F459089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 335 | 1048 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300003781|Ga0055536_1014747|Ga0055536_10147472 |
| Length | 320 |
| Sequence | MASLKALKIRIGSVKSTQKITKAMKMVAAAKLRRAQEAAEAGRPYAQRLEAVVASLASKISVSESSPKLLAGTGKDQVHLLVIATSDKGLAGAFNTNIARLARRHAQELLAQGKTVKIYTIGRKGRAVLNRQFPKNIVHSIEPGDLGKLSFAXARGYADDLIARFEAGEFDVATLFYSTFKSVLAQEPTAQQIIPVAIPQAETAAVSSGAAVTYEPDEESILADLLPRNVAIQLFRAMRENAASEQGSKMTAMDNATRNAGDLIKRLNTIYNRQRRPRSRPSWWKSFRAPKRSKTVRTRKQQWQPKLPSQRPTMAAASAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 194 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 299 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 310 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 314 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 315 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 322 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 326 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 327 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 328 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 329 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 330 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 331 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 332 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 333 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 334 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 335 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.33 |
| Metatranscriptomes | 0.57 |
| Isolates | 2.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.7 |
| Nodule | 0.76 |
| Rhizoplane | 2.67 |
| Rhizosphere | 67.75 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1014747 | 3300003781 | Bacteria | 2718 |
| 2 | ARCol0yngRDRAFT_1002397 | 3300000652 | Bacteria | 1417 |
| 3 | JGI24736J21556_1000147 | 3300001904 | Bacteria | 12247 |
| 4 | JGI25150J39212_1000349 | 3300002774 | Bacteria | 22660 |
| 5 | JGI25153J46596_10014916 | 3300003215 | Bacteria | 3198 |
| 6 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 7 | Ga0055542_1000609 | 3300003762 | Bacteria | 30543 |
| 8 | Ga0055542_1005454 | 3300003762 | Bacteria | 2875 |
| 9 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 10 | Ga0055526_1002525 | 3300003771 | Bacteria | 12297 |
| 11 | Ga0055537_1003425 | 3300003773 | Bacteria | 4882 |
| 12 | Ga0055537_1007393 | 3300003773 | Bacteria | 2653 |
| 13 | Ga0055537_1013825 | 3300003773 | Bacteria | 1495 |
| 14 | Ga0055524_1000209 | 3300003775 | Bacteria | 62993 |
| 15 | Ga0055524_1011023 | 3300003775 | Bacteria | 3558 |
| 16 | Ga0055528_1002220 | 3300003790 | Bacteria | 10590 |
| 17 | Ga0055540_1001501 | 3300003792 | Bacteria | 13868 |
| 18 | Ga0055531_10016667 | 3300003794 | Bacteria | 3154 |
| 19 | Ga0065165_1008513 | 3300005262 | Bacteria | 4779 |
| 20 | Ga0065165_1017252 | 3300005262 | Bacteria | 2667 |
| 21 | Ga0065165_1022328 | 3300005262 | Bacteria | 2172 |
| 22 | Ga0070658_10006404 | 3300005327 | Bacteria | 9539 |
| 23 | Ga0070658_10204652 | 3300005327 | Bacteria | 1666 |
| 24 | Ga0070658_10278111 | 3300005327 | Bacteria | 1424 |
| 25 | Ga0070683_100132035 | 3300005329 | Bacteria | 2364 |
| 26 | Ga0070670_100034317 | 3300005331 | Bacteria | 4366 |
| 27 | Ga0070677_10130476 | 3300005333 | Bacteria | 1147 |
| 28 | Ga0070666_10185827 | 3300005335 | Bacteria | 1459 |
| 29 | Ga0070666_10186202 | 3300005335 | Bacteria | 1458 |
| 30 | Ga0070682_100126065 | 3300005337 | Bacteria | 1726 |
| 31 | Ga0070660_100234038 | 3300005339 | Bacteria | 1495 |
| 32 | Ga0070691_10012537 | 3300005341 | Bacteria | 3881 |
| 33 | Ga0070661_100000933 | 3300005344 | Bacteria | 20889 |
| 34 | Ga0070661_100095000 | 3300005344 | Bacteria | 2210 |
| 35 | Ga0070661_100216530 | 3300005344 | Bacteria | 1467 |
| 36 | Ga0070668_100000123 | 3300005347 | Bacteria | 48192 |
| 37 | Ga0070668_100000479 | 3300005347 | Bacteria | 26526 |
| 38 | Ga0070669_100068932 | 3300005353 | Bacteria | 2612 |
| 39 | Ga0070669_100242406 | 3300005353 | Bacteria | 1433 |
| 40 | Ga0070675_100176998 | 3300005354 | Bacteria | 1842 |
| 41 | Ga0070671_100124028 | 3300005355 | Bacteria | 2174 |
| 42 | Ga0070674_100063196 | 3300005356 | Bacteria | 2590 |
| 43 | Ga0070688_100167200 | 3300005365 | Bacteria | 1515 |
| 44 | Ga0070659_100080749 | 3300005366 | Bacteria | 2596 |
| 45 | Ga0070659_100260581 | 3300005366 | Bacteria | 1438 |
| 46 | Ga0070667_100000024 | 3300005367 | Bacteria | 191216 |
| 47 | Ga0070709_10151827 | 3300005434 | Bacteria | 1601 |
| 48 | Ga0070709_10347685 | 3300005434 | Bacteria | 1095 |
| 49 | Ga0070713_100000121 | 3300005436 | Bacteria | 50650 |
| 50 | Ga0070711_100033560 | 3300005439 | Bacteria | 3418 |
| 51 | Ga0070663_100255079 | 3300005455 | Bacteria | 1389 |
| 52 | Ga0070678_100012561 | 3300005456 | Bacteria | 5272 |
| 53 | Ga0070681_10104601 | 3300005458 | Bacteria | 2773 |
