097620_1000512275	254
160	3300013296	Ga0157374_10167524	Ga0157374_101675242	254
161	3300025908	Ga0207643_10002552	Ga0207643_1000255211	254
162	3300025908	Ga0207643_10105377	Ga0207643_101053772	254
163	3300025920	Ga0207649_10323510	Ga0207649_103235102	254
164	3300025923	Ga0207681_10005813	Ga0207681_100058132	254
165	3300025925	Ga0207650_10006928	Ga0207650_100069287	254
166	3300025945	Ga0207679_10012066	Ga0207679_100120664	254
167	3300025961	Ga0207712_10009260	Ga0207712_100092605	254
168	3300026035	Ga0207703_10046067	Ga0207703_100460674	254
169	3300026089	Ga0207648_10000844	Ga0207648_1000084418	254
170	3300026095	Ga0207676_10158312	Ga0207676_101583121	254
171	3300026116	Ga0207674_10009268	Ga0207674_100092683	254
172	3300026116	Ga0207674_10066320	Ga0207674_100663205	254
173	3300027907	Ga0207428_10000562	Ga0207428_1000056233	254
174	3300028380	Ga0268265_10000103	Ga0268265_10000103107	254
175	3300028381	Ga0268264_10008258	Ga0268264_100082589	254
176	3300031616	Ga0307508_10083434	Ga0307508_100834342	254
177	3300033180	Ga0307510_10019844	Ga0307510_100198449	254
178	3300044684	Ga0466966_0035594	Ga0466966_0035594_2077_2877	254
179	3300045049	Ga0466959_0112372	Ga0466959_0112372_933_1733	254
180	3300050510	nmdc:mga06r32_567731_c1	nmdc:mga06r32_567731_c1_49_816	254
181	3300005435	Ga0070714_100102303	Ga0070714_1001023034	255
182	3300005437	Ga0070710_10069455	Ga0070710_100694553	255
183	3300005719	Ga0068861_100597081	Ga0068861_1005970811	255
184	3300009098	Ga0105245_10391500	Ga0105245_103915002	255
185	3300009177	Ga0105248_10145618	Ga0105248_101456182	255
186	3300014968	Ga0157379_10064141	Ga0157379_100641415	255
187	3300025906	Ga0207699_10093791	Ga0207699_100937913	255
188	3300025929	Ga0207664_10147900	Ga0207664_101479002	255
189	3300025941	Ga0207711_10109061	Ga0207711_101090613	255
190	3300026118	Ga0207675_100413538	Ga0207675_1004135382	255
191	3300031730	Ga0307516_10182629	Ga0307516_101826292	255
192	3300036401	Ga0373937_0006601	Ga0373937_0006601_2887_3723	255
193	3300046462	Ga0495651_0074512	Ga0495651_0074512_430_1266	255
194	3300048920	Ga0496117_0104561	Ga0496117_0104561_370_1173	255
195	3300048929	Ga0496126_0051233	Ga0496126_0051233_1262_2065	255
196	3300053093	Ga0500651_0002950	Ga0500651_0002950_7396_8199	255
197	3300053119	Ga0500595_056467	Ga0500595_056467_23_826	255
198	3300009147	Ga0114129_10158477	Ga0114129_101584773	256
199	3300009176	Ga0105242_10018046	Ga0105242_100180464	256
200	3300009177	Ga0105248_10020793	Ga0105248_100207934	256
201	3300010375	Ga0105239_10071160	Ga0105239_100711602	256
202	3300013308	Ga0157375_10108593	Ga0157375_101085932	256
203	3300013308	Ga0157375_10440717	Ga0157375_104407172	256
204	3300014326	Ga0157380_10332909	Ga0157380_103329092	256
205	3300025916	Ga0207663_10359125	Ga0207663_103591252	256
206	3300026089	Ga0207648_10306987	Ga0207648_103069872	256
207	3300034816	Ga0373930_0023712	Ga0373930_0023712_20_835	256
208	3300035084	Ga0373928_0017903	Ga0373928_0017903_196_1011	256
209	3300035112	Ga0373932_0034164	Ga0373932_0034164_107_922	256
