F459089

General Info

Members Datasets Scaffolds Average Seq Length
524 335 1048 286

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1014747|Ga0055536_10147472
Length 320
Sequence MASLKALKIRIGSVKSTQKITKAMKMVAAAKLRRAQEAAEAGRPYAQRLEAVVASLASKISVSESSPKLLAGTGKDQVHLLVIATSDKGLAGAFNTNIARLARRHAQELLAQGKTVKIYTIGRKGRAVLNRQFPKNIVHSIEPGDLGKLSFAXARGYADDLIARFEAGEFDVATLFYSTFKSVLAQEPTAQQIIPVAIPQAETAAVSSGAAVTYEPDEESILADLLPRNVAIQLFRAMRENAASEQGSKMTAMDNATRNAGDLIKRLNTIYNRQRRPRSRPSWWKSFRAPKRSKTVRTRKQQWQPKLPSQRPTMAAASAR

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
315 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
319 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
322 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
326 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
327 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
328 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
329 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
330 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
331 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
332 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
333 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
334 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
335 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.57
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.7
Nodule 0.76
Rhizoplane 2.67
Rhizosphere 67.75
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1014747 3300003781 Bacteria 2718
2 ARCol0yngRDRAFT_1002397 3300000652 Bacteria 1417
3 JGI24736J21556_1000147 3300001904 Bacteria 12247
4 JGI25150J39212_1000349 3300002774 Bacteria 22660
5 JGI25153J46596_10014916 3300003215 Bacteria 3198
6 Ga0055542_1000040 3300003762 Bacteria 214035
7 Ga0055542_1000609 3300003762 Bacteria 30543
8 Ga0055542_1005454 3300003762 Bacteria 2875
9 Ga0055529_1000037 3300003763 Bacteria 237307
10 Ga0055526_1002525 3300003771 Bacteria 12297
11 Ga0055537_1003425 3300003773 Bacteria 4882
12 Ga0055537_1007393 3300003773 Bacteria 2653
13 Ga0055537_1013825 3300003773 Bacteria 1495
14 Ga0055524_1000209 3300003775 Bacteria 62993
15 Ga0055524_1011023 3300003775 Bacteria 3558
16 Ga0055528_1002220 3300003790 Bacteria 10590
17 Ga0055540_1001501 3300003792 Bacteria 13868
18 Ga0055531_10016667 3300003794 Bacteria 3154
19 Ga0065165_1008513 3300005262 Bacteria 4779
20 Ga0065165_1017252 3300005262 Bacteria 2667
21 Ga0065165_1022328 3300005262 Bacteria 2172
22 Ga0070658_10006404 3300005327 Bacteria 9539
23 Ga0070658_10204652 3300005327 Bacteria 1666
24 Ga0070658_10278111 3300005327 Bacteria 1424
25 Ga0070683_100132035 3300005329 Bacteria 2364
26 Ga0070670_100034317 3300005331 Bacteria 4366
27 Ga0070677_10130476 3300005333 Bacteria 1147
28 Ga0070666_10185827 3300005335 Bacteria 1459
29 Ga0070666_10186202 3300005335 Bacteria 1458
30 Ga0070682_100126065 3300005337 Bacteria 1726
31 Ga0070660_100234038 3300005339 Bacteria 1495
32 Ga0070691_10012537 3300005341 Bacteria 3881
33 Ga0070661_100000933 3300005344 Bacteria 20889
34 Ga0070661_100095000 3300005344 Bacteria 2210
35 Ga0070661_100216530 3300005344 Bacteria 1467
36 Ga0070668_100000123 3300005347 Bacteria 48192
37 Ga0070668_100000479 3300005347 Bacteria 26526
38 Ga0070669_100068932 3300005353 Bacteria 2612
39 Ga0070669_100242406 3300005353 Bacteria 1433
40 Ga0070675_100176998 3300005354 Bacteria 1842
41 Ga0070671_100124028 3300005355 Bacteria 2174
42 Ga0070674_100063196 3300005356 Bacteria 2590
43 Ga0070688_100167200 3300005365 Bacteria 1515
44 Ga0070659_100080749 3300005366 Bacteria 2596
45 Ga0070659_100260581 3300005366 Bacteria 1438
46 Ga0070667_100000024 3300005367 Bacteria 191216
47 Ga0070709_10151827 3300005434 Bacteria 1601
48 Ga0070709_10347685 3300005434 Bacteria 1095
49 Ga0070713_100000121 3300005436 Bacteria 50650
50 Ga0070711_100033560 3300005439 Bacteria 3418
51 Ga0070663_100255079 3300005455 Bacteria 1389
52 Ga0070678_100012561 3300005456 Bacteria 5272
53 Ga0070681_10104601 3300005458 Bacteria 2773
54 Ga0070681_10223985 3300005458 Bacteria 1796
55 Ga0070699_100154609 3300005518 Bacteria 2029
56 Ga0070679_100000019 3300005530 Bacteria 127108
57 Ga0068853_100005255 3300005539 Bacteria 10138
58 Ga0068853_100324676 3300005539 Bacteria 1427
59 Ga0070695_100136548 3300005545 Bacteria 1696
60 Ga0070704_100292766 3300005549 Bacteria 1353
61 Ga0068855_100067127 3300005563 Bacteria 4180
62 Ga0068855_100372792 3300005563 Bacteria 1568
63 Ga0070664_100227872 3300005564 Bacteria 1669
64 Ga0068857_100004014 3300005577 Bacteria 12392
65 Ga0068856_100000497 3300005614 Bacteria 43608
66 Ga0068856_100001104 3300005614 Bacteria 28526
67 Ga0068859_100001286 3300005617 Bacteria 25622
68 Ga0068859_100095238 3300005617 Bacteria 3030
69 Ga0068859_100097479 3300005617 Bacteria 2994
70 Ga0068861_100000046 3300005719 Bacteria 56414
71 Ga0068863_100000020 3300005841 Bacteria 198519
72 Ga0068863_100000082 3300005841 Bacteria 105688
73 Ga0068863_100037980 3300005841 Bacteria 4583
