F459078

General Info

Members Datasets Scaffolds Average Seq Length
523 266 520 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|644736347|644751340
Length 181
Sequence RYWAAPEPAAAKPVRNEETPMKLQLKINGKRHAVDAERDMPLLWVLRDYLGYTGTKFGCGAGLCGACTVHVDGKAVRACITPVGTVARADITTIEGLSVDNSHPVQRAWIAEQVPQCGYCQPGMIMAACAFLKDNPMPRPEDVRAGITNLCRCGTYPRVERAILRAATALNAGEPKGRASS

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
87 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
186 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
187 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
188 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
189 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
190 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.76
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0.57
Rhizoplane 6.88
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10008344 3300002459 Bacteria 2118
2 Ga0070658_10028759 3300005327 Bacteria 4462
3 Ga0070658_10056818 3300005327 Bacteria 3182
4 Ga0070658_10242715 3300005327 Bacteria 1527
5 Ga0070683_100060646 3300005329 Bacteria 3516
6 Ga0070683_100076390 3300005329 Bacteria 3131
7 Ga0070683_100154338 3300005329 Bacteria 2177
8 Ga0070683_100236987 3300005329 Bacteria 1735
9 Ga0070683_100332970 3300005329 Bacteria 1445
10 Ga0070683_100906757 3300005329 Bacteria 845
11 Ga0070670_100124879 3300005331 Bacteria 2221
12 Ga0070670_100488391 3300005331 Bacteria 1094
13 Ga0070670_100778902 3300005331 Bacteria 863
14 Ga0070666_10177875 3300005335 Bacteria 1491
15 Ga0070680_100426163 3300005336 Bacteria 1132
16 Ga0070682_100144056 3300005337 Bacteria 1627
17 Ga0068868_100041545 3300005338 Bacteria 3583
18 Ga0068868_100382738 3300005338 Bacteria 1211
19 Ga0068868_101005540 3300005338 Bacteria 763
20 Ga0068868_102219673 3300005338 Bacteria 523
21 Ga0070660_100004686 3300005339 Bacteria 9468
22 Ga0070689_100740577 3300005340 Bacteria 861
23 Ga0070691_10001238 3300005341 Bacteria 10761
24 Ga0070661_100014709 3300005344 Bacteria 5518
25 Ga0070661_100153625 3300005344 Bacteria 1741
26 Ga0070661_100251270 3300005344 Bacteria 1364
27 Ga0070692_10022576 3300005345 Bacteria 3074
28 Ga0070668_100638142 3300005347 Bacteria 935
29 Ga0070668_100972083 3300005347 Bacteria 762
30 Ga0070669_100600703 3300005353 Bacteria 922
31 Ga0070675_100070318 3300005354 Bacteria 2900
32 Ga0070675_100135939 3300005354 Bacteria 2098
33 Ga0070675_100576121 3300005354 Bacteria 1019
34 Ga0070671_100164344 3300005355 Bacteria 1877
35 Ga0070674_100024475 3300005356 Bacteria 3918
36 Ga0070674_100592000 3300005356 Bacteria 936
37 Ga0070674_100622569 3300005356 Bacteria 915
38 Ga0070674_100715699 3300005356 Bacteria 857
39 Ga0070673_100018293 3300005364 Bacteria 5001
40 Ga0070673_100052387 3300005364 Bacteria 3202
41 Ga0070673_100767481 3300005364 Bacteria 889
42 Ga0070673_101101753 3300005364 Bacteria 742
43 Ga0070688_100479810 3300005365 Bacteria 934
44 Ga0070659_100054025 3300005366 Bacteria 3163
45 Ga0070659_100621271 3300005366 Bacteria 930
46 Ga0070667_100290859 3300005367 Bacteria 1469
47 Ga0070667_100545753 3300005367 Bacteria 1065
48 Ga0070701_10003360 3300005438 Bacteria 6318
49 Ga0070705_100148375 3300005440 Bacteria 1552
50 Ga0070700_100762404 3300005441 Bacteria 775
51 Ga0070694_100251963 3300005444 Bacteria 1336
52 Ga0070663_100144391 3300005455 Bacteria 1820
53 Ga0070678_100043118 3300005456 Bacteria 3212
54 Ga0070678_100258575 3300005456 Bacteria 1463
55 Ga0070678_101131627 3300005456 Bacteria 724
56 Ga0070662_100053334 3300005457 Bacteria 2926
57 Ga0070662_100183820 3300005457 Bacteria 1649
58 Ga0070681_10154466 3300005458 Bacteria 2221
59 Ga0068867_100043815 3300005459 Bacteria 3276
60 Ga0068867_100910650 3300005459 Bacteria 792
61 Ga0070685_10083614 3300005466 Bacteria 1918
62 Ga0070685_10476747 3300005466 Bacteria 879
63 Ga0070706_101564790 3300005467 Bacteria 602
64 Ga0070706_101742852 3300005467 Bacteria 567
65 Ga0070699_100975459 3300005518 Bacteria 777
66 Ga0070679_100221790 3300005530 Bacteria 1851
67 Ga0070684_100058245 3300005535 Bacteria 3376
68 Ga0070684_100166083 3300005535 Bacteria 2003
69 Ga0070684_100195568 3300005535 Bacteria 1841
70 Ga0070697_100250641 3300005536 Bacteria 1514
71 Ga0068853_100018683 3300005539 Bacteria 5740
72 Ga0068853_100106303 3300005539 Bacteria 2487
73 Ga0070672_100051648 3300005543 Bacteria 3207
74 Ga0070672_100303136 3300005543 Bacteria 1355
75 Ga0070672_100710233 3300005543 Bacteria 880
76 Ga0070686_100033362 3300005544 Bacteria 3163
77 Ga0070686_100425093 3300005544 Bacteria 1016
78 Ga0070696_100023307 3300005546 Bacteria 4207
79 Ga0070696_100787633 3300005546 Bacteria 782
80 Ga0070693_100028511 3300005547 Bacteria 3036
81 Ga0070665_100092614 3300005548 Bacteria 3027
82 Ga0070665_100417489 3300005548 Bacteria 1350
83 Ga0070704_100016961 3300005549 Bacteria 4618
84 Ga0070704_100106164 3300005549 Bacteria 2128
85 Ga0068855_100140921 3300005563 Bacteria 2749
86 Ga0070664_100126373 3300005564 Bacteria 2243
87 Ga0070664_100205771 3300005564 Bacteria 1757
88 Ga0070664_101546718 3300005564 Bacteria 628
89 Ga0068857_100071647 3300005577 Bacteria 3088
90 Ga0068857_100236872 3300005577 Bacteria 1670
91 Ga0068857_100747237 3300005577 Bacteria 932
92 Ga0068854_100027354 3300005578 Bacteria 3930
93 Ga0068856_100547063 3300005614 Bacteria 1179
94 Ga0070702_100044645 3300005615 Bacteria 2503
95 Ga0070702_100185281 3300005615 Bacteria 1365
96 Ga0070702_100397558 3300005615 Bacteria 985
97 Ga0068852_100041156 3300005616 Bacteria 3903
98 Ga0068852_100332174 3300005616 Bacteria 1479
99 Ga0068859_100074199 3300005617 Bacteria 3440
100 Ga0068864_100015387 3300005618 Bacteria 6361
101 Ga0068864_100141749 3300005618 Bacteria 2169
102 Ga0068864_100296911 3300005618 Bacteria 1512
103 Ga0068861_100058556 3300005719 Bacteria 2946
104 Ga0068851_10098871 3300005834 Bacteria 1545
105 Ga0068870_10035545 3300005840 Bacteria 2557
106 Ga0068863_100203462 3300005841 Bacteria 1905
107 Ga0068863_100874659 3300005841 Bacteria 898
108 Ga0068858_100763109 3300005842 Bacteria 943
109 Ga0068860_100197903 3300005843 Bacteria 1946
110 Ga0068860_100391872 3300005843 Bacteria 1373
111 Ga0068862_100319069 3300005844 Bacteria 1434
112 Ga0081455_10069535 3300005937 Bacteria 2927
113 Ga0081455_10134702 3300005937 Bacteria 1927
114 Ga0075365_10117500 3300006038 Bacteria 1832
115 Ga0075432_10079549 3300006058 Bacteria 1187
116 Ga0068871_100028349 3300006358 Bacteria 4389
117 Ga0068871_100040104 3300006358 Bacteria 3750
118 Ga0075428_100023563 3300006844 Bacteria 6814
119 Ga0075428_101313782 3300006844 Bacteria 760
120 Ga0075431_100166010 3300006847 Bacteria 2269
121 Ga0075433_10174705 3300006852 Bacteria 1911
122 Ga0075429_100033517 3300006880 Bacteria 4463
123 Ga0075429_100033971 3300006880 Bacteria 4431
124 Ga0068865_100021316 3300006881 Bacteria 4212
125 Ga0068865_100322120 3300006881 Bacteria 1244
126 Ga0068865_100657220 3300006881 Bacteria 891
127 Ga0075436_100658139 3300006914 Bacteria 774
128 Ga0097620_100074199 3300006931 Bacteria 3440
129 Ga0105240_10051692 3300009093 Bacteria 5169
130 Ga0105240_10161322 3300009093 Bacteria 2662
131 Ga0105240_10447125 3300009093 Bacteria 1447
132 Ga0105245_10023925 3300009098 Bacteria 5361
133 Ga0105245_10084735 3300009098 Bacteria 2904
134 Ga0105245_10111204 3300009098 Bacteria 2547
135 Ga0105245_10202847 3300009098 Bacteria 1905