210	3300035170	Ga0373943_0065628	Ga0373943_0065628_838_1653	256
211	3300035242	Ga0373962_0051217	Ga0373962_0051217_146_961	256
212	3300035695	Ga0373927_0031030	Ga0373927_0031030_1156_1971	256
213	3300045051	Ga0451576_0390189	Ga0451576_0390189_422_1255	256
214	3300046616	Ga0495668_0194190	Ga0495668_0194190_16_834	256
215	3300047318	Ga0495636_0015814	Ga0495636_0015814_1367_2185	256
216	3300047445	Ga0495677_0054590	Ga0495677_0054590_432_1250	256
217	3300047447	Ga0495685_027770	Ga0495685_027770_848_1666	256
218	3300048909	Ga0496106_0018582	Ga0496106_0018582_326_1141	256
219	3300048912	Ga0496109_0015451	Ga0496109_0015451_4440_5255	256
220	3300048913	Ga0496110_0071507	Ga0496110_0071507_39_854	256
221	3300048915	Ga0496112_0004436	Ga0496112_0004436_2847_3662	256
222	3300048916	Ga0496113_0007091	Ga0496113_0007091_4487_5302	256
223	3300048917	Ga0496114_0007466	Ga0496114_0007466_2016_2831	256
224	3300048918	Ga0496115_0175551	Ga0496115_0175551_106_921	256
225	3300048921	Ga0496118_0028123	Ga0496118_0028123_965_1771	256
226	3300048921	Ga0496118_0113712	Ga0496118_0113712_131_928	256
227	3300048922	Ga0496119_0165914	Ga0496119_0165914_43_840	256
228	3300048924	Ga0496121_0004775	Ga0496121_0004775_4033_4839	256
229	3300048924	Ga0496121_0270362	Ga0496121_0270362_327_1124	256
230	3300050507	nmdc:mga05p37_54843_c1	nmdc:mga05p37_54843_c1_2952_3773	256
231	3300050512	nmdc:mga0n895_217999_c1	nmdc:mga0n895_217999_c1_18_839	256
232	3300050515	nmdc:mga0a205_663800_c1	nmdc:mga0a205_663800_c1_18_839	256
233	3300050515	nmdc:mga0a205_72752_c1	nmdc:mga0a205_72752_c1_833_1663	256
234	3300005328	Ga0070676_10137908	Ga0070676_101379081	257
235	3300005330	Ga0070690_100088734	Ga0070690_1000887343	257
236	3300005337	Ga0070682_100113588	Ga0070682_1001135883	257
237	3300005338	Ga0068868_100097123	Ga0068868_1000971233	257
238	3300005341	Ga0070691_10285744	Ga0070691_102857441	257
239	3300005435	Ga0070714_100573010	Ga0070714_1005730101	257
240	3300005437	Ga0070710_10004142	Ga0070710_100041421	257
241	3300005439	Ga0070711_100016762	Ga0070711_1000167624	257
242	3300005439	Ga0070711_100316676	Ga0070711_1003166762	257
243	3300005440	Ga0070705_100000037	Ga0070705_10000003721	257
244	3300005440	Ga0070705_100031991	Ga0070705_1000319913	257
245	3300005440	Ga0070705_100152755	Ga0070705_1001527553	257
246	3300005444	Ga0070694_100001849	Ga0070694_10000184910	257
247	3300005444	Ga0070694_100005053	Ga0070694_1000050538	257
248	3300005445	Ga0070708_100167535	Ga0070708_1001675353	257
249	3300005455	Ga0070663_100336267	Ga0070663_1003362672	257
250	3300005468	Ga0070707_100296031	Ga0070707_1002960311	257
251	3300005468	Ga0070707_100732935	Ga0070707_1007329351	257
252	3300005471	Ga0070698_100007050	Ga0070698_1000070509	257
253	3300005518	Ga0070699_100067257	Ga0070699_1000672573	257
254	3300005518	Ga0070699_100073374	Ga0070699_1000733743	257
255	3300005545	Ga0070695_100000076	Ga0070695_10000007634	257
256	3300005546	Ga0070696_100037438	Ga0070696_1000374381	257
257	3300005546	Ga0070696_100043387	Ga0070696_1000433873	257
