F459086

General Info

Members Datasets Scaffolds Average Seq Length
524 361 1048 303

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10003312|JGI25406J46586_100033128
Length 294
Sequence VTRSVDDTQRLLAGGGYVADRALATTVHLALRMGRPLLLEGEPGTGKTEIAKVLAAQLPRRLVRLQCYDGLDMSAAAYEWNHARQLMAIRLAEAAGETDRAALERGIYDRRYLQERPLLAALSGDPAVLLIDELDRADEPFEAFLLEILADFQITVPELGTIRTETPPVVIITSNRTREVHDAIRRRCLYHWVDYPDAARERAILRIRAPQVGEALSHQVVAFVQKLRQGDYFKLPGVAETIDWAAALAALDARALEPAVVDETLGVLLKYQDDIAKLKGAEAARLVAEAKDAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
281 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
282 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
283 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
289 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
290 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
291 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
292 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
293 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
294 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
295 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
296 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
297 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
298 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
299 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
300 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
301 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
302 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
303 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
304 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
305 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
306 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
307 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
308 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
309 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
310 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
311 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
312 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
313 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
314 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
315 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
316 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
317 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
318 2922368715
319 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
320 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
321 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
322 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
323 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
324 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
325 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
326 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
327 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
328 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
329 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
330 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
331 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
332 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
333 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
334 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
335 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
336 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
337 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
338 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
339 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
340 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
341 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
342 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
343 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
344 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
345 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
346 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
347 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
348 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
349 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
350 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
351 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
352 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
353 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
354 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
355 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
356 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
357 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
358 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
359 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
360 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
361 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.04
Metatranscriptomes 0
Isolates 13.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 10.11
Rhizoplane 0.76
Rhizosphere 68.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003312 3300003203 Bacteria 7583
2 JGI24750J21931_1002415 3300002070 Bacteria 2252
3 JGI24742J22300_10009151 3300002244 Bacteria 1633
4 JGI25406J46586_10003180 3300003203 Bacteria 7727
5 JGI25153J46596_10000156 3300003215 Bacteria 68489
6 Ga0055531_10006966 3300003794 Bacteria 6284
7 Ga0070670_100031733 3300005331 Bacteria 4550
8 Ga0070670_100036778 3300005331 Bacteria 4212
9 Ga0070680_100066934 3300005336 Bacteria 2946
10 Ga0070689_100233072 3300005340 Bacteria 1514
11 Ga0070668_100014119 3300005347 Bacteria 5969
12 Ga0070668_100027095 3300005347 Bacteria 4349
13 Ga0070668_100063818 3300005347 Bacteria 2855
14 Ga0070668_100071133 3300005347 Bacteria 2710
15 Ga0070669_100000022 3300005353 Bacteria 177723
16 Ga0070669_100042177 3300005353 Bacteria 3320
17 Ga0070675_100499741 3300005354 Bacteria 1096