136 Ga0105245_10347847 3300009098 Bacteria 1468
137 Ga0105245_11107388 3300009098 Bacteria 838
138 Ga0105245_11799602 3300009098 Bacteria 665
139 Ga0105247_10016412 3300009101 Bacteria 4437
140 Ga0105247_10156390 3300009101 Bacteria 1506
141 Ga0114129_10044878 3300009147 Bacteria 6216
142 Ga0114129_10303666 3300009147 Bacteria 2126
143 Ga0114129_10708755 3300009147 Bacteria 1293
144 Ga0114129_10731778 3300009147 Bacteria 1268
145 Ga0114129_11396741 3300009147 Bacteria 864
146 Ga0105243_10016636 3300009148 Bacteria 5562
147 Ga0105243_10017347 3300009148 Bacteria 5442
148 Ga0105243_10133513 3300009148 Bacteria 2109
149 Ga0105243_10348826 3300009148 Bacteria 1358
150 Ga0105243_11830913 3300009148 Bacteria 639
151 Ga0105241_11515381 3300009174 Bacteria 646
152 Ga0105242_10055837 3300009176 Bacteria 3231
153 Ga0105242_10058043 3300009176 Bacteria 3171
154 Ga0105242_10079888 3300009176 Bacteria 2732
155 Ga0105242_10371992 3300009176 Bacteria 1326
156 Ga0105242_10554574 3300009176 Bacteria 1102
157 Ga0105248_10020955 3300009177 Bacteria 7246
158 Ga0105248_10594208 3300009177 Bacteria 1249
159 Ga0105248_10794119 3300009177 Bacteria 1068
160 Ga0105237_10081750 3300009545 Bacteria 3222
161 Ga0105237_10565393 3300009545 Bacteria 1144
162 Ga0105237_11559023 3300009545 Bacteria 667
163 Ga0105238_10013503 3300009551 Bacteria 8246
164 Ga0105238_10922905 3300009551 Bacteria 892
165 Ga0105238_11321362 3300009551 Bacteria 747
166 Ga0105239_10123050 3300010375 Bacteria 2883
167 Ga0105239_10232038 3300010375 Bacteria 2070
168 Ga0105239_10467448 3300010375 Bacteria 1432
169 Ga0105239_11267783 3300010375 Bacteria 850
170 Ga0105246_10056040 3300011119 Bacteria 2723
171 Ga0105246_10350794 3300011119 Bacteria 1209
172 Ga0105246_10555413 3300011119 Bacteria 985
173 Ga0105246_10614043 3300011119 Bacteria 941
174 Ga0157320_1008564 3300012481 Bacteria 756
175 Ga0157321_1011304 3300012487 Bacteria 695
176 Ga0157342_1004253 3300012507 Bacteria 1262
177 Ga0157371_10041681 3300013102 Bacteria 3275
178 Ga0157371_10099569 3300013102 Bacteria 2061
179 Ga0157370_10251529 3300013104 Bacteria 1634
180 Ga0157370_10255148 3300013104 Bacteria 1622
181 Ga0157369_10087965 3300013105 Bacteria 3316
182 Ga0157378_10802196 3300013297 Bacteria 967
183 Ga0157378_13076052 3300013297 Bacteria 518
184 Ga0163162_10625545 3300013306 Bacteria 1201
185 Ga0163162_10969331 3300013306 Bacteria 961
186 Ga0163162_11911477 3300013306 Bacteria 679
187 Ga0157372_10009445 3300013307 Bacteria 10376
188 Ga0157372_10105468 3300013307 Bacteria 3223
189 Ga0157375_10029312 3300013308 Bacteria 5173
190 Ga0157375_10041884 3300013308 Bacteria 4427
191 Ga0163163_10007040 3300014325 Bacteria 9883
192 Ga0163163_10116296 3300014325 Bacteria 2705
193 Ga0163163_10760342 3300014325 Bacteria 1032
194 Ga0157380_10341302 3300014326 Bacteria 1397
195 Ga0157380_12058810 3300014326 Bacteria 633
196 Ga0157377_10032618 3300014745 Bacteria 2837
197 Ga0157377_10033970 3300014745 Bacteria 2788
198 Ga0157379_10032751 3300014968 Bacteria 4635
199 Ga0157379_10153273 3300014968 Bacteria 2079
200 Ga0157376_10018213 3300014969 Bacteria 5377
201 Ga0157376_10111123 3300014969 Bacteria 2412
202 Ga0157376_10695677 3300014969 Bacteria 1021
203 Ga0163161_10017266 3300017792 Bacteria 5049
204 Ga0197907_11185842 3300020069 Bacteria 563
205 Ga0206356_10423462 3300020070 Bacteria 3473
206 Ga0206356_11649714 3300020070 Bacteria 646
207 Ga0206353_10010347 3300020082 Bacteria 1029
208 Ga0207656_10063602 3300025321 Bacteria 1624
209 Ga0207656_10183953 3300025321 Bacteria 1004
210 Ga0207653_10009216 3300025885 Bacteria 3076
211 Ga0207682_10192220 3300025893 Bacteria 936
212 Ga0207710_10376965 3300025900 Bacteria 726
213 Ga0207688_10197087 3300025901 Bacteria 1206
214 Ga0207680_10134445 3300025903 Bacteria 1633
215 Ga0207680_10557364 3300025903 Bacteria 818
216 Ga0207647_10109262 3300025904 Bacteria 1636
217 Ga0207645_10226488 3300025907 Bacteria 1233
218 Ga0207643_10298640 3300025908 Bacteria 1002
219 Ga0207705_10071706 3300025909 Bacteria 2511
220 Ga0207684_10915995 3300025910 Bacteria 736
221 Ga0207654_10394219 3300025911 Bacteria 961
222 Ga0207654_10836704 3300025911 Bacteria 666
223 Ga0207707_10054831 3300025912 Bacteria 3469
224 Ga0207695_10102914 3300025913 Bacteria 2848
225 Ga0207660_10117696 3300025917 Bacteria 2009
226 Ga0207660_10392519 3300025917 Bacteria 1117
227 Ga0207657_10003899 3300025919 Bacteria 15830
228 Ga0207657_10096050 3300025919 Bacteria 2465
229 Ga0207657_10100723 3300025919 Bacteria 2398
230 Ga0207649_10006520 3300025920 Bacteria 6341
231 Ga0207649_10304552 3300025920 Bacteria 1166
232 Ga0207649_10590606 3300025920 Bacteria 853
233 Ga0207652_10037736 3300025921 Bacteria 4090
234 Ga0207681_10099449 3300025923 Bacteria 2095
235 Ga0207681_11275960 3300025923 Bacteria 617
236 Ga0207694_10380618 3300025924 Bacteria 1171
237 Ga0207694_10430491 3300025924 Bacteria 1100
238 Ga0207694_11096938 3300025924 Bacteria 674
239 Ga0207659_10092959 3300025926 Bacteria 2256
240 Ga0207687_10013736 3300025927 Bacteria 5288
241 Ga0207687_10016661 3300025927 Bacteria 4829
242 Ga0207687_10142698 3300025927 Bacteria 1819
243 Ga0207687_10212582 3300025927 Bacteria 1518
244 Ga0207644_10066346 3300025931 Bacteria 2628
245 Ga0207644_11544993 3300025931 Bacteria 557
246 Ga0207690_10335931 3300025932 Bacteria 1191
247 Ga0207706_10025020 3300025933 Bacteria 5353
248 Ga0207709_10073411 3300025935 Bacteria 2180
249 Ga0207670_10034221 3300025936 Bacteria 3281
250 Ga0207669_10149972 3300025937 Bacteria 1632
251 Ga0207669_10599572 3300025937 Bacteria 895
252 Ga0207669_10602795 3300025937 Bacteria 893
253 Ga0207669_11603503 3300025937 Bacteria 555
254 Ga0207704_10208415 3300025938 Bacteria 1436
255 Ga0207691_10012064 3300025940 Bacteria 8290
256 Ga0207691_10107668 3300025940 Bacteria 2481
257 Ga0207711_10184292 3300025941 Bacteria 1900
258 Ga0207711_10312454 3300025941 Bacteria 1451
259 Ga0207711_10352632 3300025941 Bacteria 1362
260 Ga0207689_10286399 3300025942 Bacteria 1364
261 Ga0207661_10000612 3300025944 Bacteria 22876
262 Ga0207661_10036867 3300025944 Bacteria 3820
263 Ga0207661_10112769 3300025944 Bacteria 2302
264 Ga0207661_10192037 3300025944 Bacteria 1791
265 Ga0207679_10032672 3300025945 Bacteria 3656
266 Ga0207667_10112125 3300025949 Bacteria 2813
267 Ga0207651_10034406 3300025960 Bacteria 3281
268 Ga0207668_10748690 3300025972 Bacteria 862
269 Ga0207668_10796851 3300025972 Bacteria 836
270 Ga0207668_11647449 3300025972 Bacteria 579
271 Ga0207640_10029860 3300025981 Bacteria 3351
272 Ga0207640_10090400 3300025981 Bacteria 2119
273 Ga0207658_10171285 3300025986 Bacteria 1789
274 Ga0207658_10332570 3300025986 Bacteria 1318
275 Ga0207658_10884541 3300025986 Bacteria 813
276 Ga0207677_10063520 3300026023 Bacteria 2567
277 Ga0207677_10180059 3300026023 Bacteria 1662
278 Ga0207677_10385422 3300026023 Bacteria 1184
279 Ga0207677_10943416 3300026023 Bacteria 780
280 Ga0207677_11658810 3300026023 Bacteria 592
281 Ga0207703_10209426 3300026035 Bacteria 1737
282 Ga0207639_10043499 3300026041 Bacteria 3372
283 Ga0207639_10623234 3300026041 Bacteria 996
284 Ga0207678_10023034 3300026067 Bacteria 5450
285 Ga0207678_10252108 3300026067 Bacteria 1512
286 Ga0207678_10799359 3300026067 Bacteria 833
287 Ga0207708_10018168 3300026075 Bacteria 5293
288 Ga0207702_10257448 3300026078 Bacteria 1642
289 Ga0207641_10281253 3300026088 Bacteria 1565
