F459074

General Info

Members Datasets Scaffolds Average Seq Length
523 448 1046 648

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2871481445|2871481788
Length 680
Sequence GHFALVLAFALSLVQTVVPLFGARLNNQRLMAVGGPVAVTGFALTALSFAALASAYASSDFSVASVWENSHSLQPLIYKITGTWGNHEGSMLLWVLILTFFGALVAAFGSNLPATLRANVLAVQGAIGAAFFLFILATSNPFIRLNPAPIEGRDLNPILQDLGLAIHPPFLYLGYVGFSICFSFSVAALIEGRIDASWARWVRPWTLVAWMFLTGGIAMGSYWAYYELGWGGFWFWDPVENASFMPWLAGTALLHSAIVMEKRSALKIWTLLLAILTFSLSLLGTFLVRSGVLTSVHAFATDPTRGVFILCILTLFIGGSLALFALRASRLTTGGLFQPISREGALVLNNLFLTTATATVLVGTLYPLAVEAFSADKISVGAPFFNLTFGPLMVPLLLVVPFGPLLAWKRGDVFAVAQRLMVAFAAALLATLVTALFIDGASVFAALGVGLAVWLILGALTDLAVKSGVGNVAAGIMVRRLLGLPRSVFGTAFAHLGLGLTTLGIVGTLCFGTEKILSMHAGETVELSGHTLRFVGLYPAQGPNYSEDLGRFELIGVSGSPVGEISSAKRFYPVRQMTTTESGIRTIGFSQLYISLGDEGNDGSVVVRLWWKPLVTLIWGGGLMMMAGAAMSLMDRRLRVGASRRARCHPRPCHERAVFSDLHCPAAGAVLCRHGLGGEA