74 Ga0068860_100000938 3300005843 Bacteria 32302
75 Ga0068860_100020798 3300005843 Bacteria 6357
76 Ga0068860_100340126 3300005843 Bacteria 1475
77 Ga0068862_100000236 3300005844 Bacteria 61275
78 Ga0068862_100006902 3300005844 Bacteria 9417
79 Ga0068862_100082933 3300005844 Bacteria 2783
80 Ga0081455_10096438 3300005937 Bacteria 2385
81 Ga0081538_10006545 3300005981 Bacteria 10232
82 Ga0081539_10028290 3300005985 Bacteria 3527
83 Ga0081539_10030495 3300005985 Bacteria 3345
84 Ga0075363_100053180 3300006048 Bacteria 2163
85 Ga0075364_10046119 3300006051 Bacteria 2838
86 Ga0070712_100001870 3300006175 Bacteria 12848
87 Ga0075366_10053062 3300006195 Bacteria 2408
88 Ga0075370_10038326 3300006353 Bacteria 2697
89 Ga0075431_100053550 3300006847 Bacteria 4160
90 Ga0075434_100023686 3300006871 Bacteria 5988
91 Ga0075436_100000720 3300006914 Bacteria 21898
92 Ga0097620_100001286 3300006931 Bacteria 25622
93 Ga0097620_100095232 3300006931 Bacteria 3030
94 Ga0097620_100097478 3300006931 Bacteria 2994
95 Ga0079104_1016760 3300006946 Bacteria 2130
96 Ga0075435_100085091 3300007076 Bacteria 2603
97 Ga0105240_10008009 3300009093 Bacteria 15218
98 Ga0105240_10041127 3300009093 Bacteria 5903
99 Ga0105245_10332201 3300009098 Bacteria 1501
100 Ga0105243_10001261 3300009148 Bacteria 22743
101 Ga0105243_10405953 3300009148 Bacteria 1267
102 Ga0105241_10142009 3300009174 Bacteria 1956
103 Ga0105241_10290044 3300009174 Bacteria 1401
104 Ga0105242_10076982 3300009176 Bacteria 2782
105 Ga0105242_10104991 3300009176 Bacteria 2399
106 Ga0105248_10006088 3300009177 Bacteria 13234
107 Ga0105237_10006681 3300009545 Bacteria 12750
108 Ga0105237_10107412 3300009545 Bacteria 2783
109 Ga0105237_10226951 3300009545 Bacteria 1868
110 Ga0105238_10009161 3300009551 Bacteria 9910
111 Ga0105238_10061150 3300009551 Bacteria 3770
112 Ga0105238_10251117 3300009551 Bacteria 1747
113 Ga0105238_10283925 3300009551 Bacteria 1637
114 Ga0105249_10000244 3300009553 Bacteria 60263
115 Ga0105249_10174218 3300009553 Bacteria 2088
116 Ga0105249_10203480 3300009553 Bacteria 1939
117 Ga0105249_10260745 3300009553 Bacteria 1722
118 Ga0105249_10554028 3300009553 Bacteria 1201
119 Ga0105239_10489347 3300010375 Bacteria 1398
120 Ga0105239_10512436 3300010375 Bacteria 1364
121 Ga0105246_10180109 3300011119 Bacteria 1626
122 Ga0157373_10080111 3300013100 Bacteria 2303
123 Ga0157371_10000747 3300013102 Bacteria 37686
124 Ga0157370_10029166 3300013104 Bacteria 5420
125 Ga0157370_10033946 3300013104 Bacteria 4971
126 Ga0157369_10003048 3300013105 Bacteria 19997
127 Ga0157369_10097410 3300013105 Bacteria 3138
128 Ga0157374_10516300 3300013296 Bacteria 1200
129 Ga0157378_10093529 3300013297 Bacteria 2737
130 Ga0163162_10311615 3300013306 Bacteria 1706
131 Ga0157372_10415613 3300013307 Bacteria 1567
132 Ga0163163_10174107 3300014325 Bacteria 2199
133 Ga0157377_10112319 3300014745 Bacteria 1639
134 Ga0157379_10009377 3300014968 Bacteria 8529
135 Ga0157379_10266459 3300014968 Bacteria 1557
136 Ga0183363_1002 3300015690 Bacteria 425040
137 Ga0206353_10967427 3300020082 Bacteria 2793
138 Ga0213873_10000007 3300021358 Bacteria 309961
139 Ga0213876_10000005 3300021384 Bacteria 727326
140 Ga0213876_10077103 3300021384 Bacteria 1760
141 Ga0213875_10002026 3300021388 Bacteria 12482
142 Ga0209563_100105 3300025230 Bacteria 147936
143 Ga0209563_101798 3300025230 Bacteria 5327
144 Ga0207425_1000094 3300025245 Bacteria 85629
145 Ga0207425_1004731 3300025245 Bacteria 4010
146 Ga0209646_1014936 3300025246 Bacteria 1164
147 Ga0209677_103597 3300025253 Bacteria 4915
148 Ga0209148_1000011 3300025254 Bacteria 1196503
149 Ga0209148_1000238 3300025254 Bacteria 87836
150 Ga0209129_1005757 3300025258 Bacteria 4249
151 Ga0209233_1017719 3300025261 Bacteria 1933
152 Ga0209565_1000011 3300025263 Bacteria 637062
153 Ga0209565_1000149 3300025263 Bacteria 96195
154 Ga0209565_1000386 3300025263 Bacteria 37364
155 Ga0209455_1000006 3300025272 Bacteria 1196503
156 Ga0209673_1000902 3300025273 Bacteria 37959
157 Ga0209673_1006361 3300025273 Bacteria 5716
158 Ga0209675_1004628 3300025291 Bacteria 6048
159 Ga0209675_1006535 3300025291 Bacteria 4653
160 Ga0209676_1017478 3300025292 Bacteria 2537
161 Ga0209025_1000727 3300025294 Bacteria 55857
162 Ga0209564_1001341 3300025295 Bacteria 26209
163 Ga0209758_1000002 3300025297 Bacteria 1400310
164 Ga0209758_1000023 3300025297 Bacteria 612453
165 Ga0209758_1000108 3300025297 Bacteria 216541
166 Ga0209758_1016139 3300025297 Bacteria 3810
167 Ga0209050_1000342 3300025298 Bacteria 92644
168 Ga0209050_1010036 3300025298 Bacteria 4732
169 Ga0209050_1010379 3300025298 Bacteria 4599
170 Ga0209256_1000016 3300025299 Bacteria 599092
171 Ga0209256_1009780 3300025299 Bacteria 4134
172 Ga0209051_1000226 3300025303 Bacteria 94990
173 Ga0209257_1000112 3300025304 Bacteria 234058
174 Ga0209257_1001798 3300025304 Bacteria 23555
175 Ga0209257_1009856 3300025304 Bacteria 4991
176 Ga0209257_1011330 3300025304 Bacteria 4312
177 Ga0207656_10005244 3300025321 Bacteria 4566