258	3300005546	Ga0070696_100049400	Ga0070696_1000494003	257
259	3300005549	Ga0070704_100146612	Ga0070704_1001466123	257
260	3300005615	Ga0070702_100008870	Ga0070702_1000088703	257
261	3300006028	Ga0070717_10033937	Ga0070717_100339371	257
262	3300006163	Ga0070715_10002667	Ga0070715_100026675	257
263	3300006173	Ga0070716_100004527	Ga0070716_1000045277	257
264	3300006852	Ga0075433_10012346	Ga0075433_100123467	257
265	3300006871	Ga0075434_100114540	Ga0075434_1001145403	257
266	3300007788	Ga0099795_10026918	Ga0099795_100269182	257
267	3300009148	Ga0105243_10071592	Ga0105243_100715924	257
268	3300009545	Ga0105237_10043919	Ga0105237_100439193	257
269	3300009551	Ga0105238_10473242	Ga0105238_104732422	257
270	3300010159	Ga0099796_10085425	Ga0099796_100854251	257
271	3300013296	Ga0157374_10222027	Ga0157374_102220272	257
272	3300014969	Ga0157376_10308367	Ga0157376_103083672	257
273	3300025297	Ga0209758_1002552	Ga0209758_10025525	257
274	3300025901	Ga0207688_10193378	Ga0207688_101933781	257
275	3300025905	Ga0207685_10020890	Ga0207685_100208902	257
276	3300025906	Ga0207699_10023876	Ga0207699_100238761	257
277	3300025915	Ga0207693_10007270	Ga0207693_100072701	257
278	3300025916	Ga0207663_10000731	Ga0207663_1000073116	257
279	3300025922	Ga0207646_10347398	Ga0207646_103473982	257
280	3300025928	Ga0207700_10143467	Ga0207700_101434671	257
281	3300025929	Ga0207664_10022136	Ga0207664_100221365	257
282	3300025939	Ga0207665_10004550	Ga0207665_100045509	257
283	3300031249	Ga0265339_10111015	Ga0265339_101110153	257
284	3300031616	Ga0307508_10201672	Ga0307508_102016723	257
285	3300031711	Ga0265314_10032234	Ga0265314_100322344	257
286	3300031712	Ga0265342_10007251	Ga0265342_100072518	257
287	3300035086	Ga0373934_0028565	Ga0373934_0028565_969_1886	257
288	3300035117	Ga0373953_0024593	Ga0373953_0024593_574_1428	257
289	3300035724	Ga0373933_0049929	Ga0373933_0049929_904_1821	257
290	3300046454	Ga0495592_0019278	Ga0495592_0019278_2872_3789	257
291	3300046462	Ga0495651_0053977	Ga0495651_0053977_1564_2418	257
292	3300046511	Ga0495608_0038875	Ga0495608_0038875_147_1001	257
293	3300046514	Ga0495618_0052860	Ga0495618_0052860_560_1414	257
294	3300046516	Ga0495628_0094894	Ga0495628_0094894_824_1678	257
295	3300046535	Ga0495586_0157641	Ga0495586_0157641_203_1120	257
296	3300046675	Ga0495657_0017708	Ga0495657_0017708_4086_5003	257
297	3300046678	Ga0495599_0065194	Ga0495599_0065194_488_1342	257
298	3300046679	Ga0495623_0014703	Ga0495623_0014703_3566_4483	257
299	3300046680	Ga0495646_0019648	Ga0495646_0019648_1085_1939	257
300	3300046809	Ga0495600_0014498	Ga0495600_0014498_3133_4050	257
301	3300047317	Ga0495604_0003783	Ga0495604_0003783_3062_3979	257
302	3300047319	Ga0495674_0028690	Ga0495674_0028690_194_1048	257
303	3300047319	Ga0495674_0195936	Ga0495674_0195936_56_925	257
304	3300047322	Ga0495680_0018296	Ga0495680_0018296_3978_4895	257
305	3300047471	Ga0495684_0154186	Ga0495684_0154186_21_938	257
306	3300047673	Ga0495593_0097084	Ga0495593_0097084_135_989	257
307	3300048915	Ga0496112_0191766	Ga0496112_0191766_267_1103	257