Samples

Sample ID Description Type Environment
1 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
57 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
58 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
85 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
86 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
188 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
189 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
190 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
191 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
192 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
193 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
194 2512875024
195 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
196 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
197 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
198 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
199 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
200 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
201 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
202 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
203 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
204 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
205 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
206 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
207 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
208 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
209 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
210 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
211 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
212 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
213 2738543024 Aminobacter sp. AP02 Isolate Unclassified
214 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
215 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
216 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
217 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
218 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
219 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
220 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
221 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
222 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
223 2854911287 Brucella lupini LUP21 Isolate Unclassified
224 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
225 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
226 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
227 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
228 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
229 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
230 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
231 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
232 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
233 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
234 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
235 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
236 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
237 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
238 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
239 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
240 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
241 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
242 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
243 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
244 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
245 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
246 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
247 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
248 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
249 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
250 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
251 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
252 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
253 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
254 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
255 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
256 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
257 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
258 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
259 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
260 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
261 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
262 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
263 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
264 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
265 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
266 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
267 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
268 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
269 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
270 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
271 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
272 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
273 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
274 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
275 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
276 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
277 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
278 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
279 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
280 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
281 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
282 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
283 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
284 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
285 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
286 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
287 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
288 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
289 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
290 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
291 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
292 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
293 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
294 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
295 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
296 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
297 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
298 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
299 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
300 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
301 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
302 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
303 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
304 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
305 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
306 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
307 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
308 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
309 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
310 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
313 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
314 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
315 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
316 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
317 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
318 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
319 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
320 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
321 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
322 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
323 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
324 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
325 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