18 Ga0070674_100025366 3300005356 Bacteria 3859
19 Ga0070673_100094360 3300005364 Bacteria 2452
20 Ga0070705_100161870 3300005440 Bacteria 1497
21 Ga0070663_100169254 3300005455 Bacteria 1687
22 Ga0070678_100218365 3300005456 Bacteria 1584
23 Ga0070681_10006039 3300005458 Bacteria 11739
24 Ga0070681_10059940 3300005458 Bacteria 3785
25 Ga0070681_10069359 3300005458 Bacteria 3492
26 Ga0070681_10341820 3300005458 Bacteria 1406
27 Ga0068867_100203107 3300005459 Bacteria 1587
28 Ga0070707_100023683 3300005468 Bacteria 5807
29 Ga0070699_100050296 3300005518 Bacteria 3608
30 Ga0070679_100171110 3300005530 Bacteria 2145
31 Ga0070679_100182713 3300005530 Bacteria 2069
32 Ga0068853_100002422 3300005539 Bacteria 13940
33 Ga0068853_100147480 3300005539 Bacteria 2116
34 Ga0070672_100000162 3300005543 Bacteria 36932
35 Ga0070665_100110423 3300005548 Bacteria 2753
36 Ga0070704_100351849 3300005549 Bacteria 1244
37 Ga0068855_100011510 3300005563 Bacteria 10690
38 Ga0068855_100062773 3300005563 Bacteria 4336
39 Ga0070664_100332320 3300005564 Bacteria 1379
40 Ga0068857_100012149 3300005577 Bacteria 7490
41 Ga0068857_100057644 3300005577 Bacteria 3447
42 Ga0068856_100040961 3300005614 Bacteria 4551
43 Ga0070702_100174335 3300005615 Bacteria 1402
44 Ga0068864_100000460 3300005618 Bacteria 35285
45 Ga0068864_100339764 3300005618 Bacteria 1415
46 Ga0068863_100002207 3300005841 Bacteria 19336
47 Ga0068863_100314423 3300005841 Bacteria 1521
48 Ga0068858_100311295 3300005842 Bacteria 1504
49 Ga0068860_100000240 3300005843 Bacteria 83866
50 Ga0068862_100015240 3300005844 Bacteria 6383
51 Ga0068862_100024127 3300005844 Bacteria 5101
52 Ga0068862_100420646 3300005844 Bacteria 1254
53 Ga0081455_10095537 3300005937 Bacteria 2399
54 Ga0081455_10155550 3300005937 Bacteria 1758
55 Ga0081538_10019481 3300005981 Bacteria 5040
56 Ga0081540_1005010 3300005983 Bacteria 9953
57 Ga0081540_1007411 3300005983 Bacteria 7824
58 Ga0081540_1008929 3300005983 Bacteria 6943
59 Ga0081539_10000115 3300005985 Bacteria 188623
60 Ga0081539_10001983 3300005985 Bacteria 31149
61 Ga0081539_10004884 3300005985 Bacteria 14306
62 Ga0075365_10088406 3300006038 Bacteria 2108
63 Ga0075363_100021493 3300006048 Bacteria 3251
64 Ga0075363_100065214 3300006048 Bacteria 1969
65 Ga0075364_10053317 3300006051 Bacteria 2644
66 Ga0075364_10175954 3300006051 Bacteria 1447
67 Ga0070715_10119348 3300006163 Bacteria 1255
68 Ga0070716_100116670 3300006173 Bacteria 1664
69 Ga0075367_10079322 3300006178 Bacteria 1984
70 Ga0075366_10197707 3300006195 Bacteria 1222
71 Ga0075370_10009458 3300006353 Bacteria 5063
72 Ga0075370_10040880 3300006353 Bacteria 2617
73 Ga0075430_100003539 3300006846 Bacteria 13076
74 Ga0075435_100240778 3300007076 Bacteria 1539
75 Ga0105240_10001650 3300009093 Bacteria 37876
76 Ga0105240_10204687 3300009093 Bacteria 2311
77 Ga0111539_10000450 3300009094 Bacteria 51598
78 Ga0105245_10483002 3300009098 Bacteria 1252
79 Ga0114129_10001927 3300009147 Bacteria 28355
80 Ga0114129_10031152 3300009147 Bacteria 7543
81 Ga0114129_10036587 3300009147 Bacteria 6931
82 Ga0114129_10330283 3300009147 Bacteria 2025
83 Ga0114129_10483171 3300009147 Bacteria 1620
84 Ga0114129_10496688 3300009147 Bacteria 1594
85 Ga0105243_10158740 3300009148 Bacteria 1948
86 Ga0105241_10030336 3300009174 Bacteria 4040
87 Ga0105242_10255649 3300009176 Bacteria 1580
88 Ga0105248_10175751 3300009177 Bacteria 2413
89 Ga0105237_10001445 3300009545 Bacteria 31382
90 Ga0105237_10307318 3300009545 Bacteria 1589
91 Ga0105238_10005370 3300009551 Bacteria 12664
92 Ga0105238_10011866 3300009551 Bacteria 8776
93 Ga0105249_10463107 3300009553 Bacteria 1308
94 Ga0105030_100437 3300009987 Bacteria 3682
95 Ga0105239_10003184 3300010375 Bacteria 20313
96 Ga0105239_10489263 3300010375 Bacteria 1398
97 Ga0105246_10142964 3300011119 Bacteria 1801
98 Ga0157370_10167235 3300013104 Bacteria 2045
99 Ga0163162_10143870 3300013306 Bacteria 2499
100 Ga0157375_10024251 3300013308 Bacteria 5611
101 Ga0157375_10427261 3300013308 Bacteria 1491
102 Ga0163163_10052168 3300014325 Bacteria 4034
103 Ga0163163_10312539 3300014325 Bacteria 1624
104 Ga0157380_10028591 3300014326 Bacteria 4253
105 Ga0157379_10126823 3300014968 Bacteria 2296
106 Ga0157379_10286026 3300014968 Bacteria 1501
107 Ga0163161_10010453 3300017792 Bacteria 6427
108 Ga0214544_1000020 3300021320 Bacteria 178560
109 Ga0214542_1000024 3300021321 Bacteria 191218
110 Ga0214545_1000011 3300021324 Bacteria 190550
111 Ga0214543_1000033 3300021327 Bacteria 190419
112 Ga0213876_10048132 3300021384 Bacteria 2253
113 Ga0209148_1000574 3300025254 Bacteria 34124
114 Ga0209455_1003541 3300025272 Bacteria 5474
115 Ga0209675_1001973 3300025291 Bacteria 11020
116 Ga0209758_1000119 3300025297 Bacteria 195545
117 Ga0209758_1000560 3300025297 Bacteria 58586
118 Ga0209758_1012912 3300025297 Bacteria 4616
119 Ga0209051_1047544 3300025303 Bacteria 1464
120 Ga0209257_1000301 3300025304 Bacteria 108454
121 Ga0207692_10008253 3300025898 Bacteria 4307
122 Ga0207710_10047399 3300025900 Bacteria 1921
123 Ga0207685_10023580 3300025905 Bacteria 2097
124 Ga0207699_10005571 3300025906 Bacteria 6039
125 Ga0207705_10029230 3300025909 Bacteria 3929
126 Ga0207654_10079460 3300025911 Bacteria 1970
127 Ga0207707_10001852 3300025912 Bacteria 19339
128 Ga0207707_10094976 3300025912 Bacteria 2606
129 Ga0207695_10016073 3300025913 Bacteria 8777
130 Ga0207671_10024934 3300025914 Bacteria 4494
131 Ga0207671_10116724 3300025914 Bacteria 2036
132 Ga0207693_10000723 3300025915 Bacteria 29753
133 Ga0207663_10000219 3300025916 Bacteria 25504
134 Ga0207660_10238453 3300025917 Bacteria 1432
135 Ga0207652_10156850 3300025921 Bacteria 2039
136 Ga0207652_10176781 3300025921 Bacteria 1917
137 Ga0207652_10271349 3300025921 Bacteria 1530
138 Ga0207646_10016882 3300025922 Bacteria 6844
139 Ga0207681_10000033 3300025923 Bacteria 166731