308	3300048916	Ga0496113_0055207	Ga0496113_0055207_1102_1938	257
309	3300048917	Ga0496114_0250148	Ga0496114_0250148_403_1251	257
310	3300048918	Ga0496115_0304641	Ga0496115_0304641_373_1191	257
311	3300048918	Ga0496115_0501167	Ga0496115_0501167_101_937	257
312	3300048921	Ga0496118_0116302	Ga0496118_0116302_233_1069	257
313	3300048928	Ga0496125_0169709	Ga0496125_0169709_102_929	257
314	3300048929	Ga0496126_0013618	Ga0496126_0013618_13_831	257
315	3300050490	nmdc:mga03n38_22382_c1	nmdc:mga03n38_22382_c1_1269_2105	257
316	3300050494	nmdc:mga06z11_76103_c1	nmdc:mga06z11_76103_c1_941_1777	257
317	3300050511	nmdc:mga08y16_547370_c1	nmdc:mga08y16_547370_c1_206_1042	257
318	3300050515	nmdc:mga0a205_111658_c1	nmdc:mga0a205_111658_c1_185_1006	257
319	3300053085	Ga0495619_0096874	Ga0495619_0096874_16_870	257
320	3300005341	Ga0070691_10046446	Ga0070691_100464463	258
321	3300005345	Ga0070692_10073426	Ga0070692_100734264	258
322	3300005356	Ga0070674_100457103	Ga0070674_1004571032	258
323	3300005441	Ga0070700_100154916	Ga0070700_1001549162	258
324	3300005536	Ga0070697_100100631	Ga0070697_1001006313	258
325	3300005545	Ga0070695_100133466	Ga0070695_1001334663	258
326	3300005615	Ga0070702_100240380	Ga0070702_1002403801	258
327	3300005719	Ga0068861_100241181	Ga0068861_1002411812	258
328	3300005843	Ga0068860_100036929	Ga0068860_1000369294	258
329	3300006058	Ga0075432_10035624	Ga0075432_100356242	258
330	3300006852	Ga0075433_10159964	Ga0075433_101599641	258
331	3300006871	Ga0075434_100379450	Ga0075434_1003794501	258
332	3300009553	Ga0105249_10111392	Ga0105249_101113924	258
333	3300025907	Ga0207645_10249806	Ga0207645_102498061	258
334	3300025961	Ga0207712_10089425	Ga0207712_100894252	258
335	3300025972	Ga0207668_10024291	Ga0207668_100242914	258
336	3300026075	Ga0207708_10088347	Ga0207708_100883473	258
337	3300026118	Ga0207675_100255905	Ga0207675_1002559052	258
338	3300033180	Ga0307510_10019179	Ga0307510_100191797	258
339	3300046492	Ga0495585_0184660	Ga0495585_0184660_12_824	258
340	3300046523	Ga0495644_0088742	Ga0495644_0088742_339_1151	258
341	3300046530	Ga0495654_0169849	Ga0495654_0169849_28_840	258
342	3300046648	Ga0495611_0040804	Ga0495611_0040804_293_1105	258
343	3300047320	Ga0495672_0182354	Ga0495672_0182354_112_924	258
344	3300047445	Ga0495677_0063963	Ga0495677_0063963_102_914	258
345	3300048910	Ga0496107_0141865	Ga0496107_0141865_107_919	258
346	3300049744	Ga0501083_0168819	Ga0501083_0168819_555_1376	258
347	3300053109	Ga0500569_023120	Ga0500569_023120_587_1399	258
348	3300053161	Ga0500634_0183532	Ga0500634_0183532_39_851	258
349	3300005367	Ga0070667_100248611	Ga0070667_1002486112	259
350	3300005467	Ga0070706_100426553	Ga0070706_1004265532	259
351	3300006353	Ga0075370_10013444	Ga0075370_100134444	259
352	3300007076	Ga0075435_100315241	Ga0075435_1003152412	259
353	3300050507	nmdc:mga05p37_75062_c1	nmdc:mga05p37_75062_c1_1851_2681	259
354	3300050512	nmdc:mga0n895_113242_c1	nmdc:mga0n895_113242_c1_1011_1841	259
355	3300050515	nmdc:mga0a205_4288_c2	nmdc:mga0a205_4288_c2_828_1658	259