178 Ga0207682_10057987 3300025893 Bacteria 1615
179 Ga0207682_10127503 3300025893 Bacteria 1134
180 Ga0207680_10001557 3300025903 Bacteria 10806
181 Ga0207699_10000517 3300025906 Bacteria 19151
182 Ga0207645_10121881 3300025907 Bacteria 1693
183 Ga0207705_10000076 3300025909 Bacteria 122975
184 Ga0207705_10000319 3300025909 Bacteria 43949
185 Ga0207654_10002561 3300025911 Bacteria 9226
186 Ga0207707_10048443 3300025912 Bacteria 3701
187 Ga0207707_10076984 3300025912 Bacteria 2911
188 Ga0207695_10053961 3300025913 Bacteria 4201
189 Ga0207695_10064201 3300025913 Bacteria 3782
190 Ga0207695_10084164 3300025913 Bacteria 3212
191 Ga0207671_10019101 3300025914 Bacteria 5249
192 Ga0207671_10023877 3300025914 Bacteria 4606
193 Ga0207671_10042102 3300025914 Bacteria 3381
194 Ga0207693_10002910 3300025915 Bacteria 14823
195 Ga0207693_10006853 3300025915 Bacteria 9407
196 Ga0207663_10026639 3300025916 Bacteria 3359
197 Ga0207660_10022300 3300025917 Bacteria 4266
198 Ga0207657_10014944 3300025919 Bacteria 7544
199 Ga0207657_10019727 3300025919 Bacteria 6392
200 Ga0207657_10022464 3300025919 Bacteria 5900
201 Ga0207657_10194415 3300025919 Bacteria 1635
202 Ga0207649_10000220 3300025920 Bacteria 46886
203 Ga0207649_10000986 3300025920 Bacteria 17615
204 Ga0207652_10000004 3300025921 Bacteria 436303
205 Ga0207652_10164725 3300025921 Bacteria 1988
206 Ga0207681_10019658 3300025923 Bacteria 4271
207 Ga0207681_10131888 3300025923 Bacteria 1849
208 Ga0207694_10013789 3300025924 Bacteria 6093
209 Ga0207694_10080383 3300025924 Bacteria 2558
210 Ga0207694_10169538 3300025924 Bacteria 1767
211 Ga0207650_10096664 3300025925 Bacteria 2266
212 Ga0207659_10177354 3300025926 Bacteria 1685
213 Ga0207700_10000972 3300025928 Bacteria 16548
214 Ga0207644_10000025 3300025931 Bacteria 152401
215 Ga0207690_10002620 3300025932 Bacteria 10835
216 Ga0207706_10153778 3300025933 Bacteria 2023
217 Ga0207686_10088543 3300025934 Bacteria 2038
218 Ga0207709_10000039 3300025935 Bacteria 260127
219 Ga0207669_10001720 3300025937 Bacteria 9284
220 Ga0207669_10208516 3300025937 Bacteria 1424
221 Ga0207665_10021654 3300025939 Bacteria 4228
222 Ga0207711_10001387 3300025941 Bacteria 22798
223 Ga0207667_10000006 3300025949 Bacteria 679876
224 Ga0207667_10003097 3300025949 Bacteria 20583
225 Ga0207667_10009399 3300025949 Bacteria 11521
226 Ga0207712_10000149 3300025961 Bacteria 72521
227 Ga0207712_10050590 3300025961 Bacteria 2902
228 Ga0207712_10226873 3300025961 Bacteria 1497
229 Ga0207668_10000085 3300025972 Bacteria 70401
230 Ga0207668_10037414 3300025972 Bacteria 3247
231 Ga0207640_10000413 3300025981 Bacteria 26988
232 Ga0207658_10000022 3300025986 Bacteria 191235
233 Ga0207658_10228821 3300025986 Bacteria 1568
234 Ga0207639_10003109 3300026041 Bacteria 11160
235 Ga0207639_10150567 3300026041 Bacteria 1948
236 Ga0207639_10448921 3300026041 Bacteria 1170
237 Ga0207702_10000182 3300026078 Bacteria 75732
238 Ga0207702_10001450 3300026078 Bacteria 23586
239 Ga0207702_10058805 3300026078 Bacteria 3272
240 Ga0207702_10076340 3300026078 Bacteria 2896
241 Ga0207702_10266123 3300026078 Bacteria 1616
242 Ga0207702_10343908 3300026078 Bacteria 1425
243 Ga0207641_10000001 3300026088 Bacteria 1180841
244 Ga0207641_10000139 3300026088 Bacteria 105740
245 Ga0207641_10022466 3300026088 Bacteria 5192
246 Ga0207674_10000003 3300026116 Bacteria 241674
247 Ga0207674_10099388 3300026116 Bacteria 2892
248 Ga0207675_100000122 3300026118 Bacteria 63834
249 Ga0207675_100141489 3300026118 Bacteria 2286
250 Ga0207698_10130092 3300026142 Bacteria 2149
251 Ga0209974_10014028 3300027876 Bacteria 2670
252 Ga0268266_10000002 3300028379 Bacteria 3059047
253 Ga0268266_10188781 3300028379 Bacteria 1880
254 Ga0268265_10001866 3300028380 Bacteria 16787
255 Ga0268265_10005820 3300028380 Bacteria 8407
256 Ga0268265_10443654 3300028380 Bacteria 1210
257 Ga0268264_10000910 3300028381 Bacteria 31062
258 Ga0268264_10009537 3300028381 Bacteria 8041
259 Ga0307517_10051484 3300028786 Bacteria 4155
260 Ga0265325_10043397 3300031241 Bacteria 2346
261 Ga0265340_10026611 3300031247 Bacteria 2922
262 Ga0265340_10065942 3300031247 Bacteria 1723
263 Ga0265339_10116732 3300031249 Bacteria 1376
264 Ga0307513_10011050 3300031456 Bacteria 11260
265 Ga0307408_100300628 3300031548 Bacteria 1344
266 Ga0307408_100350870 3300031548 Bacteria 1252
267 Ga0307408_100397567 3300031548 Bacteria 1182
268 Ga0265313_10051589 3300031595 Bacteria 1968
269 Ga0265313_10082963 3300031595 Bacteria 1452
270 Ga0265314_10189594 3300031711 Bacteria 1225
271 Ga0265342_10040124 3300031712 Bacteria 2840
272 Ga0307405_10084921 3300031731 Bacteria 2079
273 Ga0307410_10257052 3300031852 Bacteria 1360
274 Ga0307410_10260920 3300031852 Bacteria 1351
275 Ga0307410_10363074 3300031852 Bacteria 1160
276 Ga0307406_10386076 3300031901 Bacteria 1105
277 Ga0307412_10204884 3300031911 Bacteria 1501
278 Ga0307416_100249772 3300032002 Bacteria 1725
279 Ga0307416_100290420 3300032002 Bacteria 1618