140 Ga0207681_10025495 3300025923 Bacteria 3804
141 Ga0207681_10184665 3300025923 Bacteria 1591
142 Ga0207694_10096326 3300025924 Bacteria 2340
143 Ga0207650_10003628 3300025925 Bacteria 10573
144 Ga0207700_10128654 3300025928 Bacteria 2064
145 Ga0207664_10006314 3300025929 Bacteria 8147
146 Ga0207706_10033501 3300025933 Bacteria 4572
147 Ga0207686_10107994 3300025934 Bacteria 1871
148 Ga0207665_10000064 3300025939 Bacteria 68931
149 Ga0207665_10254348 3300025939 Bacteria 1299
150 Ga0207691_10002679 3300025940 Bacteria 17410
151 Ga0207679_10273418 3300025945 Bacteria 1446
152 Ga0207667_10037834 3300025949 Bacteria 5157
153 Ga0207651_10025643 3300025960 Bacteria 3668
154 Ga0207712_10077487 3300025961 Bacteria 2409
155 Ga0207668_10002499 3300025972 Bacteria 10734
156 Ga0207658_10073725 3300025986 Bacteria 2592
157 Ga0207703_10372175 3300026035 Bacteria 1320
158 Ga0207639_10004639 3300026041 Bacteria 9251
159 Ga0207708_10257964 3300026075 Bacteria 1406
160 Ga0207702_10440976 3300026078 Bacteria 1262
161 Ga0207641_10001409 3300026088 Bacteria 23703
162 Ga0207641_10267775 3300026088 Bacteria 1602
163 Ga0207641_10523022 3300026088 Bacteria 1154
164 Ga0207648_10214824 3300026089 Bacteria 1708
165 Ga0207676_10052668 3300026095 Bacteria 3182
166 Ga0207675_100017980 3300026118 Bacteria 6594
167 Ga0207675_100038045 3300026118 Bacteria 4490
168 Ga0207683_10264758 3300026121 Bacteria 1570
169 Ga0207698_10522889 3300026142 Bacteria 1158
170 Ga0207428_10000169 3300027907 Bacteria 90667
171 Ga0268266_10059243 3300028379 Bacteria 3299
172 Ga0268265_10008980 3300028380 Bacteria 6761
173 Ga0268265_10152021 3300028380 Bacteria 1954
174 Ga0268264_10000035 3300028381 Bacteria 398196
175 Ga0307515_10024241 3300028794 Bacteria 10582
176 Ga0307511_10018066 3300030521 Bacteria 6748
177 Ga0307511_10075577 3300030521 Bacteria 2416
178 Ga0265330_10003516 3300031235 Bacteria 8163
179 Ga0265330_10025998 3300031235 Bacteria 2652
180 Ga0265332_10008441 3300031238 Bacteria 4629
181 Ga0265328_10021501 3300031239 Bacteria 2461
182 Ga0265325_10011940 3300031241 Bacteria 4978
183 Ga0265325_10044758 3300031241 Bacteria 2303
184 Ga0265329_10005614 3300031242 Bacteria 5053
185 Ga0265340_10080966 3300031247 Bacteria 1529
186 Ga0265339_10001453 3300031249 Bacteria 17549
187 Ga0265339_10010492 3300031249 Bacteria 5753
188 Ga0265339_10061245 3300031249 Bacteria 2026
189 Ga0265339_10061764 3300031249 Bacteria 2015
190 Ga0265331_10002114 3300031250 Bacteria 13701
191 Ga0265331_10022123 3300031250 Bacteria 3247
192 Ga0265327_10021155 3300031251 Bacteria 3934
193 Ga0265327_10022365 3300031251 Bacteria 3784
194 Ga0265316_10020072 3300031344 Bacteria 5697
195 Ga0307513_10033711 3300031456 Bacteria 5753
196 Ga0307509_10099481 3300031507 Bacteria 2949
197 Ga0307509_10312577 3300031507 Bacteria 1312
198 Ga0265313_10002830 3300031595 Bacteria 14587
199 Ga0265313_10143168 3300031595 Bacteria 1027
200 Ga0307508_10000521 3300031616 Bacteria 45797
201 Ga0307508_10316288 3300031616 Bacteria 1153
202 Ga0265314_10010492 3300031711 Bacteria 7724
203 Ga0265314_10022547 3300031711 Bacteria 4823
204 Ga0265314_10068544 3300031711 Bacteria 2384
205 Ga0265314_10191968 3300031711 Bacteria 1214
206 Ga0265342_10002787 3300031712 Bacteria 14791
207 Ga0265342_10010426 3300031712 Bacteria 6448
208 Ga0265342_10023795 3300031712 Bacteria 3871
209 Ga0265342_10190969 3300031712 Bacteria 1118
210 Ga0307413_10329211 3300031824 Bacteria 1170
211 Ga0307416_100879179 3300032002 Bacteria 995
212 Ga0307507_10111917 3300033179 Bacteria 2226
213 Ga0307510_10136026 3300033180 Bacteria 2115
214 Ga0373923_0009562 3300035111 Bacteria 3503
215 Ga0373923_0011876 3300035111 Bacteria 3207
216 Ga0373923_0089735 3300035111 Bacteria 1343
217 Ga0373953_0006338 3300035117 Bacteria 3895
218 Ga0373953_0123698 3300035117 Bacteria 1100
219 Ga0373954_0001728 3300035118 Bacteria 8947
220 Ga0373956_0000275 3300035119 Bacteria 20650
221 Ga0373956_0112554 3300035119 Bacteria 1268
222 Ga0373957_0058091 3300035120 Bacteria 1493
223 Ga0373955_0000324 3300035172 Bacteria 19834
224 Ga0373924_0009028 3300035410 Bacteria 3645
225 Ga0373931_0196711 3300035691 Bacteria 1202
226 Ga0373935_0311484 3300035692 Bacteria 1115
227 Ga0373927_0016732 3300035695 Bacteria 4837
228 Ga0373927_0052507 3300035695 Bacteria 2637
229 Ga0373933_0021114 3300035724 Bacteria 3695
230 Ga0373933_0062604 3300035724 Bacteria 2247
231 Ga0373937_0014181 3300036401 Bacteria 7030
232 Ga0373937_0101198 3300036401 Bacteria 2674
233 Ga0373937_0137568 3300036401 Bacteria 2284
234 Ga0316582_0144965 3300036647 Bacteria 1603
235 Ga0316584_0122146 3300036712 Bacteria 1946
236 Ga0373925_0172947 3300037068 Bacteria 1706
237 Ga0395905_0007242 3300037471 Bacteria 11053
238 Ga0395901_0002462 3300038443 Bacteria 18775
239 Ga0395901_0044578 3300038443 Bacteria 4600
240 Ga0400483_000752 3300039062 Bacteria 2443
241 Ga0400483_289717 3300039062 Bacteria 10717
242 Ga0436365_0548235 3300039437 Bacteria 2290
243 Ga0439464_0019058 3300042439 Bacteria 1872
244 Ga0453683_0056677 3300044673 Bacteria 2452
245 Ga0466963_0090244 3300044694 Bacteria 2086
246 Ga0466970_0104816 3300044765 Bacteria 1542
247 Ga0451576_0093152 3300045051 Bacteria 3133
248 Ga0451576_0139649 3300045051 Bacteria 2527
249 Ga0466967_0014757 3300045976 Bacteria 6103
250 Ga0495592_0005358 3300046454 Bacteria 9468
251 Ga0495592_0022161 3300046454 Bacteria 4832
252 Ga0495603_0029262 3300046455 Bacteria 3321
253 Ga0495629_0000612 3300046459 Bacteria 29083
254 Ga0495638_0075372 3300046460 Bacteria 2056
255 Ga0495651_0014948 3300046462 Bacteria 5999
256 Ga0495651_0039224 3300046462 Bacteria 3688
257 Ga0495651_0080993 3300046462 Bacteria 2451
258 Ga0495653_0000399 3300046463 Bacteria 34847
259 Ga0495664_0150831 3300046477 Bacteria 1410
260 Ga0495664_0151752 3300046477 Bacteria 1405
261 Ga0495594_0011444 3300046499 Bacteria 4611
262 Ga0495608_0010086 3300046511 Bacteria 6588