356	3300005289	Ga0065704_10002378	Ga0065704_100023785	261
357	3300005295	Ga0065707_10003055	Ga0065707_100030556	261
358	3300005329	Ga0070683_100074962	Ga0070683_1000749622	261
359	3300005331	Ga0070670_100209886	Ga0070670_1002098863	261
360	3300005338	Ga0068868_100036291	Ga0068868_1000362913	261
361	3300005344	Ga0070661_100242922	Ga0070661_1002429221	261
362	3300005354	Ga0070675_100033041	Ga0070675_1000330415	261
363	3300005355	Ga0070671_100026766	Ga0070671_1000267664	261
364	3300005364	Ga0070673_100268579	Ga0070673_1002685792	261
365	3300005536	Ga0070697_100075437	Ga0070697_1000754373	261
366	3300005543	Ga0070672_100270637	Ga0070672_1002706371	261
367	3300005545	Ga0070695_100021913	Ga0070695_1000219134	261
368	3300005564	Ga0070664_100020709	Ga0070664_1000207096	261
369	3300005841	Ga0068863_100025240	Ga0068863_1000252404	261
370	3300005843	Ga0068860_100479937	Ga0068860_1004799372	261
371	3300006844	Ga0075428_100019153	Ga0075428_1000191537	261
372	3300006852	Ga0075433_10013114	Ga0075433_100131143	261
373	3300006852	Ga0075433_10373170	Ga0075433_103731702	261
374	3300006871	Ga0075434_100023969	Ga0075434_1000239697	261
375	3300006871	Ga0075434_100078375	Ga0075434_1000783752	261
376	3300006871	Ga0075434_100170780	Ga0075434_1001707803	261
377	3300007076	Ga0075435_100005212	Ga0075435_1000052123	261
378	3300009094	Ga0111539_10156777	Ga0111539_101567772	261
379	3300009147	Ga0114129_10021628	Ga0114129_100216286	261
380	3300013308	Ga0157375_10574640	Ga0157375_105746402	261
381	3300025926	Ga0207659_10067902	Ga0207659_100679023	261
382	3300025944	Ga0207661_10277868	Ga0207661_102778682	261
383	3300025945	Ga0207679_10072067	Ga0207679_100720672	261
384	3300025960	Ga0207651_10425704	Ga0207651_104257042	261
385	3300026023	Ga0207677_10121968	Ga0207677_101219683	261
386	3300026088	Ga0207641_10053151	Ga0207641_100531512	261
387	3300027907	Ga0207428_10056723	Ga0207428_100567232	261
388	3300045051	Ga0451576_0021043	Ga0451576_0021043_2386_3219	261
389	3300045051	Ga0451576_0136179	Ga0451576_0136179_1283_2119	261
390	3300046539	Ga0495621_0002267	Ga0495621_0002267_2918_3751	261
391	3300046539	Ga0495621_0088085	Ga0495621_0088085_193_1026	261
392	3300046664	Ga0495659_0007709	Ga0495659_0007709_837_1670	261
393	3300050512	nmdc:mga0n895_2654_c1	nmdc:mga0n895_2654_c1_1947_2780	261
394	3300050513	nmdc:mga0rr50_33479_c1	nmdc:mga0rr50_33479_c1_2506_3348	261
395	3300050513	nmdc:mga0rr50_5638_c1	nmdc:mga0rr50_5638_c1_5534_6367	261
396	3300006844	Ga0075428_100116582	Ga0075428_1001165822	263
397	3300006847	Ga0075431_100148663	Ga0075431_1001486632	263
398	3300005288	Ga0065714_10112926	Ga0065714_101129262	264
399	3300005289	Ga0065704_10011409	Ga0065704_100114092	264
400	3300005290	Ga0065712_10069840	Ga0065712_100698405	264
401	3300005293	Ga0065715_10023726	Ga0065715_100237262	264
402	3300005295	Ga0065707_10098854	Ga0065707_100988544	264
403	3300005328	Ga0070676_10018607	Ga0070676_100186073	264
404	3300005328	Ga0070676_10282685	Ga0070676_102826852	264
405	3300005330	Ga0070690_100016465	Ga0070690_1000164653	264