290 Ga0207641_10557397 3300026088 Bacteria 1118
291 Ga0207648_10051981 3300026089 Bacteria 3582
292 Ga0207648_10117585 3300026089 Bacteria 2336
293 Ga0207648_10136343 3300026089 Bacteria 2162
294 Ga0207648_10284913 3300026089 Bacteria 1478
295 Ga0207676_10130427 3300026095 Bacteria 2136
296 Ga0207676_11485750 3300026095 Bacteria 674
297 Ga0207674_10031518 3300026116 Bacteria 5569
298 Ga0207674_10051257 3300026116 Bacteria 4212
299 Ga0207674_10150529 3300026116 Bacteria 2284
300 Ga0207675_100080618 3300026118 Bacteria 3051
301 Ga0207675_100447890 3300026118 Bacteria 1279
302 Ga0207683_10004422 3300026121 Bacteria 12149
303 Ga0207683_10148772 3300026121 Bacteria 2113
304 Ga0207683_10295919 3300026121 Bacteria 1481
305 Ga0207683_11130678 3300026121 Bacteria 726
306 Ga0207698_10003410 3300026142 Bacteria 9566
307 Ga0207698_10923958 3300026142 Bacteria 881
308 Ga0207698_10937676 3300026142 Bacteria 874
309 Ga0207428_10192889 3300027907 Bacteria 1535
310 Ga0268266_10013084 3300028379 Bacteria 7155
311 Ga0268266_10443083 3300028379 Bacteria 1234
312 Ga0268266_10513609 3300028379 Bacteria 1145
313 Ga0268264_10074484 3300028381 Bacteria 2884
314 Ga0268264_10366227 3300028381 Bacteria 1376
315 Ga0268264_10574287 3300028381 Bacteria 1108
316 Ga0268256_1038324 3300030500 Bacteria 1091
317 Ga0265325_10002730 3300031241 Bacteria 11787
318 Ga0265339_10386699 3300031249 Bacteria 655
319 Ga0265331_10087071 3300031250 Bacteria 1447
320 Ga0265314_10301065 3300031711 Bacteria 900
321 Ga0307406_10412973 3300031901 Bacteria 1073
322 Ga0307409_100507249 3300031995 Bacteria 1176
323 Ga0307416_101087250 3300032002 Bacteria 904
324 Ga0373948_0117426 3300034817 Bacteria 640
325 Ga0373952_0053518 3300035092 Bacteria 969
326 Ga0373954_0468802 3300035118 Bacteria 624
327 Ga0373955_0322230 3300035172 Bacteria 934
328 Ga0373924_0207974 3300035410 Bacteria 864
329 Ga0373947_0431025 3300035725 Bacteria 892
330 Ga0373937_1183005 3300036401 Bacteria 713
331 Ga0373925_0167162 3300037068 Bacteria 1735
332 Ga0395899_0077938 3300037312 Bacteria 2416
333 Ga0395900_0028676 3300037418 Bacteria 5705
334 Ga0395900_0096561 3300037418 Bacteria 3036
335 Ga0395898_0195827 3300037466 Bacteria 1930
336 Ga0395901_0625807 3300038443 Bacteria 1082
337 Ga0242420_022267 3300038996 Bacteria 1139
338 Ga0451802_0780308 3300041460 Bacteria 2533
339 Ga0451806_598508 3300041462 Bacteria 3344
340 Ga0451804_0405045 3300041463 Bacteria 1586
341 Ga0451807_2427642 3300041486 Bacteria 1318
342 Ga0451835_0134562 3300041492 Bacteria 1092
343 Ga0450914_007942 3300042118 Bacteria 970
344 Ga0450920_002200 3300042122 Bacteria 3301
345 Ga0450920_011995 3300042122 Bacteria 1621
346 Ga0450903_038151 3300042138 Bacteria 714
347 Ga0450889_022828 3300042144 Bacteria 703
348 Ga0450906_011271 3300042145 Bacteria 1674
349 Ga0450908_086376 3300042184 Bacteria 566
350 Ga0466967_0392406 3300045976 Bacteria 1349
351 Ga0495629_0505546 3300046459 Bacteria 815
352 Ga0495653_0111342 3300046463 Bacteria 1967
353 Ga0495605_0167380 3300046474 Bacteria 973
354 Ga0495585_0177134 3300046492 Bacteria 1098
355 Ga0495594_0237099 3300046499 Bacteria 1040
356 Ga0495596_0155507 3300046500 Bacteria 888
357 Ga0495630_0355195 3300046517 Bacteria 1122
358 Ga0495637_0195970 3300046520 Bacteria 744
359 Ga0495644_0077450 3300046523 Bacteria 1253
360 Ga0495633_0136397 3300046558 Bacteria 1135
361 Ga0495635_0269920 3300046663 Bacteria 1144
362 Ga0495658_0139862 3300046683 Bacteria 1480
363 Ga0495613_0171116 3300046689 Bacteria 1542
364 Ga0495670_0242750 3300046691 Bacteria 959
365 Ga0495670_0256573 3300046691 Bacteria 933
366 Ga0495670_0339276 3300046691 Bacteria 808
367 Ga0495589_0289274 3300046794 Bacteria 761
368 Ga0495600_0518898 3300046809 Bacteria 731
369 Ga0495683_0167571 3300047323 Bacteria 1012
370 Ga0495684_0477198 3300047471 Bacteria 862
371 Ga0496101_0135694 3300048904 Bacteria 1872
372 Ga0496101_0171055 3300048904 Bacteria 1670
373 Ga0496101_1122356 3300048904 Bacteria 617
374 Ga0496101_1339070 3300048904 Bacteria 559
375 Ga0496102_0191596 3300048905 Bacteria 1927
376 Ga0496104_0091178 3300048907 Bacteria 2913
377 Ga0496104_0472593 3300048907 Bacteria 1165
378 Ga0496104_0661702 3300048907 Bacteria 953
379 Ga0496105_0052455 3300048908 Bacteria 3369
380 Ga0496105_0081155 3300048908 Bacteria 2679
381 Ga0496106_0454296 3300048909 Bacteria 1029
382 Ga0496106_1194684 3300048909 Bacteria 593
383 Ga0496107_0518884 3300048910 Bacteria 883
384 Ga0496108_0019446 3300048911 Bacteria 5578
385 Ga0496109_0002689 3300048912 Bacteria 14909
386 Ga0496109_0090253 3300048912 Bacteria 2834
387 Ga0496109_0090877 3300048912 Bacteria 2824
388 Ga0496109_0180292 3300048912 Bacteria 1983
389 Ga0496109_1778717 3300048912 Bacteria 549
390 Ga0496110_0220142 3300048913 Bacteria 1726
391 Ga0496111_0003152 3300048914 Bacteria 10149
392 Ga0496111_0171064 3300048914 Bacteria 1614
393 Ga0496111_0765033 3300048914 Bacteria 700
394 Ga0496112_0795999 3300048915 Bacteria 870
395 Ga0496113_0150395 3300048916 Bacteria 1836
396 Ga0496113_0539975 3300048916 Bacteria 935
397 Ga0496114_0048670 3300048917 Bacteria 3526
398 Ga0496114_0068122 3300048917 Bacteria 2987
399 Ga0496114_0172327 3300048917 Bacteria 1886
400 Ga0496114_0342865 3300048917 Bacteria 1321
401 Ga0496114_1466348 3300048917 Bacteria 570
402 Ga0496115_0072007 3300048918 Bacteria 2804
403 Ga0496124_0086918 3300048927 Bacteria 2558
404 Ga0501031_0015630 3300049568 Bacteria 4927
405 Ga0501031_0029334 3300049568 Bacteria 3589
406 Ga0501032_0099603 3300049569 Bacteria 1925
407 Ga0501033_0048185 3300049570 Bacteria 3165
408 Ga0501034_1362656 3300049571 Bacteria 585
409 Ga0501036_0029538 3300049572 Bacteria 4630
410 Ga0501036_0038625 3300049572 Bacteria 4040
411 Ga0501036_0718318 3300049572 Bacteria 825
412 Ga0501037_0025296 3300049573 Bacteria 4385
413 Ga0501037_0681712 3300049573 Bacteria 685
414 Ga0501038_0002057 3300049574 Bacteria 18626
415 Ga0501038_0085943 3300049574 Bacteria 2644
416 Ga0501039_0016341 3300049575 Bacteria 5687
417 Ga0501039_0166079 3300049575 Bacteria 1735
418 Ga0501040_0026574 3300049576 Bacteria 3893
419 Ga0501040_0062134 3300049576 Bacteria 2570
420 Ga0501040_0164912 3300049576 Bacteria 1567
421 Ga0501040_0291525 3300049576 Bacteria 1166
422 Ga0501040_0365713 3300049576 Bacteria 1034
423 Ga0501041_0010597 3300049577 Bacteria 5434
424 Ga0501041_0030300 3300049577 Bacteria 3266
425 Ga0501041_0192717 3300049577 Bacteria 1277
426 Ga0501041_0370357 3300049577 Bacteria 906
427 Ga0501042_0009155 3300049578 Bacteria 6585
428 Ga0501042_0115592 3300049578 Bacteria 1932
429 Ga0501042_0139413 3300049578 Bacteria 1748
430 Ga0501042_0538960 3300049578 Bacteria 848
431 Ga0501043_0010538 3300049579 Bacteria 7237
432 Ga0501043_1093732 3300049579 Bacteria 564
433 Ga0501046_0266074 3300049580 Bacteria 1258
434 Ga0501046_0534920 3300049580 Bacteria 837
435 Ga0501046_1140576 3300049580 Bacteria 537
436 Ga0501048_0012115 3300049582 Bacteria 6426
437 Ga0501048_0074741 3300049582 Bacteria 2391
438 Ga0501048_1125091 3300049582 Bacteria 565
439 Ga0501068_0009535 3300049584 Bacteria 5435
440 Ga0501069_0018992 3300049585 Bacteria 3712
441 Ga0501069_0391283 3300049585 Bacteria 822
442 Ga0501070_0014080 3300049586 Bacteria 6733
443 Ga0501071_0009102 3300049587 Bacteria 6593
444 Ga0501071_0057452 3300049587 Bacteria 2812
445 Ga0501071_0070959 3300049587 Bacteria 2539