280 Ga0307411_10168733 3300032005 Bacteria 1648
281 Ga0307411_10179724 3300032005 Bacteria 1604
282 Ga0307411_10543514 3300032005 Bacteria 990
283 Ga0307415_100227181 3300032126 Bacteria 1500
284 Ga0316593_10012562 3300032168 Bacteria 2488
285 Ga0307510_10032156 3300033180 Bacteria 5915
286 Ga0373946_0154957 3300035171 Bacteria 1072
287 Ga0373924_0129500 3300035410 Bacteria 1098
288 Ga0373931_0087396 3300035691 Bacteria 1731
289 Ga0373935_0032086 3300035692 Bacteria 3263
290 Ga0373935_0131151 3300035692 Bacteria 1684
291 Ga0373927_0118392 3300035695 Bacteria 1728
292 Ga0373933_0032856 3300035724 Bacteria 3016
293 Ga0373947_0143436 3300035725 Bacteria 1534
294 Ga0373925_0095947 3300037068 Bacteria 2272
295 Ga0373925_0129870 3300037068 Bacteria 1964
296 Ga0395900_0001580 3300037418 Bacteria 26952
297 Ga0395900_0370977 3300037418 Bacteria 1401
298 Ga0395905_0000538 3300037471 Bacteria 51665
299 Ga0436364_0333182 3300037853 Bacteria 2544
300 Ga0436364_1265123 3300037853 Bacteria 88807
301 Ga0395901_0001664 3300038443 Bacteria 22942
302 Ga0400483_031499 3300039062 Bacteria 2030
303 Ga0400483_119336 3300039062 Bacteria 3471
304 Ga0400483_170323 3300039062 Bacteria 2427
305 Ga0400483_201528 3300039062 Bacteria 1332
306 Ga0400483_204155 3300039062 Bacteria 3571
307 Ga0400483_252307 3300039062 Bacteria 1952
308 Ga0400483_282374 3300039062 Bacteria 3368
309 Ga0436365_0477684 3300039437 Bacteria 1613
310 Ga0436365_1257511 3300039437 Bacteria 4106
311 Ga0436365_1739626 3300039437 Bacteria 1932
312 Ga0436363_0656603 3300039450 Bacteria 1026
313 Ga0436363_1509974 3300039450 Bacteria 1039
314 Ga0436362_0451893 3300039453 Bacteria 163419
315 Ga0451802_1305520 3300041460 Bacteria 1564
316 Ga0451806_696590 3300041462 Bacteria 2064
317 Ga0451807_2598915 3300041486 Bacteria 1773
318 Ga0451839_0640379 3300041496 Bacteria 1191
319 Ga0439433_0037298 3300041999 Bacteria 1125
320 Ga0466966_0014386 3300044684 Bacteria 5238
321 Ga0466968_0126260 3300044735 Bacteria 1161
322 Ga0466967_0098402 3300045976 Bacteria 2671
323 Ga0495627_017065 3300046453 Bacteria 2475
324 Ga0495603_0178135 3300046455 Bacteria 1230
325 Ga0495629_0185012 3300046459 Bacteria 1443
326 Ga0495638_0000880 3300046460 Bacteria 30953
327 Ga0495638_0107971 3300046460 Bacteria 1656
328 Ga0495650_0009791 3300046471 Bacteria 5417
329 Ga0495650_0016554 3300046471 Bacteria 3731
330 Ga0495584_0074913 3300046491 Bacteria 1701
331 Ga0495583_0017427 3300046506 Bacteria 3813
332 Ga0495583_0044038 3300046506 Bacteria 2074
333 Ga0495583_0150050 3300046506 Bacteria 966
334 Ga0495606_0010652 3300046507 Bacteria 7603
335 Ga0495618_0038799 3300046514 Bacteria 2994
336 Ga0495630_0182949 3300046517 Bacteria 1598
337 Ga0495631_0017612 3300046518 Bacteria 3376
338 Ga0495637_0020860 3300046520 Bacteria 3008
339 Ga0495643_0010747 3300046522 Bacteria 5622
340 Ga0495643_0068761 3300046522 Bacteria 1863
341 Ga0495648_0000189 3300046524 Bacteria 70824
342 Ga0495663_0027967 3300046525 Bacteria 1657
343 Ga0495663_0100391 3300046525 Bacteria 952
344 Ga0495652_0024549 3300046529 Bacteria 5335
345 Ga0495586_0046653 3300046535 Bacteria 2336
346 Ga0495587_0050347 3300046536 Bacteria 2464
347 Ga0495597_0035459 3300046542 Bacteria 2250
348 Ga0495633_0000547 3300046558 Bacteria 37231
349 Ga0495668_0000181 3300046616 Bacteria 94147
350 Ga0495634_0110315 3300046642 Bacteria 1769
351 Ga0495625_0000069 3300046660 Bacteria 168800
352 Ga0495625_0000312 3300046660 Bacteria 74208
353 Ga0495625_0020815 3300046660 Bacteria 5058
354 Ga0495661_0064542 3300046665 Bacteria 2160
355 Ga0495661_0126449 3300046665 Bacteria 1406
356 Ga0495657_0037118 3300046675 Bacteria 3361
357 Ga0495599_0095460 3300046678 Bacteria 1855
358 Ga0495669_0000179 3300046684 Bacteria 39746
359 Ga0495670_0000037 3300046691 Bacteria 77395
360 Ga0495670_0004999 3300046691 Bacteria 6519
361 Ga0495649_0116620 3300046694 Bacteria 1413
362 Ga0495600_0010218 3300046809 Bacteria 5818
363 Ga0495660_0029133 3300046810 Bacteria 3117
364 Ga0495604_0017212 3300047317 Bacteria 5783
365 Ga0495683_0039227 3300047323 Bacteria 2394
366 Ga0495687_001524 3300047443 Bacteria 21144
367 Ga0495687_019736 3300047443 Bacteria 3298
368 Ga0495687_096452 3300047443 Bacteria 1119
369 Ga0495681_0031838 3300047470 Bacteria 2662
370 Ga0495684_0163614 3300047471 Bacteria 1659
371 Ga0495686_0000733 3300047472 Bacteria 43762
372 Ga0495686_0086989 3300047472 Bacteria 1901
373 Ga0495602_0180704 3300048088 Bacteria 1627
374 Ga0495602_0318774 3300048088 Bacteria 1132
375 Ga0495615_0001828 3300048090 Bacteria 3261
376 Ga0496101_0144474 3300048904 Bacteria 1816
377 Ga0496102_0020799 3300048905 Bacteria 5799
378 Ga0496103_0009250 3300048906 Bacteria 5838
379 Ga0496104_0020854 3300048907 Bacteria 6010
380 Ga0496105_0016339 3300048908 Bacteria 5924
381 Ga0496110_0059344 3300048913 Bacteria 3372
382 Ga0496111_0211076 3300048914 Bacteria 1442
383 Ga0496114_0254748 3300048917 Bacteria 1544
384 Ga0496115_0023531 3300048918 Bacteria 4780
385 Ga0496115_0122170 3300048918 Bacteria 2143