406	3300005331	Ga0070670_100001336	Ga0070670_1000013364	264
407	3300005333	Ga0070677_10010767	Ga0070677_100107673	264
408	3300005334	Ga0068869_100003353	Ga0068869_1000033538	264
409	3300005335	Ga0070666_10006616	Ga0070666_100066162	264
410	3300005335	Ga0070666_10159659	Ga0070666_101596592	264
411	3300005338	Ga0068868_100054587	Ga0068868_1000545872	264
412	3300005338	Ga0068868_100530561	Ga0068868_1005305612	264
413	3300005340	Ga0070689_100065953	Ga0070689_1000659531	264
414	3300005344	Ga0070661_100089313	Ga0070661_1000893132	264
415	3300005347	Ga0070668_100241342	Ga0070668_1002413421	264
416	3300005353	Ga0070669_100020876	Ga0070669_1000208764	264
417	3300005353	Ga0070669_100064214	Ga0070669_1000642143	264
418	3300005354	Ga0070675_100074393	Ga0070675_1000743933	264
419	3300005356	Ga0070674_100000614	Ga0070674_1000006142	264
420	3300005356	Ga0070674_100058469	Ga0070674_1000584693	264
421	3300005356	Ga0070674_100166204	Ga0070674_1001662042	264
422	3300005364	Ga0070673_100168584	Ga0070673_1001685842	264
423	3300005364	Ga0070673_100201678	Ga0070673_1002016782	264
424	3300005365	Ga0070688_100002318	Ga0070688_1000023182	264
425	3300005366	Ga0070659_100090666	Ga0070659_1000906662	264
426	3300005367	Ga0070667_100060012	Ga0070667_1000600122	264
427	3300005438	Ga0070701_10097406	Ga0070701_100974061	264
428	3300005440	Ga0070705_100338152	Ga0070705_1003381521	264
429	3300005441	Ga0070700_100048565	Ga0070700_1000485654	264
430	3300005441	Ga0070700_100078304	Ga0070700_1000783042	264
431	3300005456	Ga0070678_100061141	Ga0070678_1000611412	264
432	3300005456	Ga0070678_100156526	Ga0070678_1001565262	264
433	3300005457	Ga0070662_100042047	Ga0070662_1000420473	264
434	3300005457	Ga0070662_100403486	Ga0070662_1004034862	264
435	3300005459	Ga0068867_100057417	Ga0068867_1000574172	264
436	3300005466	Ga0070685_10006396	Ga0070685_100063962	264
437	3300005543	Ga0070672_100125057	Ga0070672_1001250572	264
438	3300005543	Ga0070672_100285072	Ga0070672_1002850721	264
439	3300005544	Ga0070686_100006852	Ga0070686_1000068525	264
440	3300005548	Ga0070665_100536359	Ga0070665_1005363591	264
441	3300005564	Ga0070664_100003417	Ga0070664_10000341710	264
442	3300005577	Ga0068857_100251964	Ga0068857_1002519641	264
443	3300005617	Ga0068859_100074549	Ga0068859_1000745492	264
444	3300005840	Ga0068870_10008466	Ga0068870_100084663	264
445	3300005841	Ga0068863_100015735	Ga0068863_1000157354	264
446	3300005842	Ga0068858_100023625	Ga0068858_1000236255	264
447	3300005844	Ga0068862_100001025	Ga0068862_10000102528	264
448	3300006237	Ga0097621_100116303	Ga0097621_1001163032	264
449	3300006358	Ga0068871_100102738	Ga0068871_1001027382	264
450	3300006844	Ga0075428_100039174	Ga0075428_1000391743	264
451	3300006844	Ga0075428_100169318	Ga0075428_1001693182	264
452	3300006846	Ga0075430_100000604	Ga0075430_10000060422	264
453	3300006847	Ga0075431_100000232	Ga0075431_10000023223	264
454	3300006852	Ga0075433_10088952	Ga0075433_100889521	264
455	3300006871	Ga0075434_100017521	Ga0075434_1000175213	264