| 54 | Ga0070681_10223985 | 3300005458 | Bacteria | 1796 |
| 55 | Ga0070699_100154609 | 3300005518 | Bacteria | 2029 |
| 56 | Ga0070679_100000019 | 3300005530 | Bacteria | 127108 |
| 57 | Ga0068853_100005255 | 3300005539 | Bacteria | 10138 |
| 58 | Ga0068853_100324676 | 3300005539 | Bacteria | 1427 |
| 59 | Ga0070695_100136548 | 3300005545 | Bacteria | 1696 |
| 60 | Ga0070704_100292766 | 3300005549 | Bacteria | 1353 |
| 61 | Ga0068855_100067127 | 3300005563 | Bacteria | 4180 |
| 62 | Ga0068855_100372792 | 3300005563 | Bacteria | 1568 |
| 63 | Ga0070664_100227872 | 3300005564 | Bacteria | 1669 |
| 64 | Ga0068857_100004014 | 3300005577 | Bacteria | 12392 |
| 65 | Ga0068856_100000497 | 3300005614 | Bacteria | 43608 |
| 66 | Ga0068856_100001104 | 3300005614 | Bacteria | 28526 |
| 67 | Ga0068859_100001286 | 3300005617 | Bacteria | 25622 |
| 68 | Ga0068859_100095238 | 3300005617 | Bacteria | 3030 |
| 69 | Ga0068859_100097479 | 3300005617 | Bacteria | 2994 |
| 70 | Ga0068861_100000046 | 3300005719 | Bacteria | 56414 |
| 71 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 72 | Ga0068863_100000082 | 3300005841 | Bacteria | 105688 |
| 73 | Ga0068863_100037980 | 3300005841 | Bacteria | 4583 |
| 74 | Ga0068860_100000938 | 3300005843 | Bacteria | 32302 |
| 75 | Ga0068860_100020798 | 3300005843 | Bacteria | 6357 |
| 76 | Ga0068860_100340126 | 3300005843 | Bacteria | 1475 |
| 77 | Ga0068862_100000236 | 3300005844 | Bacteria | 61275 |
| 78 | Ga0068862_100006902 | 3300005844 | Bacteria | 9417 |
| 79 | Ga0068862_100082933 | 3300005844 | Bacteria | 2783 |
| 80 | Ga0081455_10096438 | 3300005937 | Bacteria | 2385 |
| 81 | Ga0081538_10006545 | 3300005981 | Bacteria | 10232 |
| 82 | Ga0081539_10028290 | 3300005985 | Bacteria | 3527 |
| 83 | Ga0081539_10030495 | 3300005985 | Bacteria | 3345 |
| 84 | Ga0075363_100053180 | 3300006048 | Bacteria | 2163 |
| 85 | Ga0075364_10046119 | 3300006051 | Bacteria | 2838 |
| 86 | Ga0070712_100001870 | 3300006175 | Bacteria | 12848 |
| 87 | Ga0075366_10053062 | 3300006195 | Bacteria | 2408 |
| 88 | Ga0075370_10038326 | 3300006353 | Bacteria | 2697 |
| 89 | Ga0075431_100053550 | 3300006847 | Bacteria | 4160 |
| 90 | Ga0075434_100023686 | 3300006871 | Bacteria | 5988 |
| 91 | Ga0075436_100000720 | 3300006914 | Bacteria | 21898 |
| 92 | Ga0097620_100001286 | 3300006931 | Bacteria | 25622 |
| 93 | Ga0097620_100095232 | 3300006931 | Bacteria | 3030 |
| 94 | Ga0097620_100097478 | 3300006931 | Bacteria | 2994 |
| 95 | Ga0079104_1016760 | 3300006946 | Bacteria | 2130 |
| 96 | Ga0075435_100085091 | 3300007076 | Bacteria | 2603 |
| 97 | Ga0105240_10008009 | 3300009093 | Bacteria | 15218 |
| 98 | Ga0105240_10041127 | 3300009093 | Bacteria | 5903 |
| 99 | Ga0105245_10332201 | 3300009098 | Bacteria | 1501 |
| 100 | Ga0105243_10001261 | 3300009148 | Bacteria | 22743 |
| 101 | Ga0105243_10405953 | 3300009148 | Bacteria | 1267 |
| 102 | Ga0105241_10142009 | 3300009174 | Bacteria | 1956 |
| 103 | Ga0105241_10290044 | 3300009174 | Bacteria | 1401 |
| 104 | Ga0105242_10076982 | 3300009176 | Bacteria | 2782 |
| 105 | Ga0105242_10104991 | 3300009176 | Bacteria | 2399 |
| 106 | Ga0105248_10006088 | 3300009177 | Bacteria | 13234 |
| 107 | Ga0105237_10006681 | 3300009545 | Bacteria | 12750 |
| 108 | Ga0105237_10107412 | 3300009545 | Bacteria | 2783 |
| 109 | Ga0105237_10226951 | 3300009545 | Bacteria | 1868 |
| 110 | Ga0105238_10009161 | 3300009551 | Bacteria | 9910 |
| 111 | Ga0105238_10061150 | 3300009551 | Bacteria | 3770 |
| 112 | Ga0105238_10251117 | 3300009551 | Bacteria | 1747 |
| 113 | Ga0105238_10283925 | 3300009551 | Bacteria | 1637 |
| 114 | Ga0105249_10000244 | 3300009553 | Bacteria | 60263 |
| 115 | Ga0105249_10174218 | 3300009553 | Bacteria | 2088 |
| 116 | Ga0105249_10203480 | 3300009553 | Bacteria | 1939 |
| 117 | Ga0105249_10260745 | 3300009553 | Bacteria | 1722 |
| 118 | Ga0105249_10554028 | 3300009553 | Bacteria | 1201 |
| 119 | Ga0105239_10489347 | 3300010375 | Bacteria | 1398 |
| 120 | Ga0105239_10512436 | 3300010375 | Bacteria | 1364 |
| 121 | Ga0105246_10180109 | 3300011119 | Bacteria | 1626 |
| 122 | Ga0157373_10080111 | 3300013100 | Bacteria | 2303 |
| 123 | Ga0157371_10000747 | 3300013102 | Bacteria | 37686 |
| 124 | Ga0157370_10029166 | 3300013104 | Bacteria | 5420 |
| 125 | Ga0157370_10033946 | 3300013104 | Bacteria | 4971 |
| 126 | Ga0157369_10003048 | 3300013105 | Bacteria | 19997 |
| 127 | Ga0157369_10097410 | 3300013105 | Bacteria | 3138 |
| 128 | Ga0157374_10516300 | 3300013296 | Bacteria | 1200 |
| 129 | Ga0157378_10093529 | 3300013297 | Bacteria | 2737 |
| 130 | Ga0163162_10311615 | 3300013306 | Bacteria | 1706 |
| 131 | Ga0157372_10415613 | 3300013307 | Bacteria | 1567 |
| 132 | Ga0163163_10174107 | 3300014325 | Bacteria | 2199 |
| 133 | Ga0157377_10112319 | 3300014745 | Bacteria | 1639 |
| 134 | Ga0157379_10009377 | 3300014968 | Bacteria | 8529 |