386 Ga0496115_0134511 3300048918 Bacteria 2038
387 Ga0496116_0050896 3300048919 Bacteria 2756
388 Ga0496117_0017135 3300048920 Bacteria 6064
389 Ga0496118_0002303 3300048921 Bacteria 25934
390 Ga0496118_0138372 3300048921 Bacteria 1549
391 Ga0496119_0000709 3300048922 Bacteria 44727
392 Ga0496119_0006343 3300048922 Bacteria 11005
393 Ga0496119_0099574 3300048922 Bacteria 1634
394 Ga0496120_0066963 3300048923 Bacteria 1985
395 Ga0496121_0028100 3300048924 Bacteria 5244
396 Ga0496121_0042369 3300048924 Bacteria 3961
397 Ga0496122_0002977 3300048925 Bacteria 23060
398 Ga0496122_0027958 3300048925 Bacteria 4803
399 Ga0496122_0028769 3300048925 Bacteria 4704
400 Ga0496122_0036712 3300048925 Bacteria 3956
401 Ga0496123_0001738 3300048926 Bacteria 28825
402 Ga0496123_0006131 3300048926 Bacteria 11786
403 Ga0496123_0016942 3300048926 Bacteria 5886
404 Ga0496123_0081756 3300048926 Bacteria 1961
405 Ga0496123_0184192 3300048926 Bacteria 1087
406 Ga0496124_0000041 3300048927 Bacteria 303887
407 Ga0496124_0132316 3300048927 Bacteria 1980
408 Ga0496124_0144999 3300048927 Bacteria 1869
409 Ga0496125_0091644 3300048928 Bacteria 2276
410 Ga0496125_0093451 3300048928 Bacteria 2244
411 Ga0496125_0135487 3300048928 Bacteria 1724
412 Ga0496126_0023311 3300048929 Bacteria 5998
413 Ga0496126_0315944 3300048929 Bacteria 1285
414 Ga0495682_0032610 3300049460 Bacteria 1924
415 Ga0501031_0026677 3300049568 Bacteria 3765
416 Ga0501033_0044178 3300049570 Bacteria 3317
417 Ga0501034_0168221 3300049571 Bacteria 2160
418 Ga0501034_0228932 3300049571 Bacteria 1808
419 Ga0501034_0275716 3300049571 Bacteria 1622
420 Ga0501034_0287800 3300049571 Bacteria 1582
421 Ga0501034_0308712 3300049571 Bacteria 1517
422 Ga0501036_0018011 3300049572 Bacteria 5913
423 Ga0501037_0052290 3300049573 Bacteria 2988
424 Ga0501038_0000045 3300049574 Bacteria 106662
425 Ga0501038_0115359 3300049574 Bacteria 2220
426 Ga0501038_0488468 3300049574 Bacteria 943
427 Ga0501039_0002298 3300049575 Bacteria 14183
428 Ga0501040_0041762 3300049576 Bacteria 3124
429 Ga0501040_0387449 3300049576 Bacteria 1003
430 Ga0501041_0025595 3300049577 Bacteria 3546
431 Ga0501042_0042874 3300049578 Bacteria 3221
432 Ga0501043_0083200 3300049579 Bacteria 2516
433 Ga0501046_0009232 3300049580 Bacteria 8538
434 Ga0501047_0187626 3300049581 Bacteria 1932
435 Ga0501047_0220089 3300049581 Bacteria 1755
436 Ga0501047_0732207 3300049581 Bacteria 805
437 Ga0501048_0012542 3300049582 Bacteria 6306
438 Ga0501068_0020446 3300049584 Bacteria 3857
439 Ga0501069_0161715 3300049585 Bacteria 1289
440 Ga0501070_0086584 3300049586 Bacteria 2594
441 Ga0501070_0401927 3300049586 Bacteria 1108
442 Ga0501071_0003945 3300049587 Bacteria 9358
443 Ga0501072_0012326 3300049588 Bacteria 6533
444 Ga0501073_0068029 3300049589 Bacteria 2483
445 Ga0501073_0116432 3300049589 Bacteria 1852
446 Ga0501073_0118126 3300049589 Bacteria 1838
447 Ga0501075_0033152 3300049591 Bacteria 3841
448 Ga0501075_0150364 3300049591 Bacteria 1775
449 Ga0501077_0004830 3300049593 Bacteria 8189
450 Ga0501249_000467 3300049679 Bacteria 10062
451 Ga0501079_0011483 3300049741 Bacteria 6760
452 Ga0501080_0015858 3300049742 Bacteria 6951
453 Ga0501080_0154983 3300049742 Bacteria 2116
454 Ga0501081_0080531 3300049743 Bacteria 2279
455 Ga0501083_0002667 3300049744 Bacteria 12290
456 Ga0501083_0067310 3300049744 Bacteria 2385
457 Ga0501241_013007 3300049758 Bacteria 1511
458 Ga0501035_0091932 3300049822 Bacteria 2670
459 Ga0501035_0127867 3300049822 Bacteria 2217
460 Ga0501044_0113591 3300049823 Bacteria 2715
461 Ga0501044_0377706 3300049823 Bacteria 1333
462 Ga0501045_0005934 3300049824 Bacteria 8447
463 nmdc:mga00v17_10584_c1 3300050491 Bacteria 5042
464 nmdc:mga0k408_22257_c2 3300050493 Bacteria 2545
465 nmdc:mga0k408_85039_c1 3300050493 Bacteria 1856
466 nmdc:mga07m45_64995_c1 3300050496 Bacteria 2071
467 nmdc:mga0qj67_103718_c1 3300050509 Bacteria 2294
468 nmdc:mga0n895_61594_c1 3300050512 Bacteria 3705
469 nmdc:mga08x19_65610_c1 3300050514 Bacteria 2358
470 nmdc:mga08x19_89_c1 3300050514 Bacteria 82051
471 nmdc:mga0sz30_43297_c1 3300050516 Bacteria 1895
472 Ga0500610_0000436 3300053079 Bacteria 12880
473 Ga0495619_0151904 3300053085 Bacteria 1597
474 Ga0500643_000112 3300053087 Bacteria 84793
475 Ga0500643_003022 3300053087 Bacteria 8318
476 Ga0500643_014901 3300053087 Bacteria 2683
477 Ga0500643_018918 3300053087 Bacteria 2277
478 Ga0500566_0018190 3300053094 Bacteria 4128
479 Ga0500566_0022608 3300053094 Bacteria 3694
480 Ga0500566_0073865 3300053094 Bacteria 1910
481 Ga0500556_0000077 3300053104 Bacteria 94403
482 Ga0500556_0004003 3300053104 Bacteria 4248
483 Ga0500592_003045 3300053116 Bacteria 2681
484 Ga0500595_017878 3300053119 Bacteria 2605
485 Ga0500595_027337 3300053119 Bacteria 1954
486 Ga0500618_015818 3300053125 Bacteria 1899
487 Ga0500621_087436 3300053126 Bacteria 1243
488 Ga0500642_0014330 3300053130 Bacteria 2946
489 Ga0500658_0007887 3300053134 Bacteria 3934