456	3300006880	Ga0075429_100077536	Ga0075429_1000775362	264
457	3300006931	Ga0097620_100074547	Ga0097620_1000745473	264
458	3300009094	Ga0111539_10005645	Ga0111539_1000564516	264
459	3300009094	Ga0111539_10266775	Ga0111539_102667752	264
460	3300009553	Ga0105249_10005393	Ga0105249_100053937	264
461	3300011119	Ga0105246_10015527	Ga0105246_100155273	264
462	3300013306	Ga0163162_10224156	Ga0163162_102241562	264
463	3300013308	Ga0157375_10136026	Ga0157375_101360263	264
464	3300014325	Ga0163163_10268313	Ga0163163_102683132	264
465	3300014326	Ga0157380_10047463	Ga0157380_100474631	264
466	3300014326	Ga0157380_10063372	Ga0157380_100633722	264
467	3300014745	Ga0157377_10068215	Ga0157377_100682152	264
468	3300014968	Ga0157379_10141236	Ga0157379_101412362	264
469	3300014969	Ga0157376_10054043	Ga0157376_100540432	264
470	3300017792	Ga0163161_10071905	Ga0163161_100719052	264
471	3300025315	Ga0207697_10001877	Ga0207697_100018776	264
472	3300025315	Ga0207697_10047687	Ga0207697_100476871	264
473	3300025893	Ga0207682_10018125	Ga0207682_100181252	264
474	3300025901	Ga0207688_10005219	Ga0207688_100052197	264
475	3300025901	Ga0207688_10015101	Ga0207688_100151012	264
476	3300025903	Ga0207680_10073648	Ga0207680_100736482	264
477	3300025903	Ga0207680_10098959	Ga0207680_100989592	264
478	3300025907	Ga0207645_10071313	Ga0207645_100713132	264
479	3300025908	Ga0207643_10004182	Ga0207643_100041826	264
480	3300025920	Ga0207649_10068451	Ga0207649_100684513	264
481	3300025923	Ga0207681_10147813	Ga0207681_101478131	264
482	3300025923	Ga0207681_10184263	Ga0207681_101842632	264
483	3300025925	Ga0207650_10008598	Ga0207650_100085986	264
484	3300025932	Ga0207690_10175116	Ga0207690_101751162	264
485	3300025933	Ga0207706_10016592	Ga0207706_100165927	264
486	3300025933	Ga0207706_10025923	Ga0207706_100259232	264
487	3300025936	Ga0207670_10096596	Ga0207670_100965961	264
488	3300025937	Ga0207669_10025533	Ga0207669_100255334	264
489	3300025937	Ga0207669_10113700	Ga0207669_101137002	264
490	3300025938	Ga0207704_10095340	Ga0207704_100953402	264
491	3300025938	Ga0207704_10234692	Ga0207704_102346922	264
492	3300025940	Ga0207691_10033747	Ga0207691_100337473	264
493	3300025940	Ga0207691_10148934	Ga0207691_101489343	264
494	3300025941	Ga0207711_10382737	Ga0207711_103827372	264
495	3300025942	Ga0207689_10066789	Ga0207689_100667892	264
496	3300025945	Ga0207679_10003661	Ga0207679_100036613	264
497	3300025960	Ga0207651_10053246	Ga0207651_100532462	264
498	3300025961	Ga0207712_10006078	Ga0207712_100060787	264
499	3300025972	Ga0207668_10479641	Ga0207668_104796412	264
500	3300025986	Ga0207658_10281130	Ga0207658_102811302	264
501	3300026035	Ga0207703_10305591	Ga0207703_103055911	264
502	3300026067	Ga0207678_10277261	Ga0207678_102772612	264
503	3300026075	Ga0207708_10002543	Ga0207708_1000254314	264
504	3300026088	Ga0207641_10024838	Ga0207641_100248384	264
505	3300026089	Ga0207648_10073503	Ga0207648_100735033	264
506	3300026095	Ga0207676_10016083	Ga0207676_100160832	264
507	3300026095	Ga0207676_10200900	Ga0207676_102009002	264