263 Ga0495616_0040089 3300046513 Bacteria 2395
264 Ga0495618_0003477 3300046514 Bacteria 9782
265 Ga0495628_0048681 3300046516 Bacteria 3359
266 Ga0495652_0004272 3300046529 Bacteria 13713
267 Ga0495652_0041756 3300046529 Bacteria 3957
268 Ga0495652_0264752 3300046529 Bacteria 1267
269 Ga0495665_0164338 3300046531 Bacteria 1156
270 Ga0495586_0042890 3300046535 Bacteria 2436
271 Ga0495587_0001433 3300046536 Bacteria 15868
272 Ga0495645_0011598 3300046543 Bacteria 6206
273 Ga0495622_0011690 3300046557 Bacteria 4058
274 Ga0495667_0007603 3300046559 Bacteria 7356
275 Ga0495667_0019409 3300046559 Bacteria 4586
276 Ga0495634_0036929 3300046642 Bacteria 3339
277 Ga0495635_0000088 3300046663 Bacteria 54355
278 Ga0495635_0049496 3300046663 Bacteria 2896
279 Ga0495588_0000900 3300046674 Bacteria 13029
280 Ga0495657_0010076 3300046675 Bacteria 7123
281 Ga0495657_0025289 3300046675 Bacteria 4219
282 Ga0495599_0008020 3300046678 Bacteria 6410
283 Ga0495599_0036813 3300046678 Bacteria 3074
284 Ga0495623_0008985 3300046679 Bacteria 6488
285 Ga0495646_0003222 3300046680 Bacteria 10148
286 Ga0495647_0038362 3300046681 Bacteria 1811
287 Ga0495613_0022225 3300046689 Bacteria 4727
288 Ga0495613_0175559 3300046689 Bacteria 1519
289 Ga0495613_0177205 3300046689 Bacteria 1511
290 Ga0495600_0016414 3300046809 Bacteria 4698
291 Ga0495581_0034914 3300047315 Bacteria 2910
292 Ga0495604_0099894 3300047317 Bacteria 2134
293 Ga0495674_0037672 3300047319 Bacteria 4345
294 Ga0495674_0211846 3300047319 Bacteria 1604
295 Ga0495680_0003010 3300047322 Bacteria 16808
296 Ga0495680_0056905 3300047322 Bacteria 3026
297 Ga0495680_0239008 3300047322 Bacteria 1291
298 Ga0495675_0008090 3300047444 Bacteria 6507
299 Ga0495684_0001916 3300047471 Bacteria 16683
300 Ga0495684_0027736 3300047471 Bacteria 4349
301 Ga0495593_0000566 3300047673 Bacteria 21032
302 Ga0495602_0016336 3300048088 Bacteria 7468
303 Ga0495602_0040667 3300048088 Bacteria 4258
304 Ga0495602_0256220 3300048088 Bacteria 1301
305 Ga0495626_0079244 3300048091 Bacteria 1462
306 Ga0496106_0024317 3300048909 Bacteria 4502
307 Ga0496106_0062719 3300048909 Bacteria 2823
308 Ga0496112_0032328 3300048915 Bacteria 5080
309 Ga0496114_0177823 3300048917 Bacteria 1857
310 Ga0496116_0030499 3300048919 Bacteria 3872
311 Ga0496118_0006231 3300048921 Bacteria 13190
312 Ga0496118_0023410 3300048921 Bacteria 5364
313 Ga0496121_0000041 3300048924 Bacteria 346686
314 Ga0496121_0024027 3300048924 Bacteria 5842
315 Ga0496121_0041583 3300048924 Bacteria 4014
316 Ga0496121_0061958 3300048924 Bacteria 3066
317 Ga0496121_0116980 3300048924 Bacteria 2020
318 Ga0496121_0171124 3300048924 Bacteria 1578
319 Ga0496124_0000910 3300048927 Bacteria 47763
320 Ga0496125_0013816 3300048928 Bacteria 7908
321 Ga0496125_0126898 3300048928 Bacteria 1806
322 Ga0496126_0003329 3300048929 Bacteria 20436
323 Ga0496126_0011637 3300048929 Bacteria 9081
324 Ga0496126_0176775 3300048929 Bacteria 1815
325 Ga0501032_0000046 3300049569 Bacteria 109405
326 Ga0501033_0001341 3300049570 Bacteria 21887
327 Ga0501034_0001492 3300049571 Bacteria 30823
328 Ga0501034_0466431 3300049571 Bacteria 1179
329 Ga0501036_0000326 3300049572 Bacteria 33146
330 Ga0501036_0027068 3300049572 Bacteria 4845
331 Ga0501036_0256961 3300049572 Bacteria 1464
332 Ga0501037_0000309 3300049573 Bacteria 41492
333 Ga0501037_0069737 3300049573 Bacteria 2559
334 Ga0501037_0166224 3300049573 Bacteria 1571
335 Ga0501038_0000026 3300049574 Bacteria 146493
336 Ga0501039_0000005 3300049575 Bacteria 295471
337 Ga0501039_0022699 3300049575 Bacteria 4815
338 Ga0501039_0040491 3300049575 Bacteria 3597
339 Ga0501040_0012691 3300049576 Bacteria 5527
340 Ga0501040_0063535 3300049576 Bacteria 2541
341 Ga0501041_0013644 3300049577 Bacteria 4819
342 Ga0501041_0044598 3300049577 Bacteria 2695
343 Ga0501042_0003821 3300049578 Bacteria 9519
344 Ga0501042_0251092 3300049578 Bacteria 1276
345 Ga0501043_0000135 3300049579 Bacteria 68762
346 Ga0501043_0274786 3300049579 Bacteria 1293
347 Ga0501043_0314746 3300049579 Bacteria 1194
348 Ga0501046_0075859 3300049580 Bacteria 2606
349 Ga0501047_0000101 3300049581 Bacteria 104950
350 Ga0501047_0152564 3300049581 Bacteria 2185
351 Ga0501047_0195974 3300049581 Bacteria 1882
352 Ga0501048_0007041 3300049582 Bacteria 8541
353 Ga0501048_0353482 3300049582 Bacteria 1048
354 Ga0501067_0072596 3300049583 Bacteria 1906
355 Ga0501068_0004441 3300049584 Bacteria 7634
356 Ga0501068_0021845 3300049584 Bacteria 3739
357 Ga0501069_0017203 3300049585 Bacteria 3888
358 Ga0501070_0000297 3300049586 Bacteria 46317
359 Ga0501070_0006131 3300049586 Bacteria 10249
360 Ga0501070_0092446 3300049586 Bacteria 2504
361 Ga0501070_0425605 3300049586 Bacteria 1072
362 Ga0501071_0000138 3300049587 Bacteria 29742
363 Ga0501071_0003062 3300049587 Bacteria 10360
364 Ga0501071_0036784 3300049587 Bacteria 3492
365 Ga0501071_0339008 3300049587 Bacteria 1143
366 Ga0501072_0003683 3300049588 Bacteria 11562
367 Ga0501072_0018670 3300049588 Bacteria 5346
368 Ga0501072_0302306 3300049588 Bacteria 1272
369 Ga0501073_0000840 3300049589 Bacteria 21856
370 Ga0501073_0030427 3300049589 Bacteria 3854
371 Ga0501073_0081743 3300049589 Bacteria 2247
372 Ga0501074_0001669 3300049590 Bacteria 15112
373 Ga0501074_0014547 3300049590 Bacteria 5725
374 Ga0501074_0046108 3300049590 Bacteria 3151
375 Ga0501075_0000779 3300049591 Bacteria 19918
376 Ga0501075_0136281 3300049591 Bacteria 1870
377 Ga0501076_0038845 3300049592 Bacteria 3737
378 Ga0501076_0048103 3300049592 Bacteria 3372
379 Ga0501077_0004453 3300049593 Bacteria 8512
380 Ga0501079_0024397 3300049741 Bacteria 4639
381 Ga0501080_0000121 3300049742 Bacteria 54804
382 Ga0501080_0000175 3300049742 Bacteria 47153
383 Ga0501080_0040648 3300049742 Bacteria 4337
384 Ga0501081_0037246 3300049743 Bacteria 3318
385 Ga0501081_0052756 3300049743 Bacteria 2807
386 Ga0501083_0009283 3300049744 Bacteria 6943