490 Ga0500559_0022633 3300053136 Bacteria 2665
491 Ga0500559_0064670 3300053136 Bacteria 1637
492 Ga0500568_0059284 3300053139 Bacteria 1485
493 Ga0500573_0007085 3300053140 Bacteria 6099
494 Ga0500577_0055348 3300053142 Bacteria 1506
495 Ga0500590_028920 3300053148 Bacteria 2875
496 Ga0500616_0006367 3300053153 Bacteria 7746
497 Ga0500616_0045815 3300053153 Bacteria 2328
498 Ga0500622_0003668 3300053156 Bacteria 10088
499 Ga0500624_000100 3300053157 Bacteria 41296
500 Ga0500627_0050590 3300053158 Bacteria 1810
501 Ga0500636_0006048 3300053177 Bacteria 6943
502 Ga0500636_0064566 3300053177 Bacteria 2132
503 Ga0500645_000132 3300053730 Bacteria 58716
504 Ga0500645_008234 3300053730 Bacteria 3575
505 Ga0500645_014763 3300053730 Bacteria 2485
506 Ga0500596_007330 3300053735 Bacteria 1812
507 Ga0500599_000339 3300053736 Bacteria 4628
508 Ga0501084_0020696 3300054114 Bacteria 5487
509 Ga0500661_004776 3300055283 Bacteria 2531
510 Ga0587068_011041 3300059641 Bacteria 1356
511 Ga0501082_0010226 3300060353 Bacteria 8078
512 Ga0501082_0149490 3300060353 Bacteria 2028
513 Ga0530510_0006210 3300061734 Bacteria 8306
514 2509152192 2508501128 Bacteria 8613869
515 2511125468 2510917020 Bacteria 5657507
516 2644128194 2643221622 Bacteria 4212502
517 2819553029 2818991438 Bacteria 5793701
518 2840880322 2840878972 Bacteria 5483153
519 2885428637 2885427238 Bacteria 2291351
520 2885430251 2885429604 Bacteria 3642894
521 2919452702 2919450847 Bacteria 5631160
522 2919681939 2919679072 Bacteria 4629602
523 2935774274 2935769743 Bacteria 7878163
524 8016565814 8016557553 Bacteria 8154380
525 Ga0055536_1014747
526 ARCol0yngRDRAFT_1002397
527 JGI24736J21556_1000147
528 JGI25150J39212_1000349
529 JGI25153J46596_10014916
530 Ga0055542_1000040
531 Ga0055542_1000609
532 Ga0055542_1005454
533 Ga0055529_1000037
534 Ga0055526_1002525
535 Ga0055537_1003425
536 Ga0055537_1007393
537 Ga0055537_1013825
538 Ga0055524_1000209
539 Ga0055524_1011023
540 Ga0055528_1002220
541 Ga0055540_1001501
542 Ga0055531_10016667
543 Ga0065165_1008513
544 Ga0065165_1017252
545 Ga0065165_1022328
546 Ga0070658_10006404
547 Ga0070658_10204652
548 Ga0070658_10278111
549 Ga0070683_100132035
550 Ga0070670_100034317
551 Ga0070677_10130476
552 Ga0070666_10185827
553 Ga0070666_10186202
554 Ga0070682_100126065
555 Ga0070660_100234038
556 Ga0070691_10012537
557 Ga0070661_100000933
558 Ga0070661_100095000
559 Ga0070661_100216530
560 Ga0070668_100000123
561 Ga0070668_100000479
562 Ga0070669_100068932
563 Ga0070669_100242406
564 Ga0070675_100176998
565 Ga0070671_100124028
566 Ga0070674_100063196
567 Ga0070688_100167200
568 Ga0070659_100080749
569 Ga0070659_100260581
570 Ga0070667_100000024
571 Ga0070709_10151827
572 Ga0070709_10347685
573 Ga0070713_100000121
574 Ga0070711_100033560
575 Ga0070663_100255079
576 Ga0070678_100012561
577 Ga0070681_10104601
578 Ga0070681_10223985
579 Ga0070699_100154609
580 Ga0070679_100000019
581 Ga0068853_100005255
582 Ga0068853_100324676
583 Ga0070695_100136548
584 Ga0070704_100292766
585 Ga0068855_100067127
586 Ga0068855_100372792
587 Ga0070664_100227872
588 Ga0068857_100004014
589 Ga0068856_100000497
590 Ga0068856_100001104
591 Ga0068859_100001286
592 Ga0068859_100095238
593 Ga0068859_100097479
594 Ga0068861_100000046
595 Ga0068863_100000020
596 Ga0068863_100000082
597 Ga0068863_100037980
598 Ga0068860_100000938
599 Ga0068860_100020798
600 Ga0068860_100340126
601 Ga0068862_100000236
602 Ga0068862_100006902
603 Ga0068862_100082933
604 Ga0081455_10096438
605 Ga0081538_10006545
606 Ga0081539_10028290
607 Ga0081539_10030495
608 Ga0075363_100053180
609 Ga0075364_10046119
610 Ga0070712_100001870
611 Ga0075366_10053062
612 Ga0075370_10038326
613 Ga0075431_100053550
614 Ga0075434_100023686
615 Ga0075436_100000720
616 Ga0097620_100001286
617 Ga0097620_100095232
618 Ga0097620_100097478
619 Ga0079104_1016760
620 Ga0075435_100085091
621 Ga0105240_10008009
622 Ga0105240_10041127
623 Ga0105245_10332201
624 Ga0105243_10001261
625 Ga0105243_10405953
626 Ga0105241_10142009
627 Ga0105241_10290044
628 Ga0105242_10076982
629 Ga0105242_10104991
630 Ga0105248_10006088
631 Ga0105237_10006681
632 Ga0105237_10107412
633 Ga0105237_10226951
634 Ga0105238_10009161
635 Ga0105238_10061150
636 Ga0105238_10251117
637 Ga0105238_10283925
638 Ga0105249_10000244
639 Ga0105249_10174218
640 Ga0105249_10203480
641 Ga0105249_10260745
642 Ga0105249_10554028
643 Ga0105239_10489347
644 Ga0105239_10512436
645 Ga0105246_10180109
646 Ga0157373_10080111
647 Ga0157371_10000747
648 Ga0157370_10029166
649 Ga0157370_10033946
650 Ga0157369_10003048
651 Ga0157369_10097410
652 Ga0157374_10516300
653 Ga0157378_10093529
654 Ga0163162_10311615
655 Ga0157372_10415613
656 Ga0163163_10174107
657 Ga0157377_10112319
658 Ga0157379_10009377
659 Ga0157379_10266459
660 Ga0183363_1002
661 Ga0206353_10967427
662 Ga0213873_10000007
663 Ga0213876_10000005
664 Ga0213876_10077103
665 Ga0213875_10002026
666 Ga0209563_100105
667 Ga0209563_101798
668 Ga0207425_1000094
669 Ga0207425_1004731