| 135 | Ga0157379_10266459 | 3300014968 | Bacteria | 1557 |
| 136 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 137 | Ga0206353_10967427 | 3300020082 | Bacteria | 2793 |
| 138 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 139 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 140 | Ga0213876_10077103 | 3300021384 | Bacteria | 1760 |
| 141 | Ga0213875_10002026 | 3300021388 | Bacteria | 12482 |
| 142 | Ga0209563_100105 | 3300025230 | Bacteria | 147936 |
| 143 | Ga0209563_101798 | 3300025230 | Bacteria | 5327 |
| 144 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 145 | Ga0207425_1004731 | 3300025245 | Bacteria | 4010 |
| 146 | Ga0209646_1014936 | 3300025246 | Bacteria | 1164 |
| 147 | Ga0209677_103597 | 3300025253 | Bacteria | 4915 |
| 148 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 149 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 150 | Ga0209129_1005757 | 3300025258 | Bacteria | 4249 |
| 151 | Ga0209233_1017719 | 3300025261 | Bacteria | 1933 |
| 152 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 153 | Ga0209565_1000149 | 3300025263 | Bacteria | 96195 |
| 154 | Ga0209565_1000386 | 3300025263 | Bacteria | 37364 |
| 155 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 156 | Ga0209673_1000902 | 3300025273 | Bacteria | 37959 |
| 157 | Ga0209673_1006361 | 3300025273 | Bacteria | 5716 |
| 158 | Ga0209675_1004628 | 3300025291 | Bacteria | 6048 |
| 159 | Ga0209675_1006535 | 3300025291 | Bacteria | 4653 |
| 160 | Ga0209676_1017478 | 3300025292 | Bacteria | 2537 |
| 161 | Ga0209025_1000727 | 3300025294 | Bacteria | 55857 |
| 162 | Ga0209564_1001341 | 3300025295 | Bacteria | 26209 |
| 163 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 164 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 165 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 166 | Ga0209758_1016139 | 3300025297 | Bacteria | 3810 |
| 167 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 168 | Ga0209050_1010036 | 3300025298 | Bacteria | 4732 |
| 169 | Ga0209050_1010379 | 3300025298 | Bacteria | 4599 |
| 170 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 171 | Ga0209256_1009780 | 3300025299 | Bacteria | 4134 |
| 172 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 173 | Ga0209257_1000112 | 3300025304 | Bacteria | 234058 |
| 174 | Ga0209257_1001798 | 3300025304 | Bacteria | 23555 |
| 175 | Ga0209257_1009856 | 3300025304 | Bacteria | 4991 |
| 176 | Ga0209257_1011330 | 3300025304 | Bacteria | 4312 |
| 177 | Ga0207656_10005244 | 3300025321 | Bacteria | 4566 |
| 178 | Ga0207682_10057987 | 3300025893 | Bacteria | 1615 |
| 179 | Ga0207682_10127503 | 3300025893 | Bacteria | 1134 |
| 180 | Ga0207680_10001557 | 3300025903 | Bacteria | 10806 |
| 181 | Ga0207699_10000517 | 3300025906 | Bacteria | 19151 |
| 182 | Ga0207645_10121881 | 3300025907 | Bacteria | 1693 |
| 183 | Ga0207705_10000076 | 3300025909 | Bacteria | 122975 |
| 184 | Ga0207705_10000319 | 3300025909 | Bacteria | 43949 |
| 185 | Ga0207654_10002561 | 3300025911 | Bacteria | 9226 |
| 186 | Ga0207707_10048443 | 3300025912 | Bacteria | 3701 |
| 187 | Ga0207707_10076984 | 3300025912 | Bacteria | 2911 |
| 188 | Ga0207695_10053961 | 3300025913 | Bacteria | 4201 |
| 189 | Ga0207695_10064201 | 3300025913 | Bacteria | 3782 |
| 190 | Ga0207695_10084164 | 3300025913 | Bacteria | 3212 |
| 191 | Ga0207671_10019101 | 3300025914 | Bacteria | 5249 |
| 192 | Ga0207671_10023877 | 3300025914 | Bacteria | 4606 |
| 193 | Ga0207671_10042102 | 3300025914 | Bacteria | 3381 |
| 194 | Ga0207693_10002910 | 3300025915 | Bacteria | 14823 |
| 195 | Ga0207693_10006853 | 3300025915 | Bacteria | 9407 |
| 196 | Ga0207663_10026639 | 3300025916 | Bacteria | 3359 |
| 197 | Ga0207660_10022300 | 3300025917 | Bacteria | 4266 |
| 198 | Ga0207657_10014944 | 3300025919 | Bacteria | 7544 |
| 199 | Ga0207657_10019727 | 3300025919 | Bacteria | 6392 |
| 200 | Ga0207657_10022464 | 3300025919 | Bacteria | 5900 |
| 201 | Ga0207657_10194415 | 3300025919 | Bacteria | 1635 |
| 202 | Ga0207649_10000220 | 3300025920 | Bacteria | 46886 |
| 203 | Ga0207649_10000986 | 3300025920 | Bacteria | 17615 |
| 204 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 205 | Ga0207652_10164725 | 3300025921 | Bacteria | 1988 |
| 206 | Ga0207681_10019658 | 3300025923 | Bacteria | 4271 |
| 207 | Ga0207681_10131888 | 3300025923 | Bacteria | 1849 |
| 208 | Ga0207694_10013789 | 3300025924 | Bacteria | 6093 |
| 209 | Ga0207694_10080383 | 3300025924 | Bacteria | 2558 |
| 210 | Ga0207694_10169538 | 3300025924 | Bacteria | 1767 |
| 211 | Ga0207650_10096664 | 3300025925 | Bacteria | 2266 |
| 212 | Ga0207659_10177354 | 3300025926 | Bacteria | 1685 |
| 213 | Ga0207700_10000972 | 3300025928 | Bacteria | 16548 |
| 214 | Ga0207644_10000025 | 3300025931 | Bacteria | 152401 |
| 215 | Ga0207690_10002620 | 3300025932 | Bacteria | 10835 |
| 216 | Ga0207706_10153778 | 3300025933 | Bacteria | 2023 |