387 Ga0501083_0025855 3300049744 Bacteria 4063
388 Ga0501035_0000588 3300049822 Bacteria 40021
389 Ga0501035_0054142 3300049822 Bacteria 3586
390 Ga0501035_0108880 3300049822 Bacteria 2429
391 Ga0501044_0002089 3300049823 Bacteria 22997
392 Ga0501044_0012516 3300049823 Bacteria 9188
393 Ga0501044_0061427 3300049823 Bacteria 3844
394 Ga0501045_0203653 3300049824 Bacteria 1474
395 nmdc:mga00v17_118621_c1 3300050491 Bacteria 1684
396 nmdc:mga0yw44_12608_c1 3300050492 Bacteria 4415
397 nmdc:mga0yw44_164325_c1 3300050492 Bacteria 1455
398 nmdc:mga0yw44_75867_c1 3300050492 Bacteria 2097
399 nmdc:mga0k408_187224_c1 3300050493 Bacteria 1235
400 nmdc:mga05p37_44403_c1 3300050507 Bacteria 5467
401 nmdc:mga05p37_48249_c1 3300050507 Bacteria 5238
402 nmdc:mga05p37_851_c1 3300050507 Bacteria 34350
403 nmdc:mga0qj67_8862_c1 3300050509 Bacteria 7464
404 nmdc:mga08y16_34_c1 3300050511 Bacteria 164092
405 Ga0495601_0037774 3300053077 Bacteria 3019
406 Ga0495612_0009654 3300053078 Bacteria 3909
407 Ga0495595_0004196 3300053084 Bacteria 5796
408 Ga0495619_0000332 3300053085 Bacteria 33066
409 Ga0500646_0001193 3300053090 Bacteria 6985
410 Ga0500583_0021676 3300053092 Bacteria 2677
411 Ga0500583_0035817 3300053092 Bacteria 2217
412 Ga0500583_0066238 3300053092 Bacteria 1718
413 Ga0500566_0000554 3300053094 Bacteria 20984
414 Ga0500566_0006182 3300053094 Bacteria 7117
415 Ga0500566_0045592 3300053094 Bacteria 2523
416 Ga0500641_0004888 3300053096 Bacteria 4743
417 Ga0500554_008743 3300053102 Bacteria 2393
418 Ga0500554_055969 3300053102 Bacteria 1254
419 Ga0500595_000354 3300053119 Bacteria 29968
420 Ga0500595_004502 3300053119 Bacteria 6234
421 Ga0500595_017964 3300053119 Bacteria 2597
422 Ga0500608_001306 3300053122 Bacteria 8879
423 Ga0500618_002062 3300053125 Bacteria 8093
424 Ga0500642_0001634 3300053130 Bacteria 6470
425 Ga0500642_0063971 3300053130 Bacteria 1659
426 Ga0500655_003517 3300053133 Bacteria 2830
427 Ga0500559_0000985 3300053136 Bacteria 17756
428 Ga0500559_0091213 3300053136 Bacteria 1395
429 Ga0500568_0003685 3300053139 Bacteria 8420
430 Ga0500573_0008062 3300053140 Bacteria 5788
431 Ga0500604_0004311 3300053151 Bacteria 3776
432 Ga0500604_0062244 3300053151 Bacteria 1174
433 Ga0500616_0000846 3300053153 Bacteria 34311
434 Ga0500638_000418 3300053162 Bacteria 10135
435 Ga0500638_054637 3300053162 Bacteria 1926
436 Ga0500636_0000076 3300053177 Bacteria 48321
437 Ga0500637_0000135 3300053178 Bacteria 27083
438 Ga0500645_042470 3300053730 Bacteria 1341
439 Ga0500609_001024 3300053731 Bacteria 4190
440 Ga0500596_001174 3300053735 Bacteria 5279
441 Ga0500599_012074 3300053736 Bacteria 1157
442 Ga0500601_000249 3300053737 Bacteria 10384
443 Ga0501084_0007857 3300054114 Bacteria 8778
444 Ga0501084_0247437 3300054114 Bacteria 1505
445 Ga0500661_001607 3300055283 Bacteria 4269
446 Ga0501082_0001872 3300060353 Bacteria 18517
447 Ga0501082_0125866 3300060353 Bacteria 2222
448 Ga0530510_0008880 3300061734 Bacteria 7035
449 Ga0530510_0086395 3300061734 Bacteria 2285
450 Ga0530510_0105461 3300061734 Bacteria 2062
451 2511397583 2511231028 Bacteria 8046582
452 2512035014 2511231221 Bacteria 6846400
453 2513643564 2513237094 Bacteria 8789602
454 2513702568 2513237102 Bacteria 7703324
455 2513893303 2513237141 Bacteria 8496279
456 2523107450 2522572158 Bacteria 6514390
457 2528849604 2528768022 Bacteria 10457665
458 2617378956 2617270741 Bacteria 8201522
459 2824669459 2824661429 Bacteria 9877870
460 2824713469 2824704595 Bacteria 9667483
461 2824740492 2824732956 Bacteria 7810675
462 2824752353 2824746037 Bacteria 7911610
463 2824758026 2824753945 Bacteria 9787441
464 2824766164 2824763712 Bacteria 9792355
465 2842338008 2842333319 Bacteria 8899485
466 2844317730 2844315083 Bacteria 8138177
467 2846954122 2846952575 Bacteria 6587527
468 2847934520 2847930680 Bacteria 9342022
469 2848859594 2848858292 Bacteria 7391279
470 2852389842 2852387548 Bacteria 8025568
471 2879089712 2879083081 Bacteria 8587928
472 2879107727 2879099564 Bacteria 10442239
473 2883357299 2883354860 Bacteria 5865246
474 2885414267 2885409591 Bacteria 9235467
475 2893069014 2893066018 Bacteria 6158120
476 2894772733 2894772417 Bacteria 5305674
477 2897805616 2897803580 Bacteria 7000062
478 2903735410 2903727486 Bacteria 8281579
479 2904718484 2904711408 Bacteria 9771557
480 2906608671 2906602504 Bacteria 8295279
481 2922375507
482 2922394980 2922393267 Bacteria 8285685
483 2929616243 2929615660 Bacteria 9193770
484 2929624987 2929624759 Bacteria 9339455
485 2932787092 2932784394 Bacteria 9704911
486 2932811286 2932809354 Bacteria 9135765
487 2932819841 2932818245 Bacteria 9955613
488 2932832318 2932828146 Bacteria 9745859
489 2933578473 2933577622 Bacteria 9116884
490 2935619030 2935616580 Bacteria 9032984
491 2935643153 2935638405 Bacteria 10015038
492 2935669779 2935665750 Bacteria 9571747
493 2935677081 2935675223 Bacteria 9928132
494 2935693118 2935684952 Bacteria 9590419
495 2935695389 2935694250 Bacteria 9291695
496 2935709502 2935703347 Bacteria 10242284
497 2935719726 2935713505 Bacteria 9608509
498 2935729507 2935722832 Bacteria 9608746
499 2935739609 2935732158 Bacteria 9706831
500 2935748647 2935741537 Bacteria 9707219
501 2935756766 2935750917 Bacteria 9590372
502 2935761248 2935760218 Bacteria 9817913
503 2935807299 2935801545 Bacteria 9301974
504 2935812438 2935810662 Bacteria 9401221
505 2935832703 2935827899 Bacteria 10038562
506 2935839218 2935837841 Bacteria 9454360
507 2935857395 2935855204 Bacteria 9035059
508 2935864924 2935864058 Bacteria 9784707
509 2935876702 2935873716 Bacteria 9632195
510 2935999684 2935992306 Bacteria 9802711
511 2936008295 2936002035 Bacteria 9362176
512 2936039031 2936037263 Bacteria 9446081
513 2940562680 2940556831 Bacteria 9590747
514 2941539908 2941538514 Bacteria 9402094
515 3005597464 3005594810 Bacteria 8716512
516 3005720902 3005718088 Bacteria 8283608
517 8016515114 8016511872 Bacteria 9921665