446 Ga0501071_0119589 3300049587 Bacteria 1952
447 Ga0501071_0166559 3300049587 Bacteria 1649
448 Ga0501071_0310384 3300049587 Bacteria 1197
449 Ga0501071_0489051 3300049587 Bacteria 943
450 Ga0501072_0023714 3300049588 Bacteria 4767
451 Ga0501072_0062147 3300049588 Bacteria 2946
452 Ga0501072_0130038 3300049588 Bacteria 2006
453 Ga0501072_0407090 3300049588 Bacteria 1079
454 Ga0501072_0587924 3300049588 Bacteria 878
455 Ga0501073_0056873 3300049589 Bacteria 2735
456 Ga0501073_0384861 3300049589 Bacteria 969
457 Ga0501074_0043103 3300049590 Bacteria 3265
458 Ga0501074_0058249 3300049590 Bacteria 2783
459 Ga0501075_0014619 3300049591 Bacteria 5625
460 Ga0501075_0039365 3300049591 Bacteria 3539
461 Ga0501075_0271972 3300049591 Bacteria 1291
462 Ga0501075_0350695 3300049591 Bacteria 1124
463 Ga0501075_0358243 3300049591 Bacteria 1112
464 Ga0501076_0038684 3300049592 Bacteria 3745
465 Ga0501076_0041475 3300049592 Bacteria 3621
466 Ga0501076_0092256 3300049592 Bacteria 2436
467 Ga0501076_0112120 3300049592 Bacteria 2206
468 Ga0501076_0353967 3300049592 Bacteria 1206
469 Ga0501076_0683455 3300049592 Bacteria 847
470 Ga0501076_0821297 3300049592 Bacteria 767
471 Ga0501077_0127135 3300049593 Bacteria 1615
472 Ga0501077_0498060 3300049593 Bacteria 781
473 Ga0501079_0014596 3300049741 Bacteria 5990
474 Ga0501079_0064351 3300049741 Bacteria 2829
475 Ga0501079_0143702 3300049741 Bacteria 1859
476 Ga0501079_0215928 3300049741 Bacteria 1498
477 Ga0501079_0358664 3300049741 Bacteria 1142
478 Ga0501079_0798585 3300049741 Bacteria 743
479 Ga0501080_0029553 3300049742 Bacteria 5102
480 Ga0501080_0370348 3300049742 Bacteria 1292
481 Ga0501080_0653620 3300049742 Bacteria 930
482 Ga0501081_0007368 3300049743 Bacteria 7141
483 Ga0501081_0017118 3300049743 Bacteria 4795
484 Ga0501081_0107584 3300049743 Bacteria 1977
485 Ga0501081_0577330 3300049743 Bacteria 841
486 Ga0501083_0006865 3300049744 Bacteria 8081
487 Ga0501083_0126702 3300049744 Bacteria 1674
488 Ga0501035_0001451 3300049822 Bacteria 24293
489 Ga0501035_0511204 3300049822 Bacteria 988
490 Ga0501035_0674057 3300049822 Bacteria 836
491 Ga0501044_0207323 3300049823 Bacteria 1916
492 Ga0501045_0016072 3300049824 Bacteria 5310
493 Ga0501045_0023232 3300049824 Bacteria 4443
494 Ga0501045_0038712 3300049824 Bacteria 3469
495 nmdc:mga0yw44_100924_c1 3300050492 Bacteria 1838
496 nmdc:mga05p37_169125_c1 3300050507 Bacteria 1447
497 nmdc:mga05p37_286231_c1 3300050507 Bacteria 1963
498 nmdc:mga05p37_989323_c1 3300050507 Bacteria 895
499 nmdc:mga09592_261880_c1 3300050508 Bacteria 1500
500 nmdc:mga0qj67_167532_c1 3300050509 Bacteria 1784
501 nmdc:mga06r32_112753_c1 3300050510 Bacteria 2676
502 nmdc:mga06r32_1429420_c1 3300050510 Bacteria 633
503 nmdc:mga08y16_114200_c1 3300050511 Bacteria 2811
504 Ga0501084_0028648 3300054114 Bacteria 4656
505 Ga0501084_0081533 3300054114 Bacteria 2714
506 Ga0501084_0108456 3300054114 Bacteria 2332
507 Ga0501084_0343205 3300054114 Bacteria 1261
508 Ga0501084_0412356 3300054114 Bacteria 1142
509 Ga0501084_0638693 3300054114 Bacteria 899
510 Ga0501084_0957740 3300054114 Bacteria 719
511 Ga0501082_0072498 3300060353 Bacteria 2967
512 Ga0501082_0105271 3300060353 Bacteria 2440
513 Ga0501082_0186292 3300060353 Bacteria 1806
514 Ga0501082_0272937 3300060353 Bacteria 1472
515 Ga0501082_0390689 3300060353 Bacteria 1214
516 Ga0501082_0609197 3300060353 Bacteria 956
517 Ga0530510_0020335 3300061734 Bacteria 4720
518 Ga0530510_0070530 3300061734 Bacteria 2536
519 Ga0530510_0167903 3300061734 Bacteria 1625
520 Ga0530510_0621019 3300061734 Bacteria 822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_0405045 Ga0451804_0405045_1173_1574 127
2 3300050492 nmdc:mga0yw44_100924_c1 nmdc:mga0yw44_100924_c1_297_692 127
3 3300046517 Ga0495630_0355195 Ga0495630_0355195_13_429 130
4 3300049576 Ga0501040_0291525 Ga0501040_0291525_223_681 132
5 3300049577 Ga0501041_0370357 Ga0501041_0370357_141_599 132
6 3300049587 Ga0501071_0489051 Ga0501071_0489051_85_543 132
7 3300049591 Ga0501075_0271972 Ga0501075_0271972_706_1164 132
8 3300049741 Ga0501079_0798585 Ga0501079_0798585_135_593 132
9 3300049742 Ga0501080_0370348 Ga0501080_0370348_71_529 132
10 3300060353 Ga0501082_0072498 Ga0501082_0072498_714_1172 132
11 3300049568 Ga0501031_0029334 Ga0501031_0029334_489_947 138
12 3300049572 Ga0501036_0038625 Ga0501036_0038625_2462_2920 138
13 3300049574 Ga0501038_0085943 Ga0501038_0085943_2037_2495 138
14 3300049575 Ga0501039_0166079 Ga0501039_0166079_544_1002 138
15 3300049576 Ga0501040_0164912 Ga0501040_0164912_544_1002 138
16 3300049577 Ga0501041_0030300 Ga0501041_0030300_2348_2806 138
17 3300049579 Ga0501043_1093732 Ga0501043_1093732_59_517 138
18 3300049582 Ga0501048_0074741 Ga0501048_0074741_1589_2047 138
19 3300049587 Ga0501071_0119589 Ga0501071_0119589_1315_1773 138
20 3300049588 Ga0501072_0062147 Ga0501072_0062147_1963_2421 138
21 3300049589 Ga0501073_0384861 Ga0501073_0384861_445_903 138
22 3300049591 Ga0501075_0014619 Ga0501075_0014619_4856_5314 138
23 3300049592 Ga0501076_0092256 Ga0501076_0092256_175_633 138
24 3300049741 Ga0501079_0358664 Ga0501079_0358664_236_694 138
25 3300049743 Ga0501081_0017118 Ga0501081_0017118_1938_2396 138
26 3300049822 Ga0501035_0674057 Ga0501035_0674057_280_738 138
27 3300049824 Ga0501045_0016072 Ga0501045_0016072_3244_3702 138
28 3300054114 Ga0501084_0108456 Ga0501084_0108456_1734_2192 138
29 3300049573 Ga0501037_0681712 Ga0501037_0681712_140_601 139
30 3300048907 Ga0496104_0472593 Ga0496104_0472593_23_469 140
31 3300048909 Ga0496106_1194684 Ga0496106_1194684_130_576 141
32 3300005518 Ga0070699_100975459 Ga0070699_1009754592 147
33 3300020069 Ga0197907_11185842 Ga0197907_111858421 147
34 3300025904 Ga0207647_10109262 Ga0207647_101092621 147
35 3300037312 Ga0395899_0077938 Ga0395899_0077938_886_1338 147
36 3300037418 Ga0395900_0096561 Ga0395900_0096561_1053_1505 147
37 3300037466 Ga0395898_0195827 Ga0395898_0195827_1026_1478 147
38 3300038443 Ga0395901_0625807 Ga0395901_0625807_575_1027 147
39 3300005331 Ga0070670_100778902 Ga0070670_1007789022 148
40 3300005338 Ga0068868_102219673 Ga0068868_1022196731 148
41 3300005347 Ga0070668_100638142 Ga0070668_1006381421 148
42 3300005364 Ga0070673_101101753 Ga0070673_1011017532 148
43 3300005456 Ga0070678_100258575 Ga0070678_1002585752 148
44 3300006058 Ga0075432_10079549 Ga0075432_100795492 148
45 3300006852 Ga0075433_10174705 Ga0075433_101747052 148
46 3300009148 Ga0105243_10348826 Ga0105243_103488263 148
47 3300009148 Ga0105243_11830913 Ga0105243_118309131 148
48 3300009176 Ga0105242_10371992 Ga0105242_103719922 148
49 3300013297 Ga0157378_10802196 Ga0157378_108021962 148
50 3300013306 Ga0163162_10969331 Ga0163162_109693311 148
51 3300026023 Ga0207677_11658810 Ga0207677_116588101 148
52 3300026121 Ga0207683_10295919 Ga0207683_102959192 148
53 3300037418 Ga0395900_0028676 Ga0395900_0028676_1332_1784 148
54 3300038996 Ga0242420_022267 Ga0242420_022267_392_844 148
55 3300046499 Ga0495594_0237099 Ga0495594_0237099_120_572 148
56 3300046691 Ga0495670_0339276 Ga0495670_0339276_158_610 148
57 3300048904 Ga0496101_0135694 Ga0496101_0135694_1367_1819 148
58 3300048904 Ga0496101_1122356 Ga0496101_1122356_59_511 148
59 3300048905 Ga0496102_0191596 Ga0496102_0191596_812_1264 148
60 3300048910 Ga0496107_0518884 Ga0496107_0518884_350_802 148
61 3300048912 Ga0496109_0090877 Ga0496109_0090877_79_531 148