326 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
327 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
328 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
329 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
330 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
331 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
332 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
333 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
334 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
335 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
336 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
337 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
338 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
339 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
340 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
341 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
342 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
343 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
344 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
345 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
346 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
347 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
348 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
349 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
350 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
351 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
352 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
353 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
354 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
355 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
356 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
357 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
358 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
359 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
360 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
361 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
362 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
363 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
364 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
365 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
366 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
367 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
368 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
369 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
370 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
371 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
372 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
373 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
374 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
375 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
376 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
377 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
378 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
379 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
380 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
381 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
382 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
383 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
384 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
385 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
386 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
387 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
388 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
389 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
390 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
391 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
392 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
393 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
394 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
395 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
396 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
397 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
398 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
399 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
400 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
401 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
402 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
403 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
404 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
405 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
406 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
407 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
408 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
409 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
410 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
411 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
412 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
413 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
414 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
415 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
416 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
417 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
418 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
419 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
420 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
421 3004167301 Mesorhizobium loti 582 Isolate Unclassified
422 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
423 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
424 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
425 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
426 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
427 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
428 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
429 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
430 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
431 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
432 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
433 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
434 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
435 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
436 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
437 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
438 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
439 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
440 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
441 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
442 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
443 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
444 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
445 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
446 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
447 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
448 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.52
Metatranscriptomes 0
Isolates 50.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 43.4
Rhizoplane 3.63
Rhizosphere 40.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1002283 3300002741 Bacteria 5080
2 JGI25165J46597_1000016 3300003214 Bacteria 377866
3 Ga0055542_1000880 3300003762 Bacteria 20790
4 Ga0070676_10007882 3300005328 Bacteria 5725
5 Ga0070683_100026451 3300005329 Bacteria 5225
6 Ga0070677_10006702 3300005333 Bacteria 3831
7 Ga0070666_10002331 3300005335 Bacteria 11476
8 Ga0070680_100022699 3300005336 Bacteria 5000
9 Ga0070680_100053808 3300005336 Bacteria 3285
10 Ga0070682_100015475 3300005337 Bacteria 4421
11 Ga0070674_100027517 3300005356 Bacteria 3727
12 Ga0070673_100011652 3300005364 Bacteria 6008
13 Ga0070673_100035841 3300005364 Bacteria 3766
14 Ga0070659_100032152 3300005366 Bacteria 4068
15 Ga0070667_100086174 3300005367 Bacteria 2694
16 Ga0070709_10000970 3300005434 Bacteria 15913
17 Ga0070714_100009295 3300005435 Bacteria 7724
18 Ga0070713_100000305 3300005436 Bacteria 32510
19 Ga0070678_100002964 3300005456 Bacteria 9402