| 217 | Ga0207686_10088543 | 3300025934 | Bacteria | 2038 |
| 218 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 219 | Ga0207669_10001720 | 3300025937 | Bacteria | 9284 |
| 220 | Ga0207669_10208516 | 3300025937 | Bacteria | 1424 |
| 221 | Ga0207665_10021654 | 3300025939 | Bacteria | 4228 |
| 222 | Ga0207711_10001387 | 3300025941 | Bacteria | 22798 |
| 223 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 224 | Ga0207667_10003097 | 3300025949 | Bacteria | 20583 |
| 225 | Ga0207667_10009399 | 3300025949 | Bacteria | 11521 |
| 226 | Ga0207712_10000149 | 3300025961 | Bacteria | 72521 |
| 227 | Ga0207712_10050590 | 3300025961 | Bacteria | 2902 |
| 228 | Ga0207712_10226873 | 3300025961 | Bacteria | 1497 |
| 229 | Ga0207668_10000085 | 3300025972 | Bacteria | 70401 |
| 230 | Ga0207668_10037414 | 3300025972 | Bacteria | 3247 |
| 231 | Ga0207640_10000413 | 3300025981 | Bacteria | 26988 |
| 232 | Ga0207658_10000022 | 3300025986 | Bacteria | 191235 |
| 233 | Ga0207658_10228821 | 3300025986 | Bacteria | 1568 |
| 234 | Ga0207639_10003109 | 3300026041 | Bacteria | 11160 |
| 235 | Ga0207639_10150567 | 3300026041 | Bacteria | 1948 |
| 236 | Ga0207639_10448921 | 3300026041 | Bacteria | 1170 |
| 237 | Ga0207702_10000182 | 3300026078 | Bacteria | 75732 |
| 238 | Ga0207702_10001450 | 3300026078 | Bacteria | 23586 |
| 239 | Ga0207702_10058805 | 3300026078 | Bacteria | 3272 |
| 240 | Ga0207702_10076340 | 3300026078 | Bacteria | 2896 |
| 241 | Ga0207702_10266123 | 3300026078 | Bacteria | 1616 |
| 242 | Ga0207702_10343908 | 3300026078 | Bacteria | 1425 |
| 243 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 244 | Ga0207641_10000139 | 3300026088 | Bacteria | 105740 |
| 245 | Ga0207641_10022466 | 3300026088 | Bacteria | 5192 |
| 246 | Ga0207674_10000003 | 3300026116 | Bacteria | 241674 |
| 247 | Ga0207674_10099388 | 3300026116 | Bacteria | 2892 |
| 248 | Ga0207675_100000122 | 3300026118 | Bacteria | 63834 |
| 249 | Ga0207675_100141489 | 3300026118 | Bacteria | 2286 |
| 250 | Ga0207698_10130092 | 3300026142 | Bacteria | 2149 |
| 251 | Ga0209974_10014028 | 3300027876 | Bacteria | 2670 |
| 252 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 253 | Ga0268266_10188781 | 3300028379 | Bacteria | 1880 |
| 254 | Ga0268265_10001866 | 3300028380 | Bacteria | 16787 |
| 255 | Ga0268265_10005820 | 3300028380 | Bacteria | 8407 |
| 256 | Ga0268265_10443654 | 3300028380 | Bacteria | 1210 |
| 257 | Ga0268264_10000910 | 3300028381 | Bacteria | 31062 |
| 258 | Ga0268264_10009537 | 3300028381 | Bacteria | 8041 |
| 259 | Ga0307517_10051484 | 3300028786 | Bacteria | 4155 |
| 260 | Ga0265325_10043397 | 3300031241 | Bacteria | 2346 |
| 261 | Ga0265340_10026611 | 3300031247 | Bacteria | 2922 |
| 262 | Ga0265340_10065942 | 3300031247 | Bacteria | 1723 |
| 263 | Ga0265339_10116732 | 3300031249 | Bacteria | 1376 |
| 264 | Ga0307513_10011050 | 3300031456 | Bacteria | 11260 |
| 265 | Ga0307408_100300628 | 3300031548 | Bacteria | 1344 |
| 266 | Ga0307408_100350870 | 3300031548 | Bacteria | 1252 |
| 267 | Ga0307408_100397567 | 3300031548 | Bacteria | 1182 |
| 268 | Ga0265313_10051589 | 3300031595 | Bacteria | 1968 |
| 269 | Ga0265313_10082963 | 3300031595 | Bacteria | 1452 |
| 270 | Ga0265314_10189594 | 3300031711 | Bacteria | 1225 |
| 271 | Ga0265342_10040124 | 3300031712 | Bacteria | 2840 |
| 272 | Ga0307405_10084921 | 3300031731 | Bacteria | 2079 |
| 273 | Ga0307410_10257052 | 3300031852 | Bacteria | 1360 |
| 274 | Ga0307410_10260920 | 3300031852 | Bacteria | 1351 |
| 275 | Ga0307410_10363074 | 3300031852 | Bacteria | 1160 |
| 276 | Ga0307406_10386076 | 3300031901 | Bacteria | 1105 |
| 277 | Ga0307412_10204884 | 3300031911 | Bacteria | 1501 |
| 278 | Ga0307416_100249772 | 3300032002 | Bacteria | 1725 |
| 279 | Ga0307416_100290420 | 3300032002 | Bacteria | 1618 |
| 280 | Ga0307411_10168733 | 3300032005 | Bacteria | 1648 |
| 281 | Ga0307411_10179724 | 3300032005 | Bacteria | 1604 |
| 282 | Ga0307411_10543514 | 3300032005 | Bacteria | 990 |
| 283 | Ga0307415_100227181 | 3300032126 | Bacteria | 1500 |
| 284 | Ga0316593_10012562 | 3300032168 | Bacteria | 2488 |
| 285 | Ga0307510_10032156 | 3300033180 | Bacteria | 5915 |
| 286 | Ga0373946_0154957 | 3300035171 | Bacteria | 1072 |
| 287 | Ga0373924_0129500 | 3300035410 | Bacteria | 1098 |
| 288 | Ga0373931_0087396 | 3300035691 | Bacteria | 1731 |
| 289 | Ga0373935_0032086 | 3300035692 | Bacteria | 3263 |
| 290 | Ga0373935_0131151 | 3300035692 | Bacteria | 1684 |
| 291 | Ga0373927_0118392 | 3300035695 | Bacteria | 1728 |
| 292 | Ga0373933_0032856 | 3300035724 | Bacteria | 3016 |
| 293 | Ga0373947_0143436 | 3300035725 | Bacteria | 1534 |
| 294 | Ga0373925_0095947 | 3300037068 | Bacteria | 2272 |
| 295 | Ga0373925_0129870 | 3300037068 | Bacteria | 1964 |
| 296 | Ga0395900_0001580 | 3300037418 | Bacteria | 26952 |
| 297 | Ga0395900_0370977 | 3300037418 | Bacteria | 1401 |