508	3300026116	Ga0207674_10233959	Ga0207674_102339592	264
509	3300026118	Ga0207675_100437562	Ga0207675_1004375622	264
510	3300026121	Ga0207683_10018975	Ga0207683_100189757	264
511	3300026121	Ga0207683_10060983	Ga0207683_100609832	264
512	3300026121	Ga0207683_10568742	Ga0207683_105687422	264
513	3300027907	Ga0207428_10000756	Ga0207428_100007562	264
514	3300028379	Ga0268266_10278242	Ga0268266_102782421	264
515	3300028379	Ga0268266_10749533	Ga0268266_107495331	264
516	3300046615	Ga0495656_0197761	Ga0495656_0197761_137_931	264
517	3300050508	nmdc:mga09592_3746_c1	nmdc:mga09592_3746_c1_2217_3023	264
518	3300050508	nmdc:mga09592_48830_c1	nmdc:mga09592_48830_c1_587_1393	264
519	3300050509	nmdc:mga0qj67_429_c1	nmdc:mga0qj67_429_c1_21487_22293	264
520	3300050510	nmdc:mga06r32_733_c1	nmdc:mga06r32_733_c1_9515_10321	264
521	3300050511	nmdc:mga08y16_7480_c1	nmdc:mga08y16_7480_c1_5314_6120	264
522	3300050512	nmdc:mga0n895_1694_c1	nmdc:mga0n895_1694_c1_13152_13958	264
523	3300050515	nmdc:mga0a205_1435_c1	nmdc:mga0a205_1435_c1_505_1311	264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

44

228

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2z7b-assembly1.cif.gz_A	crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase	0.9544	37	263
2z7b-assembly1.cif.gz_A	crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase	0.9076	37	263
6btg-assembly1.cif.gz_A	crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis	0.8765	37	244
3ocr-assembly1.cif.gz_A	crystal structure of aldolase ii superfamily protein from pseudomonas syringae	0.846	37	262
1jdi-assembly1.cif.gz_A	crystal structure of l-ribulose-5-phosphate 4-epimerase	0.8435	37	244

ID	Description	Score	Start	End	Superfamily
2z7bA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9519	37	263	3.40.225.10
2z7bA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9084	37	263	3.40.225.10
af_Q58813_1_180_3.40.225.10	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.8833	39	229	3.40.225.10
6btgA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.8764	37	244	3.40.225.10
af_P95075_7_208_3.40.225.10	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.8668	39	244	3.40.225.10

ID	Description	Score	Start	End	GO Terms
AF-A0A536XLE7-F1-model_v4	Class II aldolase/adducin family protein	1.002	38	129	GO:0005856 GO:0016830 GO:0051015
AF-A0A382W328-F1-model_v4	Class II aldolase/adducin N-terminal domain-containing protein	0.9867	36	242	GO:0005829 GO:0016832 GO:0019323
AF-A0A537D8V4-F1-model_v4	Class II aldolase/adducin family protein	0.9855	32	238	GO:0005829 GO:0016832 GO:0019323
AF-A0A524HXC3-F1-model_v4	Class II aldolase/adducin family protein	0.985	36	136	GO:0005829 GO:0016832 GO:0019323
AF-A0A7Y4WEQ3-F1-model_v4	Class II aldolase/adducin family protein	0.9821	45	264	GO:0005856 GO:0051015

Feature Viewer

pLDDT	pTM	Quality
86.15	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459064

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

44

228

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map