20 Ga0070678_100022612 3300005456 Bacteria 4171
21 Ga0070662_100014488 3300005457 Bacteria 5270
22 Ga0070681_10096777 3300005458 Bacteria 2899
23 Ga0068867_100025259 3300005459 Bacteria 4262
24 Ga0070685_10003163 3300005466 Bacteria 8373
25 Ga0070684_100033008 3300005535 Bacteria 4417
26 Ga0070672_100023105 3300005543 Bacteria 4578
27 Ga0070672_100120546 3300005543 Bacteria 2146
28 Ga0070686_100007261 3300005544 Bacteria 6173
29 Ga0068855_100019140 3300005563 Bacteria 8227
30 Ga0068855_100034955 3300005563 Bacteria 5988
31 Ga0068856_100025186 3300005614 Bacteria 5797
32 Ga0070702_100005354 3300005615 Bacteria 5963
33 Ga0068852_100014111 3300005616 Bacteria 6135
34 Ga0068870_10025970 3300005840 Bacteria 2914
35 Ga0068858_100048334 3300005842 Bacteria 3943
36 Ga0068862_100018119 3300005844 Bacteria 5862
37 Ga0081455_10002741 3300005937 Bacteria 20790
38 Ga0081539_10001332 3300005985 Bacteria 43016
39 Ga0081539_10002394 3300005985 Bacteria 26661
40 Ga0070717_10001177 3300006028 Bacteria 17686
41 Ga0075432_10014633 3300006058 Bacteria 2671
42 Ga0070716_100000169 3300006173 Bacteria 25926
43 Ga0075427_10000701 3300006194 Bacteria 4015
44 Ga0097621_100014196 3300006237 Bacteria 5956
45 Ga0075430_100000235 3300006846 Bacteria 38221
46 Ga0075431_100003088 3300006847 Bacteria 16124
47 Ga0075431_100015640 3300006847 Bacteria 7691
48 Ga0075429_100009777 3300006880 Bacteria 8316
49 Ga0068865_100071522 3300006881 Bacteria 2461
50 Ga0099824_1018680 3300006942 Bacteria 5619
51 Ga0105240_10151465 3300009093 Bacteria 2762
52 Ga0111539_10002210 3300009094 Bacteria 25988
53 Ga0111539_10026213 3300009094 Bacteria 7132
54 Ga0111539_10189815 3300009094 Bacteria 2398
55 Ga0114129_10106518 3300009147 Bacteria 3873
56 Ga0105241_10004382 3300009174 Bacteria 10433
57 Ga0105248_10039132 3300009177 Bacteria 5310
58 Ga0105238_10003803 3300009551 Bacteria 14997
59 Ga0105239_10028348 3300010375 Bacteria 6160
60 Ga0157371_10030508 3300013102 Bacteria 3889
61 Ga0157374_10077478 3300013296 Bacteria 3147
62 Ga0163162_10090830 3300013306 Bacteria 3136
63 Ga0157380_10026274 3300014326 Bacteria 4420
64 Ga0157377_10025310 3300014745 Bacteria 3164
65 Ga0214544_1000008 3300021320 Bacteria 326027
66 Ga0214542_1000010 3300021321 Bacteria 262816
67 Ga0214543_1000004 3300021327 Bacteria 527190
68 Ga0213875_10020228 3300021388 Bacteria 3193
69 Ga0209026_1000005 3300025250 Bacteria 731387
70 Ga0209148_1000056 3300025254 Bacteria 363380
71 Ga0209759_1001253 3300025256 Bacteria 15384
72 Ga0209233_1000068 3300025261 Bacteria 377969
73 Ga0209233_1001435 3300025261 Bacteria 9403
74 Ga0209455_1000238 3300025272 Bacteria 68798
75 Ga0207682_10023531 3300025893 Bacteria 2433
76 Ga0207645_10005653 3300025907 Bacteria 9036
77 Ga0207643_10006558 3300025908 Bacteria 6239
78 Ga0207643_10008151 3300025908 Bacteria 5621
79 Ga0207654_10000663 3300025911 Bacteria 19478
80 Ga0207707_10007287 3300025912 Bacteria 9629
81 Ga0207707_10020325 3300025912 Bacteria 5798
82 Ga0207663_10036360 3300025916 Bacteria 2962
83 Ga0207660_10019044 3300025917 Bacteria 4585
84 Ga0207657_10010839 3300025919 Bacteria 9070
85 Ga0207657_10097581 3300025919 Bacteria 2443
86 Ga0207681_10041974 3300025923 Bacteria 3052
87 Ga0207694_10000050 3300025924 Bacteria 159920
88 Ga0207706_10016869 3300025933 Bacteria 6588
89 Ga0207706_10018628 3300025933 Bacteria 6246
90 Ga0207669_10025944 3300025937 Bacteria 3178
91 Ga0207691_10010469 3300025940 Bacteria 8894
92 Ga0207691_10022245 3300025940 Bacteria 5981
93 Ga0207691_10039700 3300025940 Bacteria 4354
94 Ga0207667_10008645 3300025949 Bacteria 12074
95 Ga0207667_10017900 3300025949 Bacteria 7963
96 Ga0207639_10093973 3300026041 Bacteria 2406
97 Ga0207702_10000002 3300026078 Bacteria 491507
98 Ga0207702_10089361 3300026078 Bacteria 2694
99 Ga0207648_10020477 3300026089 Bacteria 5956
100 Ga0207674_10001499 3300026116 Bacteria 30140
101 Ga0207675_100004489 3300026118 Bacteria 13480
102 Ga0209589_1000001 3300027357 Bacteria 794224
103 Ga0209489_100001 3300027361 Bacteria 794224
104 Ga0209700_100001 3300027363 Bacteria 794224
105 Ga0209971_1000351 3300027682 Bacteria 12596
106 Ga0207428_10000175 3300027907 Bacteria 89715
107 Ga0265340_10002545 3300031247 Bacteria 10362
108 Ga0265339_10014375 3300031249 Bacteria 4770
109 Ga0265313_10021186 3300031595 Bacteria 3561
110 Ga0307508_10000001 3300031616 Bacteria 553635
111 Ga0265314_10017584 3300031711 Bacteria 5606
112 Ga0265342_10001704 3300031712 Bacteria 20117
113 Ga0316576_10013704 3300031727 Bacteria 5399
114 Ga0307510_10043325 3300033180 Bacteria 4893
115 Ga0373952_0001438 3300035092 Bacteria 4337
116 Ga0373939_0007226 3300035114 Bacteria 2694
117 Ga0373941_0008998 3300035115 Bacteria 2503
118 Ga0373943_0017898 3300035170 Bacteria 3248
119 Ga0316574_0000391 3300035398 Bacteria 17123
120 Ga0373931_0020115 3300035691 Bacteria 3337
121 Ga0373935_0018272 3300035692 Bacteria 4263
122 Ga0373927_0006288 3300035695 Bacteria 8102
123 Ga0373933_0000260 3300035724 Bacteria 34773
124 Ga0373947_0002798 3300035725 Bacteria 10425
125 Ga0395899_0000090 3300037312 Bacteria 156587
126 Ga0395900_0000017 3300037418 Bacteria 369602
127 Ga0395900_0040709 3300037418 Bacteria 4789
128 Ga0395900_0057363 3300037418 Bacteria 4009
129 Ga0395898_0000030 3300037466 Bacteria 369577
130 Ga0395898_0093832 3300037466 Bacteria 2884
131 Ga0395905_0000081 3300037471 Bacteria 160409
132 Ga0395905_0130604 3300037471 Bacteria 2362
133 Ga0436364_0209289 3300037853 Bacteria 16696
134 Ga0395901_0000015 3300038443 Bacteria 373388
135 Ga0395901_0003866 3300038443 Bacteria 15061
136 Ga0395901_0066665 3300038443 Bacteria 3749
137 Ga0400483_061621 3300039062 Bacteria 19892
138 Ga0400483_186102 3300039062 Bacteria 9417
139 Ga0400483_227629 3300039062 Bacteria 5742
140 Ga0436365_1622498 3300039437 Bacteria 69059
141 Ga0436363_0416726 3300039450 Bacteria 13039
142 Ga0436362_0984061 3300039453 Bacteria 17064
143 Ga0466966_0000633 3300044684 Bacteria 22332
144 Ga0466961_0000102 3300044693 Bacteria 55644
145 Ga0466959_0008547 3300045049 Bacteria 7245
146 Ga0495603_0009215 3300046455 Bacteria 5965
147 Ga0495590_0002767 3300046457 Bacteria 7235
148 Ga0495629_0002774 3300046459 Bacteria 13389
149 Ga0495638_0007312 3300046460 Bacteria 7933
150 Ga0495638_0010616 3300046460 Bacteria 6379
151 Ga0495638_0018698 3300046460 Bacteria 4597
152 Ga0495641_0007154 3300046461 Bacteria 7046
153 Ga0495641_0024177 3300046461 Bacteria 3003
154 Ga0495651_0013900 3300046462 Bacteria 6226
155 Ga0495582_0000687 3300046473 Bacteria 18629
156 Ga0495582_0011862 3300046473 Bacteria 4800
157 Ga0495616_0005546 3300046513 Bacteria 7747
158 Ga0495630_0003439 3300046517 Bacteria 11007
159 Ga0495648_0052105 3300046524 Bacteria 2488
160 Ga0495586_0024120 3300046535 Bacteria 3249
161 Ga0495645_0012385 3300046543 Bacteria 6010
162 Ga0495667_0037002 3300046559 Bacteria 3254
163 Ga0495625_0055911 3300046660 Bacteria 2812
164 Ga0495588_0013330 3300046674 Bacteria 3915
165 Ga0495647_0011431 3300046681 Bacteria 3042
166 Ga0495658_0000152 3300046683 Bacteria 38860
167 Ga0495658_0031174 3300046683 Bacteria 2901
168 Ga0495600_0046461 3300046809 Bacteria 2832
169 Ga0495581_0007556 3300047315 Bacteria 6286
170 Ga0495604_0034426 3300047317 Bacteria 4007
171 Ga0495614_0024587 3300048089 Bacteria 2600
172 Ga0496104_0000335 3300048907 Bacteria 42046
173 Ga0496104_0001131 3300048907 Bacteria 22829
174 Ga0496104_0010396 3300048907 Bacteria 8311
175 Ga0496105_0000063 3300048908 Bacteria 84836
176 Ga0496105_0008598 3300048908 Bacteria 7933
177 Ga0496105_0030898 3300048908 Bacteria 4391
178 Ga0496106_0017792 3300048909 Bacteria 5256
179 Ga0496108_0001478 3300048911 Bacteria 18566
180 Ga0496109_0030959 3300048912 Bacteria 4797
181 Ga0496110_0011042 3300048913 Bacteria 7373
182 Ga0496110_0019286 3300048913 Bacteria 5735
183 Ga0496111_0016030 3300048914 Bacteria 5157
184 Ga0496112_0003871 3300048915 Bacteria 12512
185 Ga0496112_0029674 3300048915 Bacteria 5290
186 Ga0496112_0219860 3300048915 Bacteria 1856
187 Ga0496113_0001748 3300048916 Bacteria 12302
188 Ga0496113_0008560 3300048916 Bacteria 6672
189 Ga0496113_0042903 3300048916 Bacteria 3344
190 Ga0496119_0000213 3300048922 Bacteria 82822
191 Ga0496119_0030836 3300048922 Bacteria 3607