518 8017061339 8017057580 Bacteria 10023680
519 8019580808 8019576017 Bacteria 10049540
520 8019602794 8019597564 Bacteria 10041141
521 8019615760 8019608314 Bacteria 10042931
522 8054008975 8054002106 Bacteria 7987183
523 8055747890 8055742211 Bacteria 9226248
524 8056969530 8056967851 Bacteria 9038162
525 JGI25406J46586_10003312
526 JGI24750J21931_1002415
527 JGI24742J22300_10009151
528 JGI25406J46586_10003180
529 JGI25153J46596_10000156
530 Ga0055531_10006966
531 Ga0070670_100031733
532 Ga0070670_100036778
533 Ga0070680_100066934
534 Ga0070689_100233072
535 Ga0070668_100014119
536 Ga0070668_100027095
537 Ga0070668_100063818
538 Ga0070668_100071133
539 Ga0070669_100000022
540 Ga0070669_100042177
541 Ga0070675_100499741
542 Ga0070674_100025366
543 Ga0070673_100094360
544 Ga0070705_100161870
545 Ga0070663_100169254
546 Ga0070678_100218365
547 Ga0070681_10006039
548 Ga0070681_10059940
549 Ga0070681_10069359
550 Ga0070681_10341820
551 Ga0068867_100203107
552 Ga0070707_100023683
553 Ga0070699_100050296
554 Ga0070679_100171110
555 Ga0070679_100182713
556 Ga0068853_100002422
557 Ga0068853_100147480
558 Ga0070672_100000162
559 Ga0070665_100110423
560 Ga0070704_100351849
561 Ga0068855_100011510
562 Ga0068855_100062773
563 Ga0070664_100332320
564 Ga0068857_100012149
565 Ga0068857_100057644
566 Ga0068856_100040961
567 Ga0070702_100174335
568 Ga0068864_100000460
569 Ga0068864_100339764
570 Ga0068863_100002207
571 Ga0068863_100314423
572 Ga0068858_100311295
573 Ga0068860_100000240
574 Ga0068862_100015240
575 Ga0068862_100024127
576 Ga0068862_100420646
577 Ga0081455_10095537
578 Ga0081455_10155550
579 Ga0081538_10019481
580 Ga0081540_1005010
581 Ga0081540_1007411
582 Ga0081540_1008929
583 Ga0081539_10000115
584 Ga0081539_10001983
585 Ga0081539_10004884
586 Ga0075365_10088406
587 Ga0075363_100021493
588 Ga0075363_100065214
589 Ga0075364_10053317
590 Ga0075364_10175954
591 Ga0070715_10119348
592 Ga0070716_100116670
593 Ga0075367_10079322
594 Ga0075366_10197707
595 Ga0075370_10009458
596 Ga0075370_10040880
597 Ga0075430_100003539
598 Ga0075435_100240778
599 Ga0105240_10001650
600 Ga0105240_10204687
601 Ga0111539_10000450
602 Ga0105245_10483002
603 Ga0114129_10001927
604 Ga0114129_10031152
605 Ga0114129_10036587
606 Ga0114129_10330283
607 Ga0114129_10483171
608 Ga0114129_10496688
609 Ga0105243_10158740
610 Ga0105241_10030336
611 Ga0105242_10255649
612 Ga0105248_10175751
613 Ga0105237_10001445
614 Ga0105237_10307318
615 Ga0105238_10005370
616 Ga0105238_10011866
617 Ga0105249_10463107
618 Ga0105030_100437
619 Ga0105239_10003184
620 Ga0105239_10489263
621 Ga0105246_10142964
622 Ga0157370_10167235
623 Ga0163162_10143870
624 Ga0157375_10024251
625 Ga0157375_10427261
626 Ga0163163_10052168
627 Ga0163163_10312539
628 Ga0157380_10028591
629 Ga0157379_10126823
630 Ga0157379_10286026
631 Ga0163161_10010453
632 Ga0214544_1000020
633 Ga0214542_1000024
634 Ga0214545_1000011
635 Ga0214543_1000033
636 Ga0213876_10048132
637 Ga0209148_1000574
638 Ga0209455_1003541
639 Ga0209675_1001973
640 Ga0209758_1000119
641 Ga0209758_1000560
642 Ga0209758_1012912
643 Ga0209051_1047544
644 Ga0209257_1000301
645 Ga0207692_10008253
646 Ga0207710_10047399
647 Ga0207685_10023580
648 Ga0207699_10005571
649 Ga0207705_10029230
650 Ga0207654_10079460
651 Ga0207707_10001852
652 Ga0207707_10094976
653 Ga0207695_10016073
654 Ga0207671_10024934
655 Ga0207671_10116724
656 Ga0207693_10000723
657 Ga0207663_10000219
658 Ga0207660_10238453
659 Ga0207652_10156850
660 Ga0207652_10176781
661 Ga0207652_10271349
662 Ga0207646_10016882
663 Ga0207681_10000033
664 Ga0207681_10025495
665 Ga0207681_10184665
666 Ga0207694_10096326
667 Ga0207650_10003628
668 Ga0207700_10128654
669 Ga0207664_10006314
670 Ga0207706_10033501
671 Ga0207686_10107994
672 Ga0207665_10000064
673 Ga0207665_10254348
674 Ga0207691_10002679
675 Ga0207679_10273418
676 Ga0207667_10037834
677 Ga0207651_10025643
678 Ga0207712_10077487
679 Ga0207668_10002499
680 Ga0207658_10073725
681 Ga0207703_10372175
682 Ga0207639_10004639
683 Ga0207708_10257964
684 Ga0207702_10440976
685 Ga0207641_10001409
686 Ga0207641_10267775
687 Ga0207641_10523022
688 Ga0207648_10214824
689 Ga0207676_10052668
690 Ga0207675_100017980
691 Ga0207675_100038045
692 Ga0207683_10264758
693 Ga0207698_10522889
694 Ga0207428_10000169
695 Ga0268266_10059243
696 Ga0268265_10008980
697 Ga0268265_10152021
698 Ga0268264_10000035
699 Ga0307515_10024241
700 Ga0307511_10018066
701 Ga0307511_10075577
702 Ga0265330_10003516
703 Ga0265330_10025998
704 Ga0265332_10008441
705 Ga0265328_10021501
706 Ga0265325_10011940
707 Ga0265325_10044758
708 Ga0265329_10005614
709 Ga0265340_10080966
710 Ga0265339_10001453
711 Ga0265339_10010492
712 Ga0265339_10061245
713 Ga0265339_10061764
714 Ga0265331_10002114
715 Ga0265331_10022123
716 Ga0265327_10021155
717 Ga0265327_10022365
718 Ga0265316_10020072
719 Ga0307513_10033711
720 Ga0307509_10099481
721 Ga0307509_10312577
722 Ga0265313_10002830
723 Ga0265313_10143168
724 Ga0307508_10000521
725 Ga0307508_10316288
726 Ga0265314_10010492
727 Ga0265314_10022547
728 Ga0265314_10068544
729 Ga0265314_10191968
730 Ga0265342_10002787
731 Ga0265342_10010426
732 Ga0265342_10023795
733 Ga0265342_10190969
734 Ga0307413_10329211
735 Ga0307416_100879179
736 Ga0307507_10111917
737 Ga0307510_10136026
738 Ga0373923_0009562
739 Ga0373923_0011876
740 Ga0373923_0089735
741 Ga0373953_0006338
742 Ga0373953_0123698
743 Ga0373954_0001728
744 Ga0373956_0000275
745 Ga0373956_0112554
746 Ga0373957_0058091
747 Ga0373955_0000324
748 Ga0373924_0009028
749 Ga0373931_0196711
750 Ga0373935_0311484
751 Ga0373927_0016732
752 Ga0373927_0052507
753 Ga0373933_0021114
754 Ga0373933_0062604
755 Ga0373937_0014181
756 Ga0373937_0101198
757 Ga0373937_0137568
758 Ga0316582_0144965
759 Ga0316584_0122146
760 Ga0373925_0172947
761 Ga0395905_0007242
762 Ga0395901_0002462
763 Ga0395901_0044578
764 Ga0400483_000752