62 iso_pu_bacteria 2513237150 2513955634 148
63 iso_pu_bacteria 2513237165 2514041945 148
64 3300005331 Ga0070670_100488391 Ga0070670_1004883912 149
65 3300005347 Ga0070668_100972083 Ga0070668_1009720832 149
66 3300005354 Ga0070675_100135939 Ga0070675_1001359392 149
67 3300005356 Ga0070674_100592000 Ga0070674_1005920001 149
68 3300005366 Ga0070659_100621271 Ga0070659_1006212712 149
69 3300005367 Ga0070667_100545753 Ga0070667_1005457532 149
70 3300005456 Ga0070678_101131627 Ga0070678_1011316271 149
71 3300005466 Ga0070685_10476747 Ga0070685_104767472 149
72 3300005543 Ga0070672_100051648 Ga0070672_1000516483 149
73 3300005544 Ga0070686_100425093 Ga0070686_1004250932 149
74 3300005564 Ga0070664_101546718 Ga0070664_1015467181 149
75 3300005615 Ga0070702_100397558 Ga0070702_1003975581 149
76 3300005841 Ga0068863_100203462 Ga0068863_1002034622 149
77 3300005843 Ga0068860_100391872 Ga0068860_1003918722 149
78 3300006881 Ga0068865_100322120 Ga0068865_1003221202 149
79 3300006914 Ga0075436_100658139 Ga0075436_1006581391 149
80 3300009148 Ga0105243_10017347 Ga0105243_100173475 149
81 3300009177 Ga0105248_10594208 Ga0105248_105942082 149
82 3300009551 Ga0105238_10922905 Ga0105238_109229052 149
83 3300010375 Ga0105239_11267783 Ga0105239_112677832 149
84 3300013306 Ga0163162_10625545 Ga0163162_106255452 149
85 3300013308 Ga0157375_10029312 Ga0157375_100293121 149
86 3300014326 Ga0157380_10341302 Ga0157380_103413022 149
87 3300014968 Ga0157379_10032751 Ga0157379_100327511 149
88 3300014969 Ga0157376_10111123 Ga0157376_101111234 149
89 3300025908 Ga0207643_10298640 Ga0207643_102986402 149
90 3300025920 Ga0207649_10590606 Ga0207649_105906062 149
91 3300025931 Ga0207644_11544993 Ga0207644_115449931 149
92 3300025935 Ga0207709_10073411 Ga0207709_100734113 149
93 3300025938 Ga0207704_10208415 Ga0207704_102084152 149
94 3300025940 Ga0207691_10012064 Ga0207691_100120649 149
95 3300025941 Ga0207711_10184292 Ga0207711_101842922 149
96 3300025972 Ga0207668_10796851 Ga0207668_107968512 149
97 3300025986 Ga0207658_10884541 Ga0207658_108845412 149
98 3300026067 Ga0207678_10799359 Ga0207678_107993592 149
99 3300026075 Ga0207708_10018168 Ga0207708_100181685 149
100 3300026088 Ga0207641_10557397 Ga0207641_105573972 149
101 3300026089 Ga0207648_10136343 Ga0207648_101363432 149
102 3300026121 Ga0207683_11130678 Ga0207683_111306782 149
103 3300028379 Ga0268266_10443083 Ga0268266_104430832 149
104 3300028381 Ga0268264_10366227 Ga0268264_103662272 149
105 3300046474 Ga0495605_0167380 Ga0495605_0167380_22_477 149
106 3300046500 Ga0495596_0155507 Ga0495596_0155507_66_521 149
107 3300046794 Ga0495589_0289274 Ga0495589_0289274_161_616 149
108 3300047323 Ga0495683_0167571 Ga0495683_0167571_169_624 149
109 3300048907 Ga0496104_0091178 Ga0496104_0091178_846_1301 149
110 3300048912 Ga0496109_0090253 Ga0496109_0090253_1875_2330 149
111 3300049568 Ga0501031_0015630 Ga0501031_0015630_2278_2733 149
112 3300049569 Ga0501032_0099603 Ga0501032_0099603_184_639 149
113 3300049570 Ga0501033_0048185 Ga0501033_0048185_1742_2197 149
114 3300049571 Ga0501034_1362656 Ga0501034_1362656_48_503 149
115 3300049572 Ga0501036_0029538 Ga0501036_0029538_3053_3508 149
116 3300049573 Ga0501037_0025296 Ga0501037_0025296_3859_4314 149
117 3300049574 Ga0501038_0002057 Ga0501038_0002057_13369_13824 149
118 3300049575 Ga0501039_0016341 Ga0501039_0016341_2734_3189 149
119 3300049576 Ga0501040_0026574 Ga0501040_0026574_2817_3272 149
120 3300049577 Ga0501041_0010597 Ga0501041_0010597_2044_2499 149
121 3300049578 Ga0501042_0009155 Ga0501042_0009155_1328_1783 149
122 3300049579 Ga0501043_0010538 Ga0501043_0010538_3809_4264 149
123 3300049580 Ga0501046_0266074 Ga0501046_0266074_393_848 149
124 3300049582 Ga0501048_0012115 Ga0501048_0012115_3227_3682 149
125 3300049584 Ga0501068_0009535 Ga0501068_0009535_3257_3712 149
126 3300049585 Ga0501069_0018992 Ga0501069_0018992_3102_3557 149
127 3300049586 Ga0501070_0014080 Ga0501070_0014080_4396_4851 149
128 3300049587 Ga0501071_0009102 Ga0501071_0009102_2278_2733 149
129 3300049587 Ga0501071_0166559 Ga0501071_0166559_1051_1509 149
130 3300049588 Ga0501072_0130038 Ga0501072_0130038_429_884 149
131 3300049589 Ga0501073_0056873 Ga0501073_0056873_1275_1730 149
132 3300049590 Ga0501074_0043103 Ga0501074_0043103_928_1383 149
133 3300049591 Ga0501075_0350695 Ga0501075_0350695_479_934 149
134 3300049592 Ga0501076_0041475 Ga0501076_0041475_2970_3425 149
135 3300049593 Ga0501077_0127135 Ga0501077_0127135_539_994 149
136 3300049741 Ga0501079_0014596 Ga0501079_0014596_2011_2466 149
137 3300049741 Ga0501079_0215928 Ga0501079_0215928_1018_1473 149
138 3300049742 Ga0501080_0029553 Ga0501080_0029553_2924_3379 149
139 3300049743 Ga0501081_0007368 Ga0501081_0007368_3909_4364 149
140 3300049744 Ga0501083_0006865 Ga0501083_0006865_4146_4601 149
141 3300049822 Ga0501035_0001451 Ga0501035_0001451_5943_6398 149
142 3300049823 Ga0501044_0207323 Ga0501044_0207323_133_588 149
143 3300049824 Ga0501045_0023232 Ga0501045_0023232_2278_2733 149
144 3300054114 Ga0501084_0028648 Ga0501084_0028648_2278_2733 149
145 3300060353 Ga0501082_0105271 Ga0501082_0105271_1724_2179 149
146 3300061734 Ga0530510_0070530 Ga0530510_0070530_199_654 149
147 3300005327 Ga0070658_10028759 Ga0070658_100287593 150
148 3300005327 Ga0070658_10242715 Ga0070658_102427152 150
149 3300005329 Ga0070683_100076390 Ga0070683_1000763904 150
150 3300005329 Ga0070683_100154338 Ga0070683_1001543382 150
151 3300005329 Ga0070683_100236987 Ga0070683_1002369872 150
152 3300005329 Ga0070683_100332970 Ga0070683_1003329702 150
153 3300005329 Ga0070683_100906757 Ga0070683_1009067572 150
154 3300005336 Ga0070680_100426163 Ga0070680_1004261632 150
155 3300005337 Ga0070682_100144056 Ga0070682_1001440562 150
156 3300005338 Ga0068868_100041545 Ga0068868_1000415453 150
157 3300005338 Ga0068868_100382738 Ga0068868_1003827382 150
158 3300005339 Ga0070660_100004686 Ga0070660_1000046862 150
159 3300005341 Ga0070691_10001238 Ga0070691_100012389 150
160 3300005344 Ga0070661_100014709 Ga0070661_1000147093 150
161 3300005344 Ga0070661_100153625 Ga0070661_1001536252 150
162 3300005344 Ga0070661_100251270 Ga0070661_1002512702 150
163 3300005345 Ga0070692_10022576 Ga0070692_100225763 150
164 3300005353 Ga0070669_100600703 Ga0070669_1006007032 150
165 3300005354 Ga0070675_100070318 Ga0070675_1000703182 150
166 3300005354 Ga0070675_100576121 Ga0070675_1005761212 150
167 3300005355 Ga0070671_100164344 Ga0070671_1001643442 150
168 3300005356 Ga0070674_100024475 Ga0070674_1000244754 150
169 3300005356 Ga0070674_100622569 Ga0070674_1006225692 150
170 3300005356 Ga0070674_100715699 Ga0070674_1007156991 150
171 3300005364 Ga0070673_100018293 Ga0070673_1000182934 150
172 3300005364 Ga0070673_100052387 Ga0070673_1000523876 150
173 3300005365 Ga0070688_100479810 Ga0070688_1004798102 150
174 3300005366 Ga0070659_100054025 Ga0070659_1000540252 150
175 3300005438 Ga0070701_10003360 Ga0070701_100033609 150
176 3300005440 Ga0070705_100148375 Ga0070705_1001483752 150
177 3300005441 Ga0070700_100762404 Ga0070700_1007624041 150
178 3300005455 Ga0070663_100144391 Ga0070663_1001443912 150
179 3300005456 Ga0070678_100043118 Ga0070678_1000431182 150
180 3300005457 Ga0070662_100053334 Ga0070662_1000533343 150
181 3300005457 Ga0070662_100183820 Ga0070662_1001838202 150
182 3300005458 Ga0070681_10154466 Ga0070681_101544664 150
183 3300005459 Ga0068867_100043815 Ga0068867_1000438153 150