670 Ga0209646_1014936
671 Ga0209677_103597
672 Ga0209148_1000011
673 Ga0209148_1000238
674 Ga0209129_1005757
675 Ga0209233_1017719
676 Ga0209565_1000011
677 Ga0209565_1000149
678 Ga0209565_1000386
679 Ga0209455_1000006
680 Ga0209673_1000902
681 Ga0209673_1006361
682 Ga0209675_1004628
683 Ga0209675_1006535
684 Ga0209676_1017478
685 Ga0209025_1000727
686 Ga0209564_1001341
687 Ga0209758_1000002
688 Ga0209758_1000023
689 Ga0209758_1000108
690 Ga0209758_1016139
691 Ga0209050_1000342
692 Ga0209050_1010036
693 Ga0209050_1010379
694 Ga0209256_1000016
695 Ga0209256_1009780
696 Ga0209051_1000226
697 Ga0209257_1000112
698 Ga0209257_1001798
699 Ga0209257_1009856
700 Ga0209257_1011330
701 Ga0207656_10005244
702 Ga0207682_10057987
703 Ga0207682_10127503
704 Ga0207680_10001557
705 Ga0207699_10000517
706 Ga0207645_10121881
707 Ga0207705_10000076
708 Ga0207705_10000319
709 Ga0207654_10002561
710 Ga0207707_10048443
711 Ga0207707_10076984
712 Ga0207695_10053961
713 Ga0207695_10064201
714 Ga0207695_10084164
715 Ga0207671_10019101
716 Ga0207671_10023877
717 Ga0207671_10042102
718 Ga0207693_10002910
719 Ga0207693_10006853
720 Ga0207663_10026639
721 Ga0207660_10022300
722 Ga0207657_10014944
723 Ga0207657_10019727
724 Ga0207657_10022464
725 Ga0207657_10194415
726 Ga0207649_10000220
727 Ga0207649_10000986
728 Ga0207652_10000004
729 Ga0207652_10164725
730 Ga0207681_10019658
731 Ga0207681_10131888
732 Ga0207694_10013789
733 Ga0207694_10080383
734 Ga0207694_10169538
735 Ga0207650_10096664
736 Ga0207659_10177354
737 Ga0207700_10000972
738 Ga0207644_10000025
739 Ga0207690_10002620
740 Ga0207706_10153778
741 Ga0207686_10088543
742 Ga0207709_10000039
743 Ga0207669_10001720
744 Ga0207669_10208516
745 Ga0207665_10021654
746 Ga0207711_10001387
747 Ga0207667_10000006
748 Ga0207667_10003097
749 Ga0207667_10009399
750 Ga0207712_10000149
751 Ga0207712_10050590
752 Ga0207712_10226873
753 Ga0207668_10000085
754 Ga0207668_10037414
755 Ga0207640_10000413
756 Ga0207658_10000022
757 Ga0207658_10228821
758 Ga0207639_10003109
759 Ga0207639_10150567
760 Ga0207639_10448921
761 Ga0207702_10000182
762 Ga0207702_10001450
763 Ga0207702_10058805
764 Ga0207702_10076340
765 Ga0207702_10266123
766 Ga0207702_10343908
767 Ga0207641_10000001
768 Ga0207641_10000139
769 Ga0207641_10022466
770 Ga0207674_10000003
771 Ga0207674_10099388
772 Ga0207675_100000122
773 Ga0207675_100141489
774 Ga0207698_10130092
775 Ga0209974_10014028
776 Ga0268266_10000002
777 Ga0268266_10188781
778 Ga0268265_10001866
779 Ga0268265_10005820
780 Ga0268265_10443654
781 Ga0268264_10000910
782 Ga0268264_10009537
783 Ga0307517_10051484
784 Ga0265325_10043397
785 Ga0265340_10026611
786 Ga0265340_10065942
787 Ga0265339_10116732
788 Ga0307513_10011050
789 Ga0307408_100300628
790 Ga0307408_100350870
791 Ga0307408_100397567
792 Ga0265313_10051589
793 Ga0265313_10082963
794 Ga0265314_10189594
795 Ga0265342_10040124
796 Ga0307405_10084921
797 Ga0307410_10257052
798 Ga0307410_10260920
799 Ga0307410_10363074
800 Ga0307406_10386076
801 Ga0307412_10204884
802 Ga0307416_100249772
803 Ga0307416_100290420
804 Ga0307411_10168733
805 Ga0307411_10179724
806 Ga0307411_10543514
807 Ga0307415_100227181
808 Ga0316593_10012562
809 Ga0307510_10032156
810 Ga0373946_0154957
811 Ga0373924_0129500
812 Ga0373931_0087396
813 Ga0373935_0032086
814 Ga0373935_0131151
815 Ga0373927_0118392
816 Ga0373933_0032856
817 Ga0373947_0143436
818 Ga0373925_0095947
819 Ga0373925_0129870
820 Ga0395900_0001580
821 Ga0395900_0370977
822 Ga0395905_0000538
823 Ga0436364_0333182
824 Ga0436364_1265123
825 Ga0395901_0001664
826 Ga0400483_031499
827 Ga0400483_119336
828 Ga0400483_170323
829 Ga0400483_201528
830 Ga0400483_204155
831 Ga0400483_252307
832 Ga0400483_282374
833 Ga0436365_0477684
834 Ga0436365_1257511
835 Ga0436365_1739626
836 Ga0436363_0656603
837 Ga0436363_1509974
838 Ga0436362_0451893
839 Ga0451802_1305520
840 Ga0451806_696590
841 Ga0451807_2598915
842 Ga0451839_0640379
843 Ga0439433_0037298
844 Ga0466966_0014386
845 Ga0466968_0126260
846 Ga0466967_0098402
847 Ga0495627_017065
848 Ga0495603_0178135
849 Ga0495629_0185012
850 Ga0495638_0000880
851 Ga0495638_0107971
852 Ga0495650_0009791
853 Ga0495650_0016554
854 Ga0495584_0074913
855 Ga0495583_0017427
856 Ga0495583_0044038
857 Ga0495583_0150050
858 Ga0495606_0010652
859 Ga0495618_0038799
860 Ga0495630_0182949
861 Ga0495631_0017612
862 Ga0495637_0020860
863 Ga0495643_0010747
864 Ga0495643_0068761
865 Ga0495648_0000189
866 Ga0495663_0027967
867 Ga0495663_0100391
868 Ga0495652_0024549
869 Ga0495586_0046653
870 Ga0495587_0050347
871 Ga0495597_0035459
872 Ga0495633_0000547
873 Ga0495668_0000181
874 Ga0495634_0110315
875 Ga0495625_0000069
876 Ga0495625_0000312
877 Ga0495625_0020815
878 Ga0495661_0064542
879 Ga0495661_0126449
880 Ga0495657_0037118
881 Ga0495599_0095460
882 Ga0495669_0000179
883 Ga0495670_0000037
884 Ga0495670_0004999
885 Ga0495649_0116620
886 Ga0495600_0010218
887 Ga0495660_0029133
888 Ga0495604_0017212
889 Ga0495683_0039227
890 Ga0495687_001524