765 Ga0400483_289717
766 Ga0436365_0548235
767 Ga0439464_0019058
768 Ga0453683_0056677
769 Ga0466963_0090244
770 Ga0466970_0104816
771 Ga0451576_0093152
772 Ga0451576_0139649
773 Ga0466967_0014757
774 Ga0495592_0005358
775 Ga0495592_0022161
776 Ga0495603_0029262
777 Ga0495629_0000612
778 Ga0495638_0075372
779 Ga0495651_0014948
780 Ga0495651_0039224
781 Ga0495651_0080993
782 Ga0495653_0000399
783 Ga0495664_0150831
784 Ga0495664_0151752
785 Ga0495594_0011444
786 Ga0495608_0010086
787 Ga0495616_0040089
788 Ga0495618_0003477
789 Ga0495628_0048681
790 Ga0495652_0004272
791 Ga0495652_0041756
792 Ga0495652_0264752
793 Ga0495665_0164338
794 Ga0495586_0042890
795 Ga0495587_0001433
796 Ga0495645_0011598
797 Ga0495622_0011690
798 Ga0495667_0007603
799 Ga0495667_0019409
800 Ga0495634_0036929
801 Ga0495635_0000088
802 Ga0495635_0049496
803 Ga0495588_0000900
804 Ga0495657_0010076
805 Ga0495657_0025289
806 Ga0495599_0008020
807 Ga0495599_0036813
808 Ga0495623_0008985
809 Ga0495646_0003222
810 Ga0495647_0038362
811 Ga0495613_0022225
812 Ga0495613_0175559
813 Ga0495613_0177205
814 Ga0495600_0016414
815 Ga0495581_0034914
816 Ga0495604_0099894
817 Ga0495674_0037672
818 Ga0495674_0211846
819 Ga0495680_0003010
820 Ga0495680_0056905
821 Ga0495680_0239008
822 Ga0495675_0008090
823 Ga0495684_0001916
824 Ga0495684_0027736
825 Ga0495593_0000566
826 Ga0495602_0016336
827 Ga0495602_0040667
828 Ga0495602_0256220
829 Ga0495626_0079244
830 Ga0496106_0024317
831 Ga0496106_0062719
832 Ga0496112_0032328
833 Ga0496114_0177823
834 Ga0496116_0030499
835 Ga0496118_0006231
836 Ga0496118_0023410
837 Ga0496121_0000041
838 Ga0496121_0024027
839 Ga0496121_0041583
840 Ga0496121_0061958
841 Ga0496121_0116980
842 Ga0496121_0171124
843 Ga0496124_0000910
844 Ga0496125_0013816
845 Ga0496125_0126898
846 Ga0496126_0003329
847 Ga0496126_0011637
848 Ga0496126_0176775
849 Ga0501032_0000046
850 Ga0501033_0001341
851 Ga0501034_0001492
852 Ga0501034_0466431
853 Ga0501036_0000326
854 Ga0501036_0027068
855 Ga0501036_0256961
856 Ga0501037_0000309
857 Ga0501037_0069737
858 Ga0501037_0166224
859 Ga0501038_0000026
860 Ga0501039_0000005
861 Ga0501039_0022699
862 Ga0501039_0040491
863 Ga0501040_0012691
864 Ga0501040_0063535
865 Ga0501041_0013644
866 Ga0501041_0044598
867 Ga0501042_0003821
868 Ga0501042_0251092
869 Ga0501043_0000135
870 Ga0501043_0274786
871 Ga0501043_0314746
872 Ga0501046_0075859
873 Ga0501047_0000101
874 Ga0501047_0152564
875 Ga0501047_0195974
876 Ga0501048_0007041
877 Ga0501048_0353482
878 Ga0501067_0072596
879 Ga0501068_0004441
880 Ga0501068_0021845
881 Ga0501069_0017203
882 Ga0501070_0000297
883 Ga0501070_0006131
884 Ga0501070_0092446
885 Ga0501070_0425605
886 Ga0501071_0000138
887 Ga0501071_0003062
888 Ga0501071_0036784
889 Ga0501071_0339008
890 Ga0501072_0003683
891 Ga0501072_0018670
892 Ga0501072_0302306
893 Ga0501073_0000840
894 Ga0501073_0030427
895 Ga0501073_0081743
896 Ga0501074_0001669
897 Ga0501074_0014547
898 Ga0501074_0046108
899 Ga0501075_0000779
900 Ga0501075_0136281
901 Ga0501076_0038845
902 Ga0501076_0048103
903 Ga0501077_0004453
904 Ga0501079_0024397
905 Ga0501080_0000121
906 Ga0501080_0000175
907 Ga0501080_0040648
908 Ga0501081_0037246
909 Ga0501081_0052756
910 Ga0501083_0009283
911 Ga0501083_0025855
912 Ga0501035_0000588
913 Ga0501035_0054142
914 Ga0501035_0108880
915 Ga0501044_0002089
916 Ga0501044_0012516
917 Ga0501044_0061427
918 Ga0501045_0203653
919 nmdc:mga00v17_118621_c1
920 nmdc:mga0yw44_12608_c1
921 nmdc:mga0yw44_164325_c1
922 nmdc:mga0yw44_75867_c1
923 nmdc:mga0k408_187224_c1
924 nmdc:mga05p37_44403_c1
925 nmdc:mga05p37_48249_c1
926 nmdc:mga05p37_851_c1
927 nmdc:mga0qj67_8862_c1
928 nmdc:mga08y16_34_c1
929 Ga0495601_0037774
930 Ga0495612_0009654
931 Ga0495595_0004196
932 Ga0495619_0000332
933 Ga0500646_0001193
934 Ga0500583_0021676
935 Ga0500583_0035817
936 Ga0500583_0066238
937 Ga0500566_0000554
938 Ga0500566_0006182
939 Ga0500566_0045592
940 Ga0500641_0004888
941 Ga0500554_008743
942 Ga0500554_055969
943 Ga0500595_000354
944 Ga0500595_004502
945 Ga0500595_017964
946 Ga0500608_001306
947 Ga0500618_002062
948 Ga0500642_0001634
949 Ga0500642_0063971
950 Ga0500655_003517
951 Ga0500559_0000985
952 Ga0500559_0091213
953 Ga0500568_0003685
954 Ga0500573_0008062
955 Ga0500604_0004311
956 Ga0500604_0062244
957 Ga0500616_0000846
958 Ga0500638_000418
959 Ga0500638_054637
960 Ga0500636_0000076
961 Ga0500637_0000135
962 Ga0500645_042470
963 Ga0500609_001024
964 Ga0500596_001174
965 Ga0500599_012074
966 Ga0500601_000249
967 Ga0501084_0007857
968 Ga0501084_0247437
969 Ga0500661_001607
970 Ga0501082_0001872
971 Ga0501082_0125866
972 Ga0530510_0008880
973 Ga0530510_0086395
974 Ga0530510_0105461
975 2511397583
976 2512035014
977 2513643564
978 2513702568
979 2513893303
980 2523107450
981 2528849604
982 2617378956
983 2824669459
984 2824713469
985 2824740492
986 2824752353
987 2824758026
988 2824766164
989 2842338008
990 2844317730
991 2846954122
992 2847934520
993 2848859594
994 2852389842
995 2879089712
996 2879107727
997 2883357299
998 2885414267
999 2893069014
1000 2894772733
1001 2897805616
1002 2903735410
1003 2904718484
1004 2906608671
1005 2922375507
1006 2922394980
1007 2929616243
1008 2929624987
1009 2932787092
1010 2932811286
1011 2932819841
1012 2932832318
1013 2933578473
1014 2935619030
1015 2935643153
1016 2935669779
1017 2935677081
1018 2935693118
1019 2935695389
1020 2935709502
1021 2935719726
1022 2935729507
1023 2935739609
1024 2935748647
1025 2935756766
1026 2935761248
1027 2935807299
1028 2935812438
1029 2935832703
1030 2935839218
1031 2935857395
1032 2935864924
1033 2935876702
1034 2935999684
1035 2936008295
1036 2936039031
1037 2940562680
1038 2941539908
1039 3005597464
1040 3005720902
1041 8016515114
1042 8017061339
1043 8019580808
1044 8019602794
1045 8019615760
1046 8054008975
1047 8055747890
1048 8056969530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07728