184 3300005459 Ga0068867_100910650 Ga0068867_1009106501 150
185 3300005466 Ga0070685_10083614 Ga0070685_100836144 150
186 3300005530 Ga0070679_100221790 Ga0070679_1002217902 150
187 3300005535 Ga0070684_100058245 Ga0070684_1000582452 150
188 3300005535 Ga0070684_100166083 Ga0070684_1001660832 150
189 3300005535 Ga0070684_100195568 Ga0070684_1001955682 150
190 3300005536 Ga0070697_100250641 Ga0070697_1002506411 150
191 3300005539 Ga0068853_100018683 Ga0068853_1000186834 150
192 3300005539 Ga0068853_100106303 Ga0068853_1001063032 150
193 3300005543 Ga0070672_100303136 Ga0070672_1003031362 150
194 3300005543 Ga0070672_100710233 Ga0070672_1007102332 150
195 3300005544 Ga0070686_100033362 Ga0070686_1000333623 150
196 3300005546 Ga0070696_100023307 Ga0070696_1000233073 150
197 3300005546 Ga0070696_100787633 Ga0070696_1007876331 150
198 3300005547 Ga0070693_100028511 Ga0070693_1000285113 150
199 3300005548 Ga0070665_100092614 Ga0070665_1000926144 150
200 3300005549 Ga0070704_100016961 Ga0070704_1000169611 150
201 3300005563 Ga0068855_100140921 Ga0068855_1001409212 150
202 3300005564 Ga0070664_100126373 Ga0070664_1001263732 150
203 3300005564 Ga0070664_100205771 Ga0070664_1002057712 150
204 3300005577 Ga0068857_100071647 Ga0068857_1000716472 150
205 3300005577 Ga0068857_100747237 Ga0068857_1007472372 150
206 3300005578 Ga0068854_100027354 Ga0068854_1000273544 150
207 3300005614 Ga0068856_100547063 Ga0068856_1005470632 150
208 3300005615 Ga0070702_100044645 Ga0070702_1000446452 150
209 3300005615 Ga0070702_100185281 Ga0070702_1001852812 150
210 3300005616 Ga0068852_100041156 Ga0068852_1000411562 150
211 3300005616 Ga0068852_100332174 Ga0068852_1003321742 150
212 3300005617 Ga0068859_100074199 Ga0068859_1000741992 150
213 3300005618 Ga0068864_100015387 Ga0068864_1000153872 150
214 3300005618 Ga0068864_100141749 Ga0068864_1001417492 150
215 3300005719 Ga0068861_100058556 Ga0068861_1000585563 150
216 3300005834 Ga0068851_10098871 Ga0068851_100988712 150
217 3300005840 Ga0068870_10035545 Ga0068870_100355454 150
218 3300005843 Ga0068860_100197903 Ga0068860_1001979034 150
219 3300005844 Ga0068862_100319069 Ga0068862_1003190693 150
220 3300005937 Ga0081455_10134702 Ga0081455_101347022 150
221 3300006358 Ga0068871_100040104 Ga0068871_1000401042 150
222 3300006881 Ga0068865_100021316 Ga0068865_1000213164 150
223 3300006881 Ga0068865_100657220 Ga0068865_1006572202 150
224 3300006931 Ga0097620_100074199 Ga0097620_1000741992 150
225 3300009093 Ga0105240_10447125 Ga0105240_104471253 150
226 3300009098 Ga0105245_10084735 Ga0105245_100847352 150
227 3300009098 Ga0105245_10202847 Ga0105245_102028472 150
228 3300009098 Ga0105245_10347847 Ga0105245_103478472 150
229 3300009101 Ga0105247_10016412 Ga0105247_100164122 150
230 3300009147 Ga0114129_10731778 Ga0114129_107317782 150
231 3300009147 Ga0114129_11396741 Ga0114129_113967412 150
232 3300009148 Ga0105243_10016636 Ga0105243_100166364 150
233 3300009148 Ga0105243_10133513 Ga0105243_101335132 150
234 3300009174 Ga0105241_11515381 Ga0105241_115153811 150
235 3300009176 Ga0105242_10055837 Ga0105242_100558372 150
236 3300009176 Ga0105242_10079888 Ga0105242_100798882 150
237 3300009545 Ga0105237_10565393 Ga0105237_105653932 150
238 3300009545 Ga0105237_11559023 Ga0105237_115590231 150
239 3300009551 Ga0105238_10013503 Ga0105238_100135034 150
240 3300010375 Ga0105239_10123050 Ga0105239_101230502 150
241 3300010375 Ga0105239_10467448 Ga0105239_104674482 150
242 3300011119 Ga0105246_10056040 Ga0105246_100560404 150
243 3300011119 Ga0105246_10350794 Ga0105246_103507942 150
244 3300011119 Ga0105246_10555413 Ga0105246_105554131 150
245 3300011119 Ga0105246_10614043 Ga0105246_106140432 150
246 3300012481 Ga0157320_1008564 Ga0157320_10085641 150
247 3300012487 Ga0157321_1011304 Ga0157321_10113042 150
248 3300012507 Ga0157342_1004253 Ga0157342_10042532 150
249 3300013102 Ga0157371_10041681 Ga0157371_100416812 150
250 3300013102 Ga0157371_10099569 Ga0157371_100995692 150
251 3300013104 Ga0157370_10251529 Ga0157370_102515292 150
252 3300013104 Ga0157370_10255148 Ga0157370_102551482 150
253 3300013105 Ga0157369_10087965 Ga0157369_100879652 150
254 3300013297 Ga0157378_13076052 Ga0157378_130760521 150
255 3300013307 Ga0157372_10009445 Ga0157372_100094459 150
256 3300013307 Ga0157372_10105468 Ga0157372_101054684 150
257 3300013308 Ga0157375_10041884 Ga0157375_100418844 150
258 3300014325 Ga0163163_10760342 Ga0163163_107603422 150
259 3300014745 Ga0157377_10032618 Ga0157377_100326182 150
260 3300014745 Ga0157377_10033970 Ga0157377_100339704 150
261 3300017792 Ga0163161_10017266 Ga0163161_100172662 150
262 3300020070 Ga0206356_10423462 Ga0206356_104234621 150
263 3300020070 Ga0206356_11649714 Ga0206356_116497142 150
264 3300020082 Ga0206353_10010347 Ga0206353_100103472 150
265 3300025321 Ga0207656_10063602 Ga0207656_100636022 150
266 3300025321 Ga0207656_10183953 Ga0207656_101839532 150
267 3300025885 Ga0207653_10009216 Ga0207653_100092162 150
268 3300025893 Ga0207682_10192220 Ga0207682_101922202 150
269 3300025900 Ga0207710_10376965 Ga0207710_103769652 150
270 3300025901 Ga0207688_10197087 Ga0207688_101970872 150
271 3300025903 Ga0207680_10557364 Ga0207680_105573642 150
272 3300025907 Ga0207645_10226488 Ga0207645_102264882 150
273 3300025909 Ga0207705_10071706 Ga0207705_100717063 150
274 3300025911 Ga0207654_10394219 Ga0207654_103942192 150
275 3300025911 Ga0207654_10836704 Ga0207654_108367041 150
276 3300025912 Ga0207707_10054831 Ga0207707_100548312 150
277 3300025917 Ga0207660_10117696 Ga0207660_101176962 150
278 3300025917 Ga0207660_10392519 Ga0207660_103925192 150
279 3300025919 Ga0207657_10003899 Ga0207657_100038993 150
280 3300025919 Ga0207657_10096050 Ga0207657_100960505 150
281 3300025919 Ga0207657_10100723 Ga0207657_101007232 150
282 3300025920 Ga0207649_10006520 Ga0207649_100065204 150
283 3300025920 Ga0207649_10304552 Ga0207649_103045522 150
284 3300025921 Ga0207652_10037736 Ga0207652_100377363 150
285 3300025923 Ga0207681_11275960 Ga0207681_112759601 150
286 3300025924 Ga0207694_10380618 Ga0207694_103806182 150
287 3300025924 Ga0207694_10430491 Ga0207694_104304912 150
288 3300025926 Ga0207659_10092959 Ga0207659_100929592 150
289 3300025927 Ga0207687_10013736 Ga0207687_100137362 150
290 3300025927 Ga0207687_10142698 Ga0207687_101426983 150
291 3300025927 Ga0207687_10212582 Ga0207687_102125822 150
292 3300025931 Ga0207644_10066346 Ga0207644_100663464 150
293 3300025932 Ga0207690_10335931 Ga0207690_103359311 150
294 3300025933 Ga0207706_10025020 Ga0207706_100250202 150
295 3300025936 Ga0207670_10034221 Ga0207670_100342212 150
296 3300025937 Ga0207669_10149972 Ga0207669_101499722 150
297 3300025937 Ga0207669_10599572 Ga0207669_105995722 150
298 3300025937 Ga0207669_10602795 Ga0207669_106027952 150
299 3300025937 Ga0207669_11603503 Ga0207669_116035031 150
300 3300025940 Ga0207691_10107668 Ga0207691_101076682 150
301 3300025941 Ga0207711_10352632 Ga0207711_103526322 150
302 3300025942 Ga0207689_10286399 Ga0207689_102863992 150
303 3300025944 Ga0207661_10000612 Ga0207661_1000061210 150
304 3300025944 Ga0207661_10036867 Ga0207661_100368672 150
305 3300025944 Ga0207661_10112769 Ga0207661_101127693 150
306 3300025945 Ga0207679_10032672 Ga0207679_100326723 150
307 3300025949 Ga0207667_10112125 Ga0207667_101121252 150
308 3300025960 Ga0207651_10034406 Ga0207651_100344062 150