891 Ga0495687_019736
892 Ga0495687_096452
893 Ga0495681_0031838
894 Ga0495684_0163614
895 Ga0495686_0000733
896 Ga0495686_0086989
897 Ga0495602_0180704
898 Ga0495602_0318774
899 Ga0495615_0001828
900 Ga0496101_0144474
901 Ga0496102_0020799
902 Ga0496103_0009250
903 Ga0496104_0020854
904 Ga0496105_0016339
905 Ga0496110_0059344
906 Ga0496111_0211076
907 Ga0496114_0254748
908 Ga0496115_0023531
909 Ga0496115_0122170
910 Ga0496115_0134511
911 Ga0496116_0050896
912 Ga0496117_0017135
913 Ga0496118_0002303
914 Ga0496118_0138372
915 Ga0496119_0000709
916 Ga0496119_0006343
917 Ga0496119_0099574
918 Ga0496120_0066963
919 Ga0496121_0028100
920 Ga0496121_0042369
921 Ga0496122_0002977
922 Ga0496122_0027958
923 Ga0496122_0028769
924 Ga0496122_0036712
925 Ga0496123_0001738
926 Ga0496123_0006131
927 Ga0496123_0016942
928 Ga0496123_0081756
929 Ga0496123_0184192
930 Ga0496124_0000041
931 Ga0496124_0132316
932 Ga0496124_0144999
933 Ga0496125_0091644
934 Ga0496125_0093451
935 Ga0496125_0135487
936 Ga0496126_0023311
937 Ga0496126_0315944
938 Ga0495682_0032610
939 Ga0501031_0026677
940 Ga0501033_0044178
941 Ga0501034_0168221
942 Ga0501034_0228932
943 Ga0501034_0275716
944 Ga0501034_0287800
945 Ga0501034_0308712
946 Ga0501036_0018011
947 Ga0501037_0052290
948 Ga0501038_0000045
949 Ga0501038_0115359
950 Ga0501038_0488468
951 Ga0501039_0002298
952 Ga0501040_0041762
953 Ga0501040_0387449
954 Ga0501041_0025595
955 Ga0501042_0042874
956 Ga0501043_0083200
957 Ga0501046_0009232
958 Ga0501047_0187626
959 Ga0501047_0220089
960 Ga0501047_0732207
961 Ga0501048_0012542
962 Ga0501068_0020446
963 Ga0501069_0161715
964 Ga0501070_0086584
965 Ga0501070_0401927
966 Ga0501071_0003945
967 Ga0501072_0012326
968 Ga0501073_0068029
969 Ga0501073_0116432
970 Ga0501073_0118126
971 Ga0501075_0033152
972 Ga0501075_0150364
973 Ga0501077_0004830
974 Ga0501249_000467
975 Ga0501079_0011483
976 Ga0501080_0015858
977 Ga0501080_0154983
978 Ga0501081_0080531
979 Ga0501083_0002667
980 Ga0501083_0067310
981 Ga0501241_013007
982 Ga0501035_0091932
983 Ga0501035_0127867
984 Ga0501044_0113591
985 Ga0501044_0377706
986 Ga0501045_0005934
987 nmdc:mga00v17_10584_c1
988 nmdc:mga0k408_22257_c2
989 nmdc:mga0k408_85039_c1
990 nmdc:mga07m45_64995_c1
991 nmdc:mga0qj67_103718_c1
992 nmdc:mga0n895_61594_c1
993 nmdc:mga08x19_65610_c1
994 nmdc:mga08x19_89_c1
995 nmdc:mga0sz30_43297_c1
996 Ga0500610_0000436
997 Ga0495619_0151904
998 Ga0500643_000112
999 Ga0500643_003022
1000 Ga0500643_014901
1001 Ga0500643_018918
1002 Ga0500566_0018190
1003 Ga0500566_0022608
1004 Ga0500566_0073865
1005 Ga0500556_0000077
1006 Ga0500556_0004003
1007 Ga0500592_003045
1008 Ga0500595_017878
1009 Ga0500595_027337
1010 Ga0500618_015818
1011 Ga0500621_087436
1012 Ga0500642_0014330
1013 Ga0500658_0007887
1014 Ga0500559_0022633
1015 Ga0500559_0064670
1016 Ga0500568_0059284
1017 Ga0500573_0007085
1018 Ga0500577_0055348
1019 Ga0500590_028920
1020 Ga0500616_0006367
1021 Ga0500616_0045815
1022 Ga0500622_0003668
1023 Ga0500624_000100
1024 Ga0500627_0050590
1025 Ga0500636_0006048
1026 Ga0500636_0064566
1027 Ga0500645_000132
1028 Ga0500645_008234
1029 Ga0500645_014763
1030 Ga0500596_007330
1031 Ga0500599_000339
1032 Ga0501084_0020696
1033 Ga0500661_004776
1034 Ga0587068_011041
1035 Ga0501082_0010226
1036 Ga0501082_0149490
1037 Ga0530510_0006210
1038 2509152192
1039 2511125468
1040 2644128194
1041 2819553029
1042 2840880322
1043 2885428637
1044 2885430251
1045 2919452702
1046 2919681939
1047 2935774274
1048 8016565814

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

3

278

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tsf-assembly1.cif.gz_G the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase 0.8971 2 296
4tsf-assembly1.cif.gz_G the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase 0.8929 2 296
5dn6-assembly1.cif.gz_G atp synthase from paracoccus denitrificans 0.8877 3 296
5dn6-assembly1.cif.gz_G atp synthase from paracoccus denitrificans 0.8845 3 296
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8836 3 296
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9092 75 197 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8957 28 253 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8826 28 253 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8707 77 175 3.40.1380.10
3oaaG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8671 75 197 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A2E3C4P0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.9391 1 296 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A2E3C4P0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.936 1 296 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A355USC6-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.9356 1 296 GO:0005524
GO:0031676
GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.9333 1 251 GO:0045261
GO:0046933
AF-A0A7C3K599-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.928 1 295 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933

Map