192 Ga0496120_0000924 3300048923 Bacteria 40753
193 Ga0496120_0048810 3300048923 Bacteria 2434
194 Ga0496125_0086706 3300048928 Bacteria 2367
195 Ga0496126_0072029 3300048929 Bacteria 3075
196 Ga0501031_0000001 3300049568 Bacteria 219461
197 Ga0501032_0000003 3300049569 Bacteria 317700
198 Ga0501032_0002588 3300049569 Bacteria 14159
199 Ga0501032_0026659 3300049569 Bacteria 3972
200 Ga0501032_0044361 3300049569 Bacteria 3010
201 Ga0501033_0000070 3300049570 Bacteria 97795
202 Ga0501033_0000228 3300049570 Bacteria 54176
203 Ga0501033_0005512 3300049570 Bacteria 10012
204 Ga0501034_0000005 3300049571 Bacteria 367512
205 Ga0501034_0000087 3300049571 Bacteria 166714
206 Ga0501034_0014018 3300049571 Bacteria 8253
207 Ga0501034_0041177 3300049571 Bacteria 4674
208 Ga0501034_0153927 3300049571 Bacteria 2274
209 Ga0501036_0000018 3300049572 Bacteria 121185
210 Ga0501036_0006642 3300049572 Bacteria 9402
211 Ga0501036_0065530 3300049572 Bacteria 3074
212 Ga0501037_0000005 3300049573 Bacteria 219461
213 Ga0501037_0000014 3300049573 Bacteria 171015
214 Ga0501037_0019910 3300049573 Bacteria 4952
215 Ga0501037_0020732 3300049573 Bacteria 4853
216 Ga0501038_0000001 3300049574 Bacteria 375481
217 Ga0501038_0000023 3300049574 Bacteria 151469
218 Ga0501039_0000015 3300049575 Bacteria 219470
219 Ga0501039_0000044 3300049575 Bacteria 108828
220 Ga0501039_0062996 3300049575 Bacteria 2874
221 Ga0501040_0010361 3300049576 Bacteria 6093
222 Ga0501042_0016154 3300049578 Bacteria 5120
223 Ga0501043_0000922 3300049579 Bacteria 26076
224 Ga0501043_0003007 3300049579 Bacteria 14031
225 Ga0501043_0015303 3300049579 Bacteria 6009
226 Ga0501047_0001221 3300049581 Bacteria 25492
227 Ga0501047_0001700 3300049581 Bacteria 21395
228 Ga0501047_0006343 3300049581 Bacteria 11121
229 Ga0501047_0024980 3300049581 Bacteria 5739
230 Ga0501048_0008218 3300049582 Bacteria 7894
231 Ga0501048_0057811 3300049582 Bacteria 2750
232 Ga0501067_0026127 3300049583 Bacteria 3236
233 Ga0501067_0048710 3300049583 Bacteria 2350
234 Ga0501068_0013892 3300049584 Bacteria 4591
235 Ga0501070_0001996 3300049586 Bacteria 17938
236 Ga0501070_0009945 3300049586 Bacteria 8043
237 Ga0501072_0023322 3300049588 Bacteria 4805
238 Ga0501035_0000047 3300049822 Bacteria 146497
239 Ga0501035_0000053 3300049822 Bacteria 142860
240 Ga0501035_0004670 3300049822 Bacteria 13000
241 Ga0501044_0000001 3300049823 Bacteria 418087
242 Ga0501044_0012838 3300049823 Bacteria 9070
243 Ga0501045_0005337 3300049824 Bacteria 8903
244 nmdc:mga05p37_17554_c1 3300050507 Bacteria 8639
245 nmdc:mga05p37_680_c1 3300050507 Bacteria 37674
246 nmdc:mga09592_45242_c1 3300050508 Bacteria 3707
247 nmdc:mga09592_602_c1 3300050508 Bacteria 27290
248 nmdc:mga0qj67_3217_c1 3300050509 Bacteria 11761
249 nmdc:mga06r32_21805_c1 3300050510 Bacteria 5915
250 nmdc:mga06r32_9690_c1 3300050510 Bacteria 8703
251 nmdc:mga08y16_2194_c1 3300050511 Bacteria 20038
252 nmdc:mga0rr50_68071_c1 3300050513 Bacteria 2707
253 nmdc:mga0a205_1612_c1 3300050515 Bacteria 19396
254 Ga0495619_0000226 3300053085 Bacteria 40937
255 Ga0500569_007609 3300053109 Bacteria 2440
256 Ga0500568_0000798 3300053139 Bacteria 22229
257 Ga0500616_0019750 3300053153 Bacteria 3794
258 Ga0500638_035857 3300053162 Bacteria 2404
259 Ga0530510_0121611 3300061734 Bacteria 1917
260 2871481788 2871481445 Bacteria 6700002
261 2503203433 2503198000 Bacteria 6884444
262 2509115849 2508501123 Bacteria 6283661
263 2509373301 2509276018 Bacteria 6910194
264 2509397859 2509276022 Bacteria 6200534
265 2510316432 2510065059 Bacteria 6847884
266 2512929684 2512875016 Bacteria 6529530
267 2512964455 2512875024 Bacteria 7195110
268 2513608328 2513237090 Bacteria 7096802
269 2514037012 2513237164 Bacteria 7563725
270 2514416763 2513237305 Bacteria 7293571
271 2514591695 2513237351 Bacteria 6968952
272 2588515266 2588253730 Bacteria 6881675
273 2597815150 2597489875 Bacteria 7010078
274 2599939979 2599185301 Bacteria 6161860
275 2643774060 2643221550 Bacteria 4619371
276 2643774835 2643221551 Bacteria 3750538
277 2643793279 2643221555 Bacteria 3749717
278 2643838671 2643221564 Bacteria 4193379
279 2643988975 2643221595 Bacteria 6565519
280 2644132785 2643221623 Bacteria 5239945
281 2644152160 2643221627 Bacteria 6761570
282 2688600266 2687453392 Bacteria 6880454
283 2694631773 2693429783 Bacteria 7019804
284 2694639825 2693429784 Bacteria 7241525
285 2723577548 2721755686 Bacteria 7343952
286 2739306588 2738543024 Bacteria 5603683
287 2756673174 2756170246 Bacteria 7451806
288 2758641166 2758568016 Bacteria 5645291
289 2792750909 2791355123 Bacteria 8049106
290 2837682743 2837678835 Bacteria 5252418
291 2841734572 2841734538 Bacteria 6784580
292 2844005617 2844002411 Bacteria 7168230
293 2844015582 2844009547 Bacteria 6728125
294 2847671955 2847670302 Bacteria 6165597
295 2847688182 2847686936 Bacteria 6278406
296 2854913220 2854911287 Bacteria 5582813
297 2856318315 2856314179 Bacteria 6477897
298 2856324273 2856320880 Bacteria 7263508
299 2856328568 2856328259 Bacteria 6528202
300 2856338516 2856334872 Bacteria 7037011
301 2856345572 2856342000 Bacteria 7176905
302 2856353682 2856349417 Bacteria 6230045
303 2856364782 2856364286 Bacteria 6939991
304 2857354944 2857349434 Bacteria 7926032
305 2869165527 2869162929 Bacteria 6399702
306 2869170356 2869169390 Bacteria 6659796
307 2869234903 2869234852 Bacteria 6654993
308 2869242809 2869242130 Bacteria 6609239
309 2869261299 2869256925 Bacteria 6981691
310 2869270935 2869264136 Bacteria 6880765
311 2869271810 2869271264 Bacteria 6908218
312 2869281729 2869278585 Bacteria 7077053
313 2869289769 2869285874 Bacteria 6901219
314 2871431835 2871429161 Bacteria 6547891
315 2871450746 2871444079 Bacteria 6423508
316 2871456635 2871451962 Bacteria 7336357
317 2871462010 2871459585 Bacteria 6866887
318 2871468539 2871466892 Bacteria 6923287
319 2871477930 2871474448 Bacteria 6806570
320 2871494069 2871488783 Bacteria 6929816
321 2871497482 2871495908 Bacteria 6935695
322 2874112204 2874109183 Bacteria 6517025
323 2874120432 2874116593 Bacteria 6674494
324 2874127699 2874123672 Bacteria 7238285
325 2874140606 2874139085 Bacteria 7021506
326 2874155513 2874146452 Bacteria 7533118
327 2874162370 2874155637 Bacteria 6724144
328 2874166877 2874162495 Bacteria 6174670
329 2874175309 2874168670 Bacteria 8062617
330 2876366754 2876363079 Bacteria 6544991
331 2876384867 2876377896 Bacteria 6565995
332 2876390719 2876386047 Bacteria 6698674
333 2876398717 2876392853 Bacteria 6660880
334 2876400560 2876399893 Bacteria 6927900
335 2876411506 2876406927 Bacteria 6191900
336 2876420858 2876413966 Bacteria 6831344
337 2876425792 2876420981 Bacteria 6687741
338 2878037652 2878035449 Bacteria 6555736
339 2878736690 2878730984 Bacteria 6380721
340 2878742388 2878738818 Bacteria 7136951
341 2878748441 2878745973 Bacteria 6867388
342 2878756644 2878753008 Bacteria 6922523
343 2878761700 2878760144 Bacteria 6823465
344 2878768668 2878767105 Bacteria 6898628
345 2878775165 2878774303 Bacteria 6108671
346 2878787577 2878781027 Bacteria 6834456
347 2881153809 2881147464 Bacteria 7779814
348 2881157593 2881155292 Bacteria 6461656
349 2881162953 2881161766 Bacteria 7127907
350 2881846881 2881845957 Bacteria 6611900
351 2881858618 2881853255 Bacteria 6698367
352 2881866511 2881861095 Bacteria 7128710
353 2882635391 2882632389 Bacteria 8154593
354 2882917821 2882912400 Bacteria 6801539
355 2885311743 2885305155 Bacteria 7348390
356 2885316270 2885312484 Bacteria 6415165
357 2885325669 2885318864 Bacteria 6729568
358 2885345209 2885342637 Bacteria 7011821
359 2885356195 2885350715 Bacteria 6787678
360 2888341444 2888337043 Bacteria 6629336
361 2888348599 2888343758 Bacteria 6611049
362 2888350785 2888350351 Bacteria 7372807
363 2889013127 2889010040 Bacteria 6749192
364 2889022013 2889016732 Bacteria 6700763
365 2889795423 2889790730 Bacteria 5689708
366 2889920072 2889914905 Bacteria 5702301
367 2903452930 2903448605 Bacteria 7357801
368 2903502427 2903492973 Bacteria 13473544
369 2903506117 2903492973 Bacteria 13473544
370 2903524621 2903521522 Bacteria 6525694
371 2903531136 2903528002 Bacteria 6586099
372 2903542277 2903540706 Bacteria 7062119
373 2904665249 2904659560 Bacteria 6685615