309 3300025972 Ga0207668_10748690 Ga0207668_107486902 150
310 3300025972 Ga0207668_11647449 Ga0207668_116474491 150
311 3300025981 Ga0207640_10029860 Ga0207640_100298603 150
312 3300025981 Ga0207640_10090400 Ga0207640_100904002 150
313 3300025986 Ga0207658_10171285 Ga0207658_101712852 150
314 3300026023 Ga0207677_10063520 Ga0207677_100635202 150
315 3300026023 Ga0207677_10180059 Ga0207677_101800591 150
316 3300026023 Ga0207677_10385422 Ga0207677_103854222 150
317 3300026041 Ga0207639_10043499 Ga0207639_100434993 150
318 3300026067 Ga0207678_10023034 Ga0207678_100230342 150
319 3300026067 Ga0207678_10252108 Ga0207678_102521082 150
320 3300026088 Ga0207641_10281253 Ga0207641_102812531 150
321 3300026089 Ga0207648_10051981 Ga0207648_100519812 150
322 3300026089 Ga0207648_10117585 Ga0207648_101175852 150
323 3300026089 Ga0207648_10284913 Ga0207648_102849131 150
324 3300026095 Ga0207676_10130427 Ga0207676_101304271 150
325 3300026116 Ga0207674_10031518 Ga0207674_100315185 150
326 3300026116 Ga0207674_10051257 Ga0207674_100512573 150
327 3300026118 Ga0207675_100080618 Ga0207675_1000806182 150
328 3300026121 Ga0207683_10004422 Ga0207683_100044229 150
329 3300026121 Ga0207683_10148772 Ga0207683_101487723 150
330 3300026142 Ga0207698_10003410 Ga0207698_100034102 150
331 3300026142 Ga0207698_10923958 Ga0207698_109239582 150
332 3300026142 Ga0207698_10937676 Ga0207698_109376761 150
333 3300027907 Ga0207428_10192889 Ga0207428_101928893 150
334 3300028379 Ga0268266_10513609 Ga0268266_105136092 150
335 3300028381 Ga0268264_10074484 Ga0268264_100744844 150
336 3300028381 Ga0268264_10574287 Ga0268264_105742872 150
337 3300031901 Ga0307406_10412973 Ga0307406_104129732 150
338 3300031995 Ga0307409_100507249 Ga0307409_1005072492 150
339 3300032002 Ga0307416_101087250 Ga0307416_1010872502 150
340 3300034817 Ga0373948_0117426 Ga0373948_0117426_83_541 150
341 3300035092 Ga0373952_0053518 Ga0373952_0053518_380_838 150
342 3300041460 Ga0451802_0780308 Ga0451802_0780308_735_1205 150
343 3300041462 Ga0451806_598508 Ga0451806_598508_1502_1972 150
344 3300041486 Ga0451807_2427642 Ga0451807_2427642_651_1121 150
345 3300041492 Ga0451835_0134562 Ga0451835_0134562_494_964 150
346 3300042118 Ga0450914_007942 Ga0450914_007942_386_844 150
347 3300042122 Ga0450920_002200 Ga0450920_002200_353_811 150
348 3300042122 Ga0450920_011995 Ga0450920_011995_708_1166 150
349 3300042138 Ga0450903_038151 Ga0450903_038151_132_590 150
350 3300042144 Ga0450889_022828 Ga0450889_022828_220_678 150
351 3300042145 Ga0450906_011271 Ga0450906_011271_860_1318 150
352 3300042184 Ga0450908_086376 Ga0450908_086376_29_487 150
353 3300045976 Ga0466967_0392406 Ga0466967_0392406_845_1303 150
354 3300046520 Ga0495637_0195970 Ga0495637_0195970_81_545 150
355 3300046691 Ga0495670_0256573 Ga0495670_0256573_359_817 150
356 3300048904 Ga0496101_0171055 Ga0496101_0171055_858_1316 150
357 3300048907 Ga0496104_0661702 Ga0496104_0661702_345_803 150
358 3300048908 Ga0496105_0052455 Ga0496105_0052455_1038_1496 150
359 3300048908 Ga0496105_0081155 Ga0496105_0081155_164_622 150
360 3300048909 Ga0496106_0454296 Ga0496106_0454296_338_796 150
361 3300048911 Ga0496108_0019446 Ga0496108_0019446_1977_2435 150
362 3300048912 Ga0496109_0002689 Ga0496109_0002689_1714_2172 150
363 3300048912 Ga0496109_0180292 Ga0496109_0180292_54_512 150
364 3300048912 Ga0496109_1778717 Ga0496109_1778717_54_512 150
365 3300048913 Ga0496110_0220142 Ga0496110_0220142_824_1282 150
366 3300048914 Ga0496111_0003152 Ga0496111_0003152_5834_6292 150
367 3300048914 Ga0496111_0171064 Ga0496111_0171064_304_762 150
368 3300048914 Ga0496111_0765033 Ga0496111_0765033_140_598 150
369 3300048915 Ga0496112_0795999 Ga0496112_0795999_384_842 150
370 3300048916 Ga0496113_0150395 Ga0496113_0150395_119_577 150
371 3300048916 Ga0496113_0539975 Ga0496113_0539975_443_901 150
372 3300048917 Ga0496114_0068122 Ga0496114_0068122_343_801 150
373 3300048917 Ga0496114_0172327 Ga0496114_0172327_822_1280 150
374 3300048917 Ga0496114_0342865 Ga0496114_0342865_206_664 150
375 3300048917 Ga0496114_1466348 Ga0496114_1466348_38_496 150
376 3300049572 Ga0501036_0718318 Ga0501036_0718318_320_805 150
377 3300049576 Ga0501040_0062134 Ga0501040_0062134_1661_2146 150
378 3300049578 Ga0501042_0115592 Ga0501042_0115592_425_910 150
379 3300049578 Ga0501042_0139413 Ga0501042_0139413_1218_1676 150
380 3300049578 Ga0501042_0538960 Ga0501042_0538960_341_799 150
381 3300049580 Ga0501046_0534920 Ga0501046_0534920_91_549 150
382 3300049580 Ga0501046_1140576 Ga0501046_1140576_41_514 150
383 3300049582 Ga0501048_1125091 Ga0501048_1125091_55_513 150
384 3300049585 Ga0501069_0391283 Ga0501069_0391283_201_659 150
385 3300049587 Ga0501071_0057452 Ga0501071_0057452_557_1015 150
386 3300049587 Ga0501071_0070959 Ga0501071_0070959_393_878 150
387 3300049588 Ga0501072_0023714 Ga0501072_0023714_1994_2452 150
388 3300049590 Ga0501074_0058249 Ga0501074_0058249_351_809 150
389 3300049591 Ga0501075_0039365 Ga0501075_0039365_384_842 150
390 3300049592 Ga0501076_0038684 Ga0501076_0038684_2033_2491 150
391 3300049592 Ga0501076_0112120 Ga0501076_0112120_645_1130 150
392 3300049592 Ga0501076_0683455 Ga0501076_0683455_150_608 150
393 3300049741 Ga0501079_0064351 Ga0501079_0064351_1908_2366 150
394 3300049741 Ga0501079_0143702 Ga0501079_0143702_96_581 150
395 3300049742 Ga0501080_0653620 Ga0501080_0653620_28_486 150
396 3300049822 Ga0501035_0511204 Ga0501035_0511204_405_890 150
397 3300049824 Ga0501045_0038712 Ga0501045_0038712_1463_1921 150
398 3300050507 nmdc:mga05p37_286231_c1 nmdc:mga05p37_286231_c1_144_602 150
399 3300054114 Ga0501084_0081533 Ga0501084_0081533_440_898 150
400 3300054114 Ga0501084_0343205 Ga0501084_0343205_377_835 150
401 3300054114 Ga0501084_0957740 Ga0501084_0957740_13_498 150
402 3300060353 Ga0501082_0186292 Ga0501082_0186292_29_487 150
403 3300060353 Ga0501082_0272937 Ga0501082_0272937_739_1212 150
404 3300060353 Ga0501082_0390689 Ga0501082_0390689_687_1145 150
405 3300061734 Ga0530510_0020335 Ga0530510_0020335_534_992 150
406 3300061734 Ga0530510_0167903 Ga0530510_0167903_184_642 150
407 3300005937 Ga0081455_10069535 Ga0081455_100695352 151
408 3300006038 Ga0075365_10117500 Ga0075365_101175002 151
409 3300006844 Ga0075428_101313782 Ga0075428_1013137822 151
410 3300006847 Ga0075431_100166010 Ga0075431_1001660102 151
411 3300006880 Ga0075429_100033517 Ga0075429_1000335174 151
412 3300009098 Ga0105245_11107388 Ga0105245_111073882 151
413 3300009147 Ga0114129_10303666 Ga0114129_103036662 151
414 3300031241 Ga0265325_10002730 Ga0265325_100027307 151
415 3300046492 Ga0495585_0177134 Ga0495585_0177134_235_702 151
416 3300046523 Ga0495644_0077450 Ga0495644_0077450_471_938 151
417 3300046558 Ga0495633_0136397 Ga0495633_0136397_632_1099 151
418 3300046691 Ga0495670_0242750 Ga0495670_0242750_314_781 151
419 3300048927 Ga0496124_0086918 Ga0496124_0086918_813_1286 151
420 3300049577 Ga0501041_0192717 Ga0501041_0192717_577_1053 151
421 3300049588 Ga0501072_0407090 Ga0501072_0407090_170_637 151
422 3300049592 Ga0501076_0821297 Ga0501076_0821297_46_522 151
423 3300049743 Ga0501081_0107584 Ga0501081_0107584_88_564 151
424 3300049744 Ga0501083_0126702 Ga0501083_0126702_684_1151 151
425 3300050508 nmdc:mga09592_261880_c1 nmdc:mga09592_261880_c1_438_905 151
426 3300050509 nmdc:mga0qj67_167532_c1 nmdc:mga0qj67_167532_c1_1140_1607 151
427 3300050510 nmdc:mga06r32_112753_c1 nmdc:mga06r32_112753_c1_481_948 151