| 298 | Ga0395905_0000538 | 3300037471 | Bacteria | 51665 |
| 299 | Ga0436364_0333182 | 3300037853 | Bacteria | 2544 |
| 300 | Ga0436364_1265123 | 3300037853 | Bacteria | 88807 |
| 301 | Ga0395901_0001664 | 3300038443 | Bacteria | 22942 |
| 302 | Ga0400483_031499 | 3300039062 | Bacteria | 2030 |
| 303 | Ga0400483_119336 | 3300039062 | Bacteria | 3471 |
| 304 | Ga0400483_170323 | 3300039062 | Bacteria | 2427 |
| 305 | Ga0400483_201528 | 3300039062 | Bacteria | 1332 |
| 306 | Ga0400483_204155 | 3300039062 | Bacteria | 3571 |
| 307 | Ga0400483_252307 | 3300039062 | Bacteria | 1952 |
| 308 | Ga0400483_282374 | 3300039062 | Bacteria | 3368 |
| 309 | Ga0436365_0477684 | 3300039437 | Bacteria | 1613 |
| 310 | Ga0436365_1257511 | 3300039437 | Bacteria | 4106 |
| 311 | Ga0436365_1739626 | 3300039437 | Bacteria | 1932 |
| 312 | Ga0436363_0656603 | 3300039450 | Bacteria | 1026 |
| 313 | Ga0436363_1509974 | 3300039450 | Bacteria | 1039 |
| 314 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 315 | Ga0451802_1305520 | 3300041460 | Bacteria | 1564 |
| 316 | Ga0451806_696590 | 3300041462 | Bacteria | 2064 |
| 317 | Ga0451807_2598915 | 3300041486 | Bacteria | 1773 |
| 318 | Ga0451839_0640379 | 3300041496 | Bacteria | 1191 |
| 319 | Ga0439433_0037298 | 3300041999 | Bacteria | 1125 |
| 320 | Ga0466966_0014386 | 3300044684 | Bacteria | 5238 |
| 321 | Ga0466968_0126260 | 3300044735 | Bacteria | 1161 |
| 322 | Ga0466967_0098402 | 3300045976 | Bacteria | 2671 |
| 323 | Ga0495627_017065 | 3300046453 | Bacteria | 2475 |
| 324 | Ga0495603_0178135 | 3300046455 | Bacteria | 1230 |
| 325 | Ga0495629_0185012 | 3300046459 | Bacteria | 1443 |
| 326 | Ga0495638_0000880 | 3300046460 | Bacteria | 30953 |
| 327 | Ga0495638_0107971 | 3300046460 | Bacteria | 1656 |
| 328 | Ga0495650_0009791 | 3300046471 | Bacteria | 5417 |
| 329 | Ga0495650_0016554 | 3300046471 | Bacteria | 3731 |
| 330 | Ga0495584_0074913 | 3300046491 | Bacteria | 1701 |
| 331 | Ga0495583_0017427 | 3300046506 | Bacteria | 3813 |
| 332 | Ga0495583_0044038 | 3300046506 | Bacteria | 2074 |
| 333 | Ga0495583_0150050 | 3300046506 | Bacteria | 966 |
| 334 | Ga0495606_0010652 | 3300046507 | Bacteria | 7603 |
| 335 | Ga0495618_0038799 | 3300046514 | Bacteria | 2994 |
| 336 | Ga0495630_0182949 | 3300046517 | Bacteria | 1598 |
| 337 | Ga0495631_0017612 | 3300046518 | Bacteria | 3376 |
| 338 | Ga0495637_0020860 | 3300046520 | Bacteria | 3008 |
| 339 | Ga0495643_0010747 | 3300046522 | Bacteria | 5622 |
| 340 | Ga0495643_0068761 | 3300046522 | Bacteria | 1863 |
| 341 | Ga0495648_0000189 | 3300046524 | Bacteria | 70824 |
| 342 | Ga0495663_0027967 | 3300046525 | Bacteria | 1657 |
| 343 | Ga0495663_0100391 | 3300046525 | Bacteria | 952 |
| 344 | Ga0495652_0024549 | 3300046529 | Bacteria | 5335 |
| 345 | Ga0495586_0046653 | 3300046535 | Bacteria | 2336 |
| 346 | Ga0495587_0050347 | 3300046536 | Bacteria | 2464 |
| 347 | Ga0495597_0035459 | 3300046542 | Bacteria | 2250 |
| 348 | Ga0495633_0000547 | 3300046558 | Bacteria | 37231 |
| 349 | Ga0495668_0000181 | 3300046616 | Bacteria | 94147 |
| 350 | Ga0495634_0110315 | 3300046642 | Bacteria | 1769 |
| 351 | Ga0495625_0000069 | 3300046660 | Bacteria | 168800 |
| 352 | Ga0495625_0000312 | 3300046660 | Bacteria | 74208 |
| 353 | Ga0495625_0020815 | 3300046660 | Bacteria | 5058 |
| 354 | Ga0495661_0064542 | 3300046665 | Bacteria | 2160 |
| 355 | Ga0495661_0126449 | 3300046665 | Bacteria | 1406 |
| 356 | Ga0495657_0037118 | 3300046675 | Bacteria | 3361 |
| 357 | Ga0495599_0095460 | 3300046678 | Bacteria | 1855 |
| 358 | Ga0495669_0000179 | 3300046684 | Bacteria | 39746 |
| 359 | Ga0495670_0000037 | 3300046691 | Bacteria | 77395 |
| 360 | Ga0495670_0004999 | 3300046691 | Bacteria | 6519 |
| 361 | Ga0495649_0116620 | 3300046694 | Bacteria | 1413 |
| 362 | Ga0495600_0010218 | 3300046809 | Bacteria | 5818 |
| 363 | Ga0495660_0029133 | 3300046810 | Bacteria | 3117 |
| 364 | Ga0495604_0017212 | 3300047317 | Bacteria | 5783 |
| 365 | Ga0495683_0039227 | 3300047323 | Bacteria | 2394 |
| 366 | Ga0495687_001524 | 3300047443 | Bacteria | 21144 |
| 367 | Ga0495687_019736 | 3300047443 | Bacteria | 3298 |
| 368 | Ga0495687_096452 | 3300047443 | Bacteria | 1119 |
| 369 | Ga0495681_0031838 | 3300047470 | Bacteria | 2662 |
| 370 | Ga0495684_0163614 | 3300047471 | Bacteria | 1659 |
| 371 | Ga0495686_0000733 | 3300047472 | Bacteria | 43762 |
| 372 | Ga0495686_0086989 | 3300047472 | Bacteria | 1901 |
| 373 | Ga0495602_0180704 | 3300048088 | Bacteria | 1627 |
| 374 | Ga0495602_0318774 | 3300048088 | Bacteria | 1132 |
| 375 | Ga0495615_0001828 | 3300048090 | Bacteria | 3261 |
| 376 | Ga0496101_0144474 | 3300048904 | Bacteria | 1816 |
| 377 | Ga0496102_0020799 | 3300048905 | Bacteria | 5799 |
| 378 | Ga0496103_0009250 | 3300048906 | Bacteria | 5838 |
| 379 | Ga0496104_0020854 | 3300048907 | Bacteria | 6010 |
| 380 | Ga0496105_0016339 | 3300048908 | Bacteria | 5924 |