374 2906312058 2906308376 Bacteria 6841989
375 2906323796 2906321335 Bacteria 6579571
376 2906331347 2906328253 Bacteria 6585166
377 2906372403 2906370794 Bacteria 6881062
378 2906384052 2906378014 Bacteria 6911440
379 2906393009 2906386501 Bacteria 5977019
380 2906397019 2906393657 Bacteria 6790866
381 2906402482 2906401398 Bacteria 6693206
382 2906408369 2906408224 Bacteria 6162342
383 2906418352 2906414383 Bacteria 6580790
384 2906433360 2906427513 Bacteria 6375796
385 2913297539 2913295892 Bacteria 6333755
386 2922152758 2922151315 Bacteria 6902399
387 2922178208 2922172374 Bacteria 6167644
388 2922183876 2922178524 Bacteria 6025201
389 2922187327 2922185730 Bacteria 7113964
390 2924710565 2924710171 Bacteria 6752351
391 2924723750 2924718760 Bacteria 6331356
392 2924726901 2924726620 Bacteria 6271473
393 2924740415 2924733363 Bacteria 7574837
394 2924746443 2924741084 Bacteria 6661321
395 2924764488 2924762789 Bacteria 6561353
396 2924780188 2924776078 Bacteria 7492003
397 2924788233 2924784321 Bacteria 7416538
398 2937818119 2937813078 Bacteria 7783518
399 2937829125 2937822353 Bacteria 7290551
400 2937842705 2937836603 Bacteria 6811263
401 2937846675 2937843397 Bacteria 5256375
402 2937850727 2937848649 Bacteria 6983481
403 2937866725 2937861824 Bacteria 6660327
404 2937872616 2937868953 Bacteria 6639878
405 2937882708 2937877337 Bacteria 7246526
406 2937973319 2937972304 Bacteria 7532020
407 2937983321 2937980651 Bacteria 6517427
408 2937996132 2937994558 Bacteria 7036190
409 2938016710 2938014810 Bacteria 6700592
410 2958037690 2958034702 Bacteria 6989922
411 2958047401 2958041894 Bacteria 13082850
412 2958050965 2958041894 Bacteria 13082850
413 2958066071 2958064165 Bacteria 7158582
414 2958074988 2958071322 Bacteria 6815895
415 2958089833 2958084443 Bacteria 7312792
416 2958098306 2958092219 Bacteria 6861151
417 2958106295 2958100919 Bacteria 6800575
418 2958108421 2958108152 Bacteria 6681128
419 2958116855 2958115193 Bacteria 6923548
420 2958123822 2958122699 Bacteria 7280457
421 2958134142 2958130278 Bacteria 6897202
422 2958139228 2958137437 Bacteria 6050276
423 2958145911 2958144490 Bacteria 6677056
424 2958166602 2958165035 Bacteria 6906348
425 2958183788 2958179912 Bacteria 6874908
426 2961081754 2961077736 Bacteria 7079850
427 2961120249 2961114664 Bacteria 6680456
428 2961138888 2961136820 Bacteria 6775228
429 2961165068 2961163497 Bacteria 6901077
430 2961172934 2961170736 Bacteria 7072258
431 2961188158 2961183825 Bacteria 6688536
432 2963649548 2963644680 Bacteria 6530403
433 2965019892 2965018300 Bacteria 6883036
434 2965026189 2965025482 Bacteria 6532201
435 2965040771 2965040258 Bacteria 6855979
436 2965047727 2965047637 Bacteria 6623551
437 2965067013 2965062239 Bacteria 7412989
438 2965094456 2965089291 Bacteria 6866420
439 2965110460 2965102966 Bacteria 6800987
440 2965117212 2965110997 Bacteria 6693150
441 2967998145 2967996073 Bacteria 6787468
442 2968008797 2968003550 Bacteria 6929263
443 2968019475 2968016561 Bacteria 7022047
444 2968084711 2968083720 Bacteria 7351627
445 2968092281 2968091066 Bacteria 6052692
446 2968116716 2968110612 Bacteria 6814636
447 2968118471 2968117919 Bacteria 6536078
448 2968131799 2968128360 Bacteria 6270294
449 2968173469 2968171901 Bacteria 6894245
450 2970472796 2970469710 Bacteria 6969209
451 2970494789 2970489779 Bacteria 6517260
452 2970505528 2970503327 Bacteria 7099517
453 2970515819 2970510686 Bacteria 7006402
454 2970529591 2970524798 Bacteria 6840927
455 2970538880 2970532167 Bacteria 6553173
456 2970550587 2970547951 Bacteria 6931819
457 2970556558 2970554993 Bacteria 6814252
458 2970596332 2970593180 Bacteria 7073582
459 2970620274 2970619444 Bacteria 6986144
460 2970633717 2970627176 Bacteria 6680862
461 2977825824 2977821940 Bacteria 6906439
462 2977830081 2977828996 Bacteria 7007971
463 2977851215 2977843712 Bacteria 6753583
464 2977856250 2977851361 Bacteria 6694324
465 2977869424 2977864932 Bacteria 7534097
466 2977875044 2977872689 Bacteria 7270173
467 2977906226 2977898635 Bacteria 6675551
468 2977921404 2977915119 Bacteria 6829656
469 2977927584 2977922695 Bacteria 6956781
470 2977939732 2977935797 Bacteria 6252826
471 2977947173 2977942078 Bacteria 7570577
472 2977952082 2977950692 Bacteria 6893264
473 2977958458 2977957713 Bacteria 6877875
474 2977979010 2977971508 Bacteria 7472917
475 2977990821 2977986579 Bacteria 6581278
476 2979710983 2979710463 Bacteria 6785254
477 2979743165 2979742915 Bacteria 7301278
478 2979767589 2979764755 Bacteria 6610066
479 2979785987 2979779861 Bacteria 6219781
480 2979798349 2979793036 Bacteria 6808957
481 2979810249 2979808191 Bacteria 7179355
482 2987643546 2987636660 Bacteria 8088555
483 2987647080 2987645492 Bacteria 6117018
484 2987654741 2987652177 Bacteria 6969023
485 2987661076 2987659509 Bacteria 6966464
486 2987672669 2987666974 Bacteria 6509233
487 2987673768 2987673487 Bacteria 6884027
488 2989354299 2989349275 Bacteria 6349068
489 2996313197 2996310559 Bacteria 6357320
490 2996340204 2996336353 Bacteria 5511628
491 2996348622 2996341866 Bacteria 6643098
492 2996352085 2996348954 Bacteria 7239054
493 2996392031 2996386984 Bacteria 6978667
494 3000141986 3000135777 Bacteria 6891109
495 3003932550 3003930520 Bacteria 5667563
496 3004171049 3004167301 Bacteria 8330599
497 3004190126 3004188549 Bacteria 6952365
498 3004201830 3004195979 Bacteria 6776956
499 3004207091 3004203850 Bacteria 7307914
500 3004214515 3004211236 Bacteria 7417683
501 3004219196 3004218560 Bacteria 7421728
502 3004237308 3004232784 Bacteria 6662140
503 3004240071 3004239961 Bacteria 6892290
504 3004248861 3004248173 Bacteria 6563236
505 3004273419 3004268573 Bacteria 7043476
506 3004278783 3004275668 Bacteria 7114440
507 3004295055 3004289098 Bacteria 6135450
508 3004339263 3004334049 Bacteria 8449246
509 637079428 637000159 Bacteria 7596297
510 649874737 649633066 Bacteria 6690028
511 8002287945 8002285264 Bacteria 6717907
512 8004301536 8004300914 Bacteria 6132239
513 8004317345 8004312739 Bacteria 7444653
514 8004369103 8004361976 Bacteria 6858373
515 8004378232 8004374579 Bacteria 6898112
516 8004391647 8004387939 Bacteria 7049250
517 8004633761 8004633249 Bacteria 6723080
518 8004641337 8004640170 Bacteria 6723001
519 8004710737 8004703790 Bacteria 8006957
520 8004717016 8004714634 Bacteria 6776161
521 8004732785 8004727605 Bacteria 6643904
522 8019661387 8019659431 Bacteria 8577854
523 8055622828 8055617313 Bacteria 7548464
524 JGI25157J39369_1002283
525 JGI25165J46597_1000016
526 Ga0055542_1000880
527 Ga0070676_10007882
528 Ga0070683_100026451
529 Ga0070677_10006702
530 Ga0070666_10002331
531 Ga0070680_100022699
532 Ga0070680_100053808
533 Ga0070682_100015475
534 Ga0070674_100027517
535 Ga0070673_100011652
536 Ga0070673_100035841
537 Ga0070659_100032152
538 Ga0070667_100086174
539 Ga0070709_10000970
540 Ga0070714_100009295
541 Ga0070713_100000305
542 Ga0070678_100002964
543 Ga0070678_100022612
544 Ga0070662_100014488
545 Ga0070681_10096777
546 Ga0068867_100025259
547 Ga0070685_10003163
548 Ga0070684_100033008
549 Ga0070672_100023105
550 Ga0070672_100120546
551 Ga0070686_100007261
552 Ga0068855_100019140
553 Ga0068855_100034955
554 Ga0068856_100025186
555 Ga0070702_100005354
556 Ga0068852_100014111
557 Ga0068870_10025970
558 Ga0068858_100048334
559 Ga0068862_100018119
560 Ga0081455_10002741
561 Ga0081539_10001332
562 Ga0081539_10002394
563 Ga0070717_10001177
564 Ga0075432_10014633
565 Ga0070716_100000169
566 Ga0075427_10000701
567 Ga0097621_100014196
568 Ga0075430_100000235
569 Ga0075431_100003088
570 Ga0075431_100015640
571 Ga0075429_100009777
572 Ga0068865_100071522
573 Ga0099824_1018680
574 Ga0105240_10151465
575 Ga0111539_10002210
576 Ga0111539_10026213
577 Ga0111539_10189815
578 Ga0114129_10106518
579 Ga0105241_10004382
580 Ga0105248_10039132
581 Ga0105238_10003803
582 Ga0105239_10028348
583 Ga0157371_10030508
584 Ga0157374_10077478
585 Ga0163162_10090830
586 Ga0157380_10026274
587 Ga0157377_10025310
588 Ga0214544_1000008
589 Ga0214542_1000010
590 Ga0214543_1000004
591 Ga0213875_10020228
592 Ga0209026_1000005
593 Ga0209148_1000056
594 Ga0209759_1001253
595 Ga0209233_1000068
596 Ga0209233_1001435
597 Ga0209455_1000238
598 Ga0207682_10023531