428 3300054114 Ga0501084_0412356 Ga0501084_0412356_25_501 151
429 3300060353 Ga0501082_0609197 Ga0501082_0609197_99_566 151
430 3300061734 Ga0530510_0621019 Ga0530510_0621019_28_495 151
431 3300026041 Ga0207639_10623234 Ga0207639_106232342 152
432 3300030500 Ga0268256_1038324 Ga0268256_10383242 152
433 3300009177 Ga0105248_10794119 Ga0105248_107941192 153
434 3300025923 Ga0207681_10099449 Ga0207681_100994492 153
435 3300049587 Ga0501071_0310384 Ga0501071_0310384_111_572 153
436 iso_pu_bacteria 644736347 644751340 153
437 3300005327 Ga0070658_10056818 Ga0070658_100568183 154
438 3300005335 Ga0070666_10177875 Ga0070666_101778752 154
439 3300005338 Ga0068868_101005540 Ga0068868_1010055402 154
440 3300005364 Ga0070673_100767481 Ga0070673_1007674812 154
441 3300005367 Ga0070667_100290859 Ga0070667_1002908592 154
442 3300005467 Ga0070706_101564790 Ga0070706_1015647901 154
443 3300005548 Ga0070665_100417489 Ga0070665_1004174892 154
444 3300005618 Ga0068864_100296911 Ga0068864_1002969112 154
445 3300005842 Ga0068858_100763109 Ga0068858_1007631092 154
446 3300006358 Ga0068871_100028349 Ga0068871_1000283492 154
447 3300006844 Ga0075428_100023563 Ga0075428_1000235634 154
448 3300006880 Ga0075429_100033971 Ga0075429_1000339713 154
449 3300009093 Ga0105240_10161322 Ga0105240_101613222 154
450 3300009098 Ga0105245_10111204 Ga0105245_101112042 154
451 3300009098 Ga0105245_11799602 Ga0105245_117996022 154
452 3300009101 Ga0105247_10156390 Ga0105247_101563902 154
453 3300009147 Ga0114129_10044878 Ga0114129_100448783 154
454 3300009176 Ga0105242_10058043 Ga0105242_100580432 154
455 3300009177 Ga0105248_10020955 Ga0105248_100209552 154
456 3300009545 Ga0105237_10081750 Ga0105237_100817502 154
457 3300009551 Ga0105238_11321362 Ga0105238_113213621 154
458 3300010375 Ga0105239_10232038 Ga0105239_102320382 154
459 3300013306 Ga0163162_11911477 Ga0163162_119114771 154
460 3300014325 Ga0163163_10116296 Ga0163163_101162961 154
461 3300014968 Ga0157379_10153273 Ga0157379_101532732 154
462 3300014969 Ga0157376_10018213 Ga0157376_100182132 154
463 3300025903 Ga0207680_10134445 Ga0207680_101344452 154
464 3300025910 Ga0207684_10915995 Ga0207684_109159952 154
465 3300025924 Ga0207694_11096938 Ga0207694_110969381 154
466 3300025941 Ga0207711_10312454 Ga0207711_103124542 154
467 3300025986 Ga0207658_10332570 Ga0207658_103325702 154
468 3300026023 Ga0207677_10943416 Ga0207677_109434162 154
469 3300026035 Ga0207703_10209426 Ga0207703_102094262 154
470 3300026118 Ga0207675_100447890 Ga0207675_1004478901 154
471 3300028379 Ga0268266_10013084 Ga0268266_100130845 154
472 3300048904 Ga0496101_1339070 Ga0496101_1339070_35_523 154
473 3300048917 Ga0496114_0048670 Ga0496114_0048670_2449_2937 154
474 3300048918 Ga0496115_0072007 Ga0496115_0072007_2175_2663 154
475 3300049576 Ga0501040_0365713 Ga0501040_0365713_247_717 154
476 3300049591 Ga0501075_0358243 Ga0501075_0358243_540_1004 154
477 3300049592 Ga0501076_0353967 Ga0501076_0353967_377_841 154
478 3300050507 nmdc:mga05p37_169125_c1 nmdc:mga05p37_169125_c1_556_1020 154
479 3300050510 nmdc:mga06r32_1429420_c1 nmdc:mga06r32_1429420_c1_17_481 154
480 3300050511 nmdc:mga08y16_114200_c1 nmdc:mga08y16_114200_c1_44_508 154
481 3300002459 JGI24751J29686_10008344 JGI24751J29686_100083442 155
482 3300005329 Ga0070683_100060646 Ga0070683_1000606462 155
483 3300005331 Ga0070670_100124879 Ga0070670_1001248792 155
484 3300005340 Ga0070689_100740577 Ga0070689_1007405772 155
485 3300005444 Ga0070694_100251963 Ga0070694_1002519632 155
486 3300005467 Ga0070706_101742852 Ga0070706_1017428521 155
487 3300005549 Ga0070704_100106164 Ga0070704_1001061642 155
488 3300005577 Ga0068857_100236872 Ga0068857_1002368722 155
489 3300005841 Ga0068863_100874659 Ga0068863_1008746591 155
490 3300009093 Ga0105240_10051692 Ga0105240_100516922 155
491 3300009098 Ga0105245_10023925 Ga0105245_100239251 155
492 3300009147 Ga0114129_10708755 Ga0114129_107087553 155
493 3300009176 Ga0105242_10554574 Ga0105242_105545742 155
494 3300014325 Ga0163163_10007040 Ga0163163_100070402 155
495 3300014326 Ga0157380_12058810 Ga0157380_120588101 155
496 3300014969 Ga0157376_10695677 Ga0157376_106956772 155
497 3300025913 Ga0207695_10102914 Ga0207695_101029142 155
498 3300025927 Ga0207687_10016661 Ga0207687_100166613 155
499 3300025944 Ga0207661_10192037 Ga0207661_101920372 155
500 3300026078 Ga0207702_10257448 Ga0207702_102574482 155
501 3300026095 Ga0207676_11485750 Ga0207676_114857501 155
502 3300026116 Ga0207674_10150529 Ga0207674_101505291 155
503 3300031249 Ga0265339_10386699 Ga0265339_103866991 155
504 3300031250 Ga0265331_10087071 Ga0265331_100870711 155
505 3300031711 Ga0265314_10301065 Ga0265314_103010651 155
506 3300035118 Ga0373954_0468802 Ga0373954_0468802_53_544 155
507 3300035172 Ga0373955_0322230 Ga0373955_0322230_348_839 155
508 3300035410 Ga0373924_0207974 Ga0373924_0207974_351_842 155
509 3300035725 Ga0373947_0431025 Ga0373947_0431025_199_690 155
510 3300036401 Ga0373937_1183005 Ga0373937_1183005_21_512 155
511 3300037068 Ga0373925_0167162 Ga0373925_0167162_648_1139 155
512 3300046459 Ga0495629_0505546 Ga0495629_0505546_29_520 155
513 3300046463 Ga0495653_0111342 Ga0495653_0111342_599_1090 155
514 3300046663 Ga0495635_0269920 Ga0495635_0269920_471_962 155
515 3300046683 Ga0495658_0139862 Ga0495658_0139862_887_1378 155
516 3300046689 Ga0495613_0171116 Ga0495613_0171116_815_1306 155
517 3300046809 Ga0495600_0518898 Ga0495600_0518898_162_653 155
518 3300047471 Ga0495684_0477198 Ga0495684_0477198_169_660 155
519 3300049588 Ga0501072_0587924 Ga0501072_0587924_181_648 155
520 3300049593 Ga0501077_0498060 Ga0501077_0498060_93_560 155
521 3300049743 Ga0501081_0577330 Ga0501081_0577330_344_811 155
522 3300050507 nmdc:mga05p37_989323_c1 nmdc:mga05p37_989323_c1_350_817 155
523 3300054114 Ga0501084_0638693 Ga0501084_0638693_123_590 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

93

164

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

25

90

0.87

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

24

115

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9539 1 150
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.95 2 154
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9493 2 150
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9488 1 154
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.943 2 155
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9537 2 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9532 2 75 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9433 1 73 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9403 1 76 3.10.20.30
af_P22985_1_94_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9379 3 81 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A538PHS1-F1-model_v4 (2Fe-2S)-binding protein 0.9847 2 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V8M2P3-F1-model_v4 (2Fe-2S)-binding protein 0.9845 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V9DAT7-F1-model_v4 (2Fe-2S)-binding protein 0.983 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F2SC53-F1-model_v4 (2Fe-2S)-binding protein 0.9807 1 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1W6ZC29-F1-model_v4 (2Fe-2S)-binding protein 0.9796 2 152 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
95.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map