| 381 | Ga0496110_0059344 | 3300048913 | Bacteria | 3372 |
| 382 | Ga0496111_0211076 | 3300048914 | Bacteria | 1442 |
| 383 | Ga0496114_0254748 | 3300048917 | Bacteria | 1544 |
| 384 | Ga0496115_0023531 | 3300048918 | Bacteria | 4780 |
| 385 | Ga0496115_0122170 | 3300048918 | Bacteria | 2143 |
| 386 | Ga0496115_0134511 | 3300048918 | Bacteria | 2038 |
| 387 | Ga0496116_0050896 | 3300048919 | Bacteria | 2756 |
| 388 | Ga0496117_0017135 | 3300048920 | Bacteria | 6064 |
| 389 | Ga0496118_0002303 | 3300048921 | Bacteria | 25934 |
| 390 | Ga0496118_0138372 | 3300048921 | Bacteria | 1549 |
| 391 | Ga0496119_0000709 | 3300048922 | Bacteria | 44727 |
| 392 | Ga0496119_0006343 | 3300048922 | Bacteria | 11005 |
| 393 | Ga0496119_0099574 | 3300048922 | Bacteria | 1634 |
| 394 | Ga0496120_0066963 | 3300048923 | Bacteria | 1985 |
| 395 | Ga0496121_0028100 | 3300048924 | Bacteria | 5244 |
| 396 | Ga0496121_0042369 | 3300048924 | Bacteria | 3961 |
| 397 | Ga0496122_0002977 | 3300048925 | Bacteria | 23060 |
| 398 | Ga0496122_0027958 | 3300048925 | Bacteria | 4803 |
| 399 | Ga0496122_0028769 | 3300048925 | Bacteria | 4704 |
| 400 | Ga0496122_0036712 | 3300048925 | Bacteria | 3956 |
| 401 | Ga0496123_0001738 | 3300048926 | Bacteria | 28825 |
| 402 | Ga0496123_0006131 | 3300048926 | Bacteria | 11786 |
| 403 | Ga0496123_0016942 | 3300048926 | Bacteria | 5886 |
| 404 | Ga0496123_0081756 | 3300048926 | Bacteria | 1961 |
| 405 | Ga0496123_0184192 | 3300048926 | Bacteria | 1087 |
| 406 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 407 | Ga0496124_0132316 | 3300048927 | Bacteria | 1980 |
| 408 | Ga0496124_0144999 | 3300048927 | Bacteria | 1869 |
| 409 | Ga0496125_0091644 | 3300048928 | Bacteria | 2276 |
| 410 | Ga0496125_0093451 | 3300048928 | Bacteria | 2244 |
| 411 | Ga0496125_0135487 | 3300048928 | Bacteria | 1724 |
| 412 | Ga0496126_0023311 | 3300048929 | Bacteria | 5998 |
| 413 | Ga0496126_0315944 | 3300048929 | Bacteria | 1285 |
| 414 | Ga0495682_0032610 | 3300049460 | Bacteria | 1924 |
| 415 | Ga0501031_0026677 | 3300049568 | Bacteria | 3765 |
| 416 | Ga0501033_0044178 | 3300049570 | Bacteria | 3317 |
| 417 | Ga0501034_0168221 | 3300049571 | Bacteria | 2160 |
| 418 | Ga0501034_0228932 | 3300049571 | Bacteria | 1808 |
| 419 | Ga0501034_0275716 | 3300049571 | Bacteria | 1622 |
| 420 | Ga0501034_0287800 | 3300049571 | Bacteria | 1582 |
| 421 | Ga0501034_0308712 | 3300049571 | Bacteria | 1517 |
| 422 | Ga0501036_0018011 | 3300049572 | Bacteria | 5913 |
| 423 | Ga0501037_0052290 | 3300049573 | Bacteria | 2988 |
| 424 | Ga0501038_0000045 | 3300049574 | Bacteria | 106662 |
| 425 | Ga0501038_0115359 | 3300049574 | Bacteria | 2220 |
| 426 | Ga0501038_0488468 | 3300049574 | Bacteria | 943 |
| 427 | Ga0501039_0002298 | 3300049575 | Bacteria | 14183 |
| 428 | Ga0501040_0041762 | 3300049576 | Bacteria | 3124 |
| 429 | Ga0501040_0387449 | 3300049576 | Bacteria | 1003 |
| 430 | Ga0501041_0025595 | 3300049577 | Bacteria | 3546 |
| 431 | Ga0501042_0042874 | 3300049578 | Bacteria | 3221 |
| 432 | Ga0501043_0083200 | 3300049579 | Bacteria | 2516 |
| 433 | Ga0501046_0009232 | 3300049580 | Bacteria | 8538 |
| 434 | Ga0501047_0187626 | 3300049581 | Bacteria | 1932 |
| 435 | Ga0501047_0220089 | 3300049581 | Bacteria | 1755 |
| 436 | Ga0501047_0732207 | 3300049581 | Bacteria | 805 |
| 437 | Ga0501048_0012542 | 3300049582 | Bacteria | 6306 |
| 438 | Ga0501068_0020446 | 3300049584 | Bacteria | 3857 |
| 439 | Ga0501069_0161715 | 3300049585 | Bacteria | 1289 |
| 440 | Ga0501070_0086584 | 3300049586 | Bacteria | 2594 |
| 441 | Ga0501070_0401927 | 3300049586 | Bacteria | 1108 |
| 442 | Ga0501071_0003945 | 3300049587 | Bacteria | 9358 |
| 443 | Ga0501072_0012326 | 3300049588 | Bacteria | 6533 |
| 444 | Ga0501073_0068029 | 3300049589 | Bacteria | 2483 |
| 445 | Ga0501073_0116432 | 3300049589 | Bacteria | 1852 |
| 446 | Ga0501073_0118126 | 3300049589 | Bacteria | 1838 |
| 447 | Ga0501075_0033152 | 3300049591 | Bacteria | 3841 |
| 448 | Ga0501075_0150364 | 3300049591 | Bacteria | 1775 |
| 449 | Ga0501077_0004830 | 3300049593 | Bacteria | 8189 |
| 450 | Ga0501249_000467 | 3300049679 | Bacteria | 10062 |
| 451 | Ga0501079_0011483 | 3300049741 | Bacteria | 6760 |
| 452 | Ga0501080_0015858 | 3300049742 | Bacteria | 6951 |
| 453 | Ga0501080_0154983 | 3300049742 | Bacteria | 2116 |
| 454 | Ga0501081_0080531 | 3300049743 | Bacteria | 2279 |
| 455 | Ga0501083_0002667 | 3300049744 | Bacteria | 12290 |
| 456 | Ga0501083_0067310 | 3300049744 | Bacteria | 2385 |
| 457 | Ga0501241_013007 | 3300049758 | Bacteria | 1511 |
| 458 | Ga0501035_0091932 | 3300049822 | Bacteria | 2670 |
| 459 | Ga0501035_0127867 | 3300049822 | Bacteria | 2217 |
| 460 | Ga0501044_0113591 | 3300049823 | Bacteria | 2715 |
| 461 | Ga0501044_0377706 | 3300049823 | Bacteria | 1333 |
| 462 | Ga0501045_0005934 | 3300049824 | Bacteria | 8447 |