599 Ga0207645_10005653
600 Ga0207643_10006558
601 Ga0207643_10008151
602 Ga0207654_10000663
603 Ga0207707_10007287
604 Ga0207707_10020325
605 Ga0207663_10036360
606 Ga0207660_10019044
607 Ga0207657_10010839
608 Ga0207657_10097581
609 Ga0207681_10041974
610 Ga0207694_10000050
611 Ga0207706_10016869
612 Ga0207706_10018628
613 Ga0207669_10025944
614 Ga0207691_10010469
615 Ga0207691_10022245
616 Ga0207691_10039700
617 Ga0207667_10008645
618 Ga0207667_10017900
619 Ga0207639_10093973
620 Ga0207702_10000002
621 Ga0207702_10089361
622 Ga0207648_10020477
623 Ga0207674_10001499
624 Ga0207675_100004489
625 Ga0209589_1000001
626 Ga0209489_100001
627 Ga0209700_100001
628 Ga0209971_1000351
629 Ga0207428_10000175
630 Ga0265340_10002545
631 Ga0265339_10014375
632 Ga0265313_10021186
633 Ga0307508_10000001
634 Ga0265314_10017584
635 Ga0265342_10001704
636 Ga0316576_10013704
637 Ga0307510_10043325
638 Ga0373952_0001438
639 Ga0373939_0007226
640 Ga0373941_0008998
641 Ga0373943_0017898
642 Ga0316574_0000391
643 Ga0373931_0020115
644 Ga0373935_0018272
645 Ga0373927_0006288
646 Ga0373933_0000260
647 Ga0373947_0002798
648 Ga0395899_0000090
649 Ga0395900_0000017
650 Ga0395900_0040709
651 Ga0395900_0057363
652 Ga0395898_0000030
653 Ga0395898_0093832
654 Ga0395905_0000081
655 Ga0395905_0130604
656 Ga0436364_0209289
657 Ga0395901_0000015
658 Ga0395901_0003866
659 Ga0395901_0066665
660 Ga0400483_061621
661 Ga0400483_186102
662 Ga0400483_227629
663 Ga0436365_1622498
664 Ga0436363_0416726
665 Ga0436362_0984061
666 Ga0466966_0000633
667 Ga0466961_0000102
668 Ga0466959_0008547
669 Ga0495603_0009215
670 Ga0495590_0002767
671 Ga0495629_0002774
672 Ga0495638_0007312
673 Ga0495638_0010616
674 Ga0495638_0018698
675 Ga0495641_0007154
676 Ga0495641_0024177
677 Ga0495651_0013900
678 Ga0495582_0000687
679 Ga0495582_0011862
680 Ga0495616_0005546
681 Ga0495630_0003439
682 Ga0495648_0052105
683 Ga0495586_0024120
684 Ga0495645_0012385
685 Ga0495667_0037002
686 Ga0495625_0055911
687 Ga0495588_0013330
688 Ga0495647_0011431
689 Ga0495658_0000152
690 Ga0495658_0031174
691 Ga0495600_0046461
692 Ga0495581_0007556
693 Ga0495604_0034426
694 Ga0495614_0024587
695 Ga0496104_0000335
696 Ga0496104_0001131
697 Ga0496104_0010396
698 Ga0496105_0000063
699 Ga0496105_0008598
700 Ga0496105_0030898
701 Ga0496106_0017792
702 Ga0496108_0001478
703 Ga0496109_0030959
704 Ga0496110_0011042
705 Ga0496110_0019286
706 Ga0496111_0016030
707 Ga0496112_0003871
708 Ga0496112_0029674
709 Ga0496112_0219860
710 Ga0496113_0001748
711 Ga0496113_0008560
712 Ga0496113_0042903
713 Ga0496119_0000213
714 Ga0496119_0030836
715 Ga0496120_0000924
716 Ga0496120_0048810
717 Ga0496125_0086706
718 Ga0496126_0072029
719 Ga0501031_0000001
720 Ga0501032_0000003
721 Ga0501032_0002588
722 Ga0501032_0026659
723 Ga0501032_0044361
724 Ga0501033_0000070
725 Ga0501033_0000228
726 Ga0501033_0005512
727 Ga0501034_0000005
728 Ga0501034_0000087
729 Ga0501034_0014018
730 Ga0501034_0041177
731 Ga0501034_0153927
732 Ga0501036_0000018
733 Ga0501036_0006642
734 Ga0501036_0065530
735 Ga0501037_0000005
736 Ga0501037_0000014
737 Ga0501037_0019910
738 Ga0501037_0020732
739 Ga0501038_0000001
740 Ga0501038_0000023
741 Ga0501039_0000015
742 Ga0501039_0000044
743 Ga0501039_0062996
744 Ga0501040_0010361
745 Ga0501042_0016154
746 Ga0501043_0000922
747 Ga0501043_0003007
748 Ga0501043_0015303
749 Ga0501047_0001221
750 Ga0501047_0001700
751 Ga0501047_0006343
752 Ga0501047_0024980
753 Ga0501048_0008218
754 Ga0501048_0057811
755 Ga0501067_0026127
756 Ga0501067_0048710
757 Ga0501068_0013892
758 Ga0501070_0001996
759 Ga0501070_0009945
760 Ga0501072_0023322
761 Ga0501035_0000047
762 Ga0501035_0000053
763 Ga0501035_0004670
764 Ga0501044_0000001
765 Ga0501044_0012838
766 Ga0501045_0005337
767 nmdc:mga05p37_17554_c1
768 nmdc:mga05p37_680_c1
769 nmdc:mga09592_45242_c1
770 nmdc:mga09592_602_c1
771 nmdc:mga0qj67_3217_c1
772 nmdc:mga06r32_21805_c1
773 nmdc:mga06r32_9690_c1
774 nmdc:mga08y16_2194_c1
775 nmdc:mga0rr50_68071_c1
776 nmdc:mga0a205_1612_c1
777 Ga0495619_0000226
778 Ga0500569_007609
779 Ga0500568_0000798
780 Ga0500616_0019750
781 Ga0500638_035857
782 Ga0530510_0121611
783 2871481788
784 2503203433
785 2509115849
786 2509373301
787 2509397859
788 2510316432
789 2512929684
790 2512964455
791 2513608328
792 2514037012
793 2514416763
794 2514591695
795 2588515266
796 2597815150
797 2599939979
798 2643774060
799 2643774835
800 2643793279
801 2643838671
802 2643988975
803 2644132785
804 2644152160
805 2688600266
806 2694631773
807 2694639825
808 2723577548
809 2739306588
810 2756673174
811 2758641166
812 2792750909
813 2837682743
814 2841734572
815 2844005617
816 2844015582
817 2847671955
818 2847688182
819 2854913220
820 2856318315
821 2856324273
822 2856328568
823 2856338516
824 2856345572
825 2856353682
826 2856364782
827 2857354944
828 2869165527
829 2869170356
830 2869234903
831 2869242809
832 2869261299
833 2869270935
834 2869271810
835 2869281729
836 2869289769
837 2871431835
838 2871450746
839 2871456635
840 2871462010
841 2871468539
842 2871477930
843 2871494069
844 2871497482
845 2874112204
846 2874120432
847 2874127699
848 2874140606
849 2874155513
850 2874162370
851 2874166877
852 2874175309
853 2876366754
854 2876384867
855 2876390719
856 2876398717
857 2876400560
858 2876411506
859 2876420858
860 2876425792
861 2878037652
862 2878736690
863 2878742388
864 2878748441
865 2878756644
866 2878761700
867 2878768668
868 2878775165
869 2878787577
870 2881153809
871 2881157593
872 2881162953
873 2881846881
874 2881858618
875 2881866511
876 2882635391
877 2882917821
878 2885311743
879 2885316270
880 2885325669
881 2885345209
882 2885356195
883 2888341444
884 2888348599
885 2888350785
886 2889013127
887 2889022013
888 2889795423
889 2889920072
890 2903452930
891 2903502427
892 2903506117
893 2903524621
894 2903531136
895 2903542277
896 2904665249
897 2906312058
898 2906323796
899 2906331347
900 2906372403
901 2906384052
902 2906393009
903 2906397019
904 2906402482
905 2906408369
906 2906418352
907 2906433360
908 2913297539
909 2922152758
910 2922178208
911 2922183876
912 2922187327
913 2924710565
914 2924723750
915 2924726901
916 2924740415
917 2924746443
918 2924764488
919 2924780188
920 2924788233
921 2937818119
922 2937829125
923 2937842705
924 2937846675
925 2937850727
926 2937866725
927 2937872616
928 2937882708
929 2937973319
930 2937983321
931 2937996132
932 2938016710
933 2958037690
934 2958047401
935 2958050965
936 2958066071
937 2958074988
938 2958089833
939 2958098306
940 2958106295
941 2958108421
942 2958116855
943 2958123822
944 2958134142
945 2958139228
946 2958145911
947 2958166602
948 2958183788
949 2961081754
950 2961120249
951 2961138888
952 2961165068
953 2961172934
954 2961188158
955 2963649548
956 2965019892
957 2965026189
958 2965040771
959 2965047727
960 2965067013
961 2965094456
962 2965110460
963 2965117212
964 2967998145
965 2968008797
966 2968019475
967 2968084711
968 2968092281
969 2968116716
970 2968118471
971 2968131799
972 2968173469
973 2970472796
974 2970494789
975 2970505528
976 2970515819
977 2970529591
978 2970538880
979 2970550587
980 2970556558
981 2970596332
982 2970620274
983 2970633717
984 2977825824
985 2977830081
986 2977851215
987 2977856250
988 2977869424
989 2977875044
990 2977906226
991 2977921404
992 2977927584
993 2977939732
994 2977947173
995 2977952082
996 2977958458
997 2977979010
998 2977990821
999 2979710983
1000 2979743165
1001 2979767589
1002 2979785987
1003 2979798349
1004 2979810249
1005 2987643546
1006 2987647080
1007 2987654741
1008 2987661076
1009 2987672669
1010 2987673768
1011 2989354299
1012 2996313197
1013 2996340204
1014 2996348622
1015 2996352085
1016 2996392031
1017 3000141986
1018 3003932550
1019 3004171049
1020 3004190126
1021 3004201830
1022 3004207091
1023 3004214515
1024 3004219196
1025 3004237308
1026 3004240071
1027 3004248861
1028 3004273419
1029 3004278783
1030 3004295055
1031 3004339263
1032 637079428
1033 649874737
1034 8002287945
1035 8004301536
1036 8004317345
1037 8004369103
1038 8004378232
1039 8004391647
1040 8004633761
1041 8004641337
1042 8004710737
1043 8004717016
1044 8004732785
1045 8019661387
1046 8055622828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