AAA_5

AAA domain (dynein-related subfamily)

36

188

0.89

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

37

192

0.82

PF13191

AAA_16

AAA ATPase domain

20

172

0.73

PF13401

AAA_22

AAA domain

32

173

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.8433 29 295
6l1q-assembly1.cif.gz_C crystal structure of afcbbq2, a moxr aaa+-atpase and cbbqo-type rubisco activase from acidithiobacillus ferrooxidans 0.7879 29 299
5c3c-assembly1.cif.gz_A structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7863 29 295
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7813 15 297
5c3c-assembly1.cif.gz_B structural characterization of a newly identified component of alpha-carboxysomes: the aaa+ domain protein cso-cbbq 0.7462 15 297
ID Description Score Start End Superfamily
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9794 24 212 3.40.50.300
af_P71922_29_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 24 212 3.40.50.300
af_O53705_22_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 27 212 3.40.50.300
af_O53705_22_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9237 27 212 3.40.50.300
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8213 10 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520G4G7-F1-model_v4 MoxR family ATPase 0.981 212 297
AF-A0A659UML9-F1-model_v4 MoxR family ATPase 0.9802 200 299
AF-A0A257ZFF5-F1-model_v4 ATPase 0.9778 3 260 GO:0005524
GO:0016887
AF-A0A1F3X8M0-F1-model_v4 ATPase 0.9775 3 200 GO:0005524
GO:0016887
AF-A0A3D0HJI4-F1-model_v4 ATPase 0.9771 207 298

Map