| 463 | nmdc:mga00v17_10584_c1 | 3300050491 | Bacteria | 5042 |
| 464 | nmdc:mga0k408_22257_c2 | 3300050493 | Bacteria | 2545 |
| 465 | nmdc:mga0k408_85039_c1 | 3300050493 | Bacteria | 1856 |
| 466 | nmdc:mga07m45_64995_c1 | 3300050496 | Bacteria | 2071 |
| 467 | nmdc:mga0qj67_103718_c1 | 3300050509 | Bacteria | 2294 |
| 468 | nmdc:mga0n895_61594_c1 | 3300050512 | Bacteria | 3705 |
| 469 | nmdc:mga08x19_65610_c1 | 3300050514 | Bacteria | 2358 |
| 470 | nmdc:mga08x19_89_c1 | 3300050514 | Bacteria | 82051 |
| 471 | nmdc:mga0sz30_43297_c1 | 3300050516 | Bacteria | 1895 |
| 472 | Ga0500610_0000436 | 3300053079 | Bacteria | 12880 |
| 473 | Ga0495619_0151904 | 3300053085 | Bacteria | 1597 |
| 474 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 475 | Ga0500643_003022 | 3300053087 | Bacteria | 8318 |
| 476 | Ga0500643_014901 | 3300053087 | Bacteria | 2683 |
| 477 | Ga0500643_018918 | 3300053087 | Bacteria | 2277 |
| 478 | Ga0500566_0018190 | 3300053094 | Bacteria | 4128 |
| 479 | Ga0500566_0022608 | 3300053094 | Bacteria | 3694 |
| 480 | Ga0500566_0073865 | 3300053094 | Bacteria | 1910 |
| 481 | Ga0500556_0000077 | 3300053104 | Bacteria | 94403 |
| 482 | Ga0500556_0004003 | 3300053104 | Bacteria | 4248 |
| 483 | Ga0500592_003045 | 3300053116 | Bacteria | 2681 |
| 484 | Ga0500595_017878 | 3300053119 | Bacteria | 2605 |
| 485 | Ga0500595_027337 | 3300053119 | Bacteria | 1954 |
| 486 | Ga0500618_015818 | 3300053125 | Bacteria | 1899 |
| 487 | Ga0500621_087436 | 3300053126 | Bacteria | 1243 |
| 488 | Ga0500642_0014330 | 3300053130 | Bacteria | 2946 |
| 489 | Ga0500658_0007887 | 3300053134 | Bacteria | 3934 |
| 490 | Ga0500559_0022633 | 3300053136 | Bacteria | 2665 |
| 491 | Ga0500559_0064670 | 3300053136 | Bacteria | 1637 |
| 492 | Ga0500568_0059284 | 3300053139 | Bacteria | 1485 |
| 493 | Ga0500573_0007085 | 3300053140 | Bacteria | 6099 |
| 494 | Ga0500577_0055348 | 3300053142 | Bacteria | 1506 |
| 495 | Ga0500590_028920 | 3300053148 | Bacteria | 2875 |
| 496 | Ga0500616_0006367 | 3300053153 | Bacteria | 7746 |
| 497 | Ga0500616_0045815 | 3300053153 | Bacteria | 2328 |
| 498 | Ga0500622_0003668 | 3300053156 | Bacteria | 10088 |
| 499 | Ga0500624_000100 | 3300053157 | Bacteria | 41296 |
| 500 | Ga0500627_0050590 | 3300053158 | Bacteria | 1810 |
| 501 | Ga0500636_0006048 | 3300053177 | Bacteria | 6943 |
| 502 | Ga0500636_0064566 | 3300053177 | Bacteria | 2132 |
| 503 | Ga0500645_000132 | 3300053730 | Bacteria | 58716 |
| 504 | Ga0500645_008234 | 3300053730 | Bacteria | 3575 |
| 505 | Ga0500645_014763 | 3300053730 | Bacteria | 2485 |
| 506 | Ga0500596_007330 | 3300053735 | Bacteria | 1812 |
| 507 | Ga0500599_000339 | 3300053736 | Bacteria | 4628 |
| 508 | Ga0501084_0020696 | 3300054114 | Bacteria | 5487 |
| 509 | Ga0500661_004776 | 3300055283 | Bacteria | 2531 |
| 510 | Ga0587068_011041 | 3300059641 | Bacteria | 1356 |
| 511 | Ga0501082_0010226 | 3300060353 | Bacteria | 8078 |
| 512 | Ga0501082_0149490 | 3300060353 | Bacteria | 2028 |
| 513 | Ga0530510_0006210 | 3300061734 | Bacteria | 8306 |
| 514 | 2509152192 | 2508501128 | Bacteria | 8613869 |
| 515 | 2511125468 | 2510917020 | Bacteria | 5657507 |
| 516 | 2644128194 | 2643221622 | Bacteria | 4212502 |
| 517 | 2819553029 | 2818991438 | Bacteria | 5793701 |
| 518 | 2840880322 | 2840878972 | Bacteria | 5483153 |
| 519 | 2885428637 | 2885427238 | Bacteria | 2291351 |
| 520 | 2885430251 | 2885429604 | Bacteria | 3642894 |
| 521 | 2919452702 | 2919450847 | Bacteria | 5631160 |
| 522 | 2919681939 | 2919679072 | Bacteria | 4629602 |
| 523 | 2935774274 | 2935769743 | Bacteria | 7878163 |
| 524 | 8016565814 | 8016557553 | Bacteria | 8154380 |
| 525 | Ga0055536_1014747 | |||
| 526 | ARCol0yngRDRAFT_1002397 | |||
| 527 | JGI24736J21556_1000147 | |||
| 528 | JGI25150J39212_1000349 | |||
| 529 | JGI25153J46596_10014916 | |||
| 530 | Ga0055542_1000040 | |||
| 531 | Ga0055542_1000609 | |||
| 532 | Ga0055542_1005454 | |||
| 533 | Ga0055529_1000037 | |||
| 534 | Ga0055526_1002525 | |||
| 535 | Ga0055537_1003425 | |||
| 536 | Ga0055537_1007393 | |||
| 537 | Ga0055537_1013825 | |||
| 538 | Ga0055524_1000209 | |||
| 539 | Ga0055524_1011023 | |||
| 540 | Ga0055528_1002220 | |||
| 541 | Ga0055540_1001501 | |||
| 542 | Ga0055531_10016667 | |||
| 543 | Ga0065165_1008513 | |||
| 544 | Ga0065165_1017252 | |||
| 545 | Ga0065165_1022328 | |||
| 546 | Ga0070658_10006404 | |||
| 547 | Ga0070658_10204652 | |||
| 548 | Ga0070658_10278111 | |||
| 549 | Ga0070683_100132035 | |||
| 550 | Ga0070670_100034317 | |||
| 551 | Ga0070677_10130476 | |||
| 552 | Ga0070666_10185827 | |||
| 553 | Ga0070666_10186202 | |||
| 554 | Ga0070682_100126065 | |||
| 555 | Ga0070660_100234038 | |||
| 556 | Ga0070691_10012537 | |||
| 557 | Ga0070661_100000933 | |||
| 558 | Ga0070661_100095000 | |||
| 559 | Ga0070661_100216530 | |||
| 560 | Ga0070668_100000123 | |||
| 561 | Ga0070668_100000479 | |||
| 562 | Ga0070669_100068932 | |||
| 563 | Ga0070669_100242406 | |||
| 564 | Ga0070675_100176998 | |||
| 565 | Ga0070671_100124028 | |||
| 566 | Ga0070674_100063196 | |||
| 567 | Ga0070688_100167200 | |||
| 568 | Ga0070659_100080749 | |||
| 569 | Ga0070659_100260581 | |||
| 570 | Ga0070667_100000024 | |||
| 571 | Ga0070709_10151827 | |||
| 572 | Ga0070709_10347685 | |||
| 573 | Ga0070713_100000121 | |||
| 574 | Ga0070711_100033560 | |||
| 575 | Ga0070663_100255079 | |||
| 576 | Ga0070678_100012561 | |||
| 577 | Ga0070681_10104601 | |||
| 578 | Ga0070681_10223985 | |||
| 579 | Ga0070699_100154609 | |||
| 580 | Ga0070679_100000019 | |||
| 581 | Ga0068853_100005255 | |||
| 582 | Ga0068853_100324676 | |||
| 583 | Ga0070695_100136548 | |||
| 584 | Ga0070704_100292766 | |||
| 585 | Ga0068855_100067127 | |||
| 586 | Ga0068855_100372792 | |||
| 587 | Ga0070664_100227872 | |||
| 588 | Ga0068857_100004014 | |||
| 589 | Ga0068856_100000497 | |||
| 590 | Ga0068856_100001104 | |||
| 591 | Ga0068859_100001286 | |||
| 592 | Ga0068859_100095238 | |||
| 593 | Ga0068859_100097479 | |||
| 594 | Ga0068861_100000046 | |||
| 595 | Ga0068863_100000020 | |||
| 596 | Ga0068863_100000082 | |||
| 597 | Ga0068863_100037980 | |||
| 598 | Ga0068860_100000938 | |||
| 599 | Ga0068860_100020798 | |||
| 600 | Ga0068860_100340126 | |||
| 601 | Ga0068862_100000236 | |||
| 602 | Ga0068862_100006902 | |||
| 603 | Ga0068862_100082933 | |||
| 604 | Ga0081455_10096438 | |||
| 605 | Ga0081538_10006545 | |||
| 606 | Ga0081539_10028290 | |||
| 607 | Ga0081539_10030495 | |||
| 608 | Ga0075363_100053180 | |||
| 609 | Ga0075364_10046119 | |||
| 610 | Ga0070712_100001870 | |||
| 611 | Ga0075366_10053062 | |||
| 612 | Ga0075370_10038326 | |||
| 613 | Ga0075431_100053550 | |||
| 614 | Ga0075434_100023686 | |||
| 615 | Ga0075436_100000720 | |||
| 616 | Ga0097620_100001286 | |||
| 617 | Ga0097620_100095232 | |||
| 618 | Ga0097620_100097478 | |||
| 619 | Ga0079104_1016760 | |||
| 620 | Ga0075435_100085091 | |||
| 621 | Ga0105240_10008009 | |||
| 622 | Ga0105240_10041127 | |||
| 623 | Ga0105245_10332201 | |||
| 624 | Ga0105243_10001261 | |||
| 625 | Ga0105243_10405953 | |||
| 626 | Ga0105241_10142009 | |||
| 627 | Ga0105241_10290044 | |||
| 628 | Ga0105242_10076982 | |||
| 629 | Ga0105242_10104991 | |||
| 630 | Ga0105248_10006088 | |||
| 631 | Ga0105237_10006681 | |||
| 632 | Ga0105237_10107412 | |||
| 633 | Ga0105237_10226951 | |||
| 634 | Ga0105238_10009161 | |||
| 635 | Ga0105238_10061150 | |||
| 636 | Ga0105238_10251117 | |||
| 637 | Ga0105238_10283925 | |||
| 638 | Ga0105249_10000244 | |||
| 639 | Ga0105249_10174218 | |||
| 640 | Ga0105249_10203480 | |||
| 641 | Ga0105249_10260745 | |||
| 642 | Ga0105249_10554028 | |||
| 643 | Ga0105239_10489347 | |||
| 644 | Ga0105239_10512436 | |||
| 645 | Ga0105246_10180109 | |||
| 646 | Ga0157373_10080111 | |||
| 647 | Ga0157371_10000747 | |||
| 648 | Ga0157370_10029166 | |||
| 649 | Ga0157370_10033946 | |||
| 650 | Ga0157369_10003048 | |||
| 651 | Ga0157369_10097410 | |||
| 652 | Ga0157374_10516300 | |||
| 653 | Ga0157378_10093529 | |||
| 654 | Ga0163162_10311615 | |||
| 655 | Ga0157372_10415613 | |||
| 656 | Ga0163163_10174107 | |||
| 657 | Ga0157377_10112319 | |||
| 658 | Ga0157379_10009377 | |||
| 659 | Ga0157379_10266459 | |||
| 660 | Ga0183363_1002 | |||
| 661 | Ga0206353_10967427 | |||
| 662 | Ga0213873_10000007 | |||
| 663 | Ga0213876_10000005 | |||
| 664 | Ga0213876_10077103 | |||
| 665 | Ga0213875_10002026 | |||
| 666 | Ga0209563_100105 | |||
| 667 | Ga0209563_101798 | |||
| 668 | Ga0207425_1000094 | |||
| 669 | Ga0207425_1004731 | |||
| 670 | Ga0209646_1014936 | |||
| 671 | Ga0209677_103597 | |||
| 672 | Ga0209148_1000011 | |||
| 673 | Ga0209148_1000238 | |||
| 674 | Ga0209129_1005757 | |||
| 675 | Ga0209233_1017719 | |||
| 676 | Ga0209565_1000011 | |||
| 677 | Ga0209565_1000149 | |||
| 678 | Ga0209565_1000386 | |||
| 679 | Ga0209455_1000006 | |||
| 680 | Ga0209673_1000902 | |||
| 681 | Ga0209673_1006361 | |||
| 682 | Ga0209675_1004628 | |||
| 683 | Ga0209675_1006535 | |||
| 684 | Ga0209676_1017478 | |||
| 685 | Ga0209025_1000727 | |||
| 686 | Ga0209564_1001341 | |||
| 687 | Ga0209758_1000002 | |||
| 688 | Ga0209758_1000023 | |||
| 689 | Ga0209758_1000108 | |||
| 690 | Ga0209758_1016139 | |||
| 691 | Ga0209050_1000342 | |||
| 692 | Ga0209050_1010036 | |||
| 693 | Ga0209050_1010379 | |||
| 694 | Ga0209256_1000016 | |||
| 695 | Ga0209256_1009780 | |||
| 696 | Ga0209051_1000226 | |||
| 697 | Ga0209257_1000112 | |||
| 698 | Ga0209257_1001798 | |||
| 699 | Ga0209257_1009856 | |||
| 700 | Ga0209257_1011330 | |||
| 701 | Ga0207656_10005244 | |||
| 702 | Ga0207682_10057987 | |||
| 703 | Ga0207682_10127503 | |||
| 704 | Ga0207680_10001557 | |||
| 705 | Ga0207699_10000517 | |||
| 706 | Ga0207645_10121881 | |||
| 707 | Ga0207705_10000076 | |||
| 708 | Ga0207705_10000319 | |||
| 709 | Ga0207654_10002561 | |||
| 710 | Ga0207707