84

293

0.99

PF16327

CcmF_C

Cytochrome c-type biogenesis protein CcmF C-terminal

310

636

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8363 2 623
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8181 2 623
2duu-assembly2.cif.gz_O crystal structure of apo-form of nadp-dependent glyceraldehyde-3-phosphate dehydrogenase from synechococcus sp. 0.5442 588 620
1jn0-assembly1.cif.gz_A crystal structure of the non-regulatory a4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with nadp 0.5348 589 619
2pkr-assembly1.cif.gz_Q crystal structure of (a+cte)4 chimeric form of photosyntetic glyceraldehyde-3-phosphate dehydrogenase, complexed with nadp 0.5315 589 619
ID Description Score Start End Superfamily
af_P91345_169_448_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5642 508 554 3.90.190.10
3caxA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.53 2 161 1.20.120.520
af_Q8MYN1_1050_1343_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5296 513 560 3.90.190.10
af_Q9U1Q9_1006_1244_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5122 509 560 3.90.190.10
af_Q95XJ2_996_1266_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.4815 509 560 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A5H7IQD1-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.9587 73 318 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-E6YGT2-F1-model_v4 Cytochrome C-type biogenesis protein 0.9505 5 629 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A529NU93-F1-model_v4 Heme lyase NrfEFG subunit NrfE 0.9498 106 326 GO:0005886
GO:0015232
GO:0016829
GO:0017004
GO:0020037
AF-A0A379W726-F1-model_v4 Cytochrome c heme lyase subunit CcmF 0.9494 74 371 GO:0005886
GO:0015232
GO:0016829
GO:0017004
GO:0020037
AF-A0A2N6B3E0-F1-model_v4 Cytochrome c-type biogenesis protein 0.9485 2 641 GO:0005886
GO:0015232
GO:0016829
GO:0017004
GO:0020037
GO:0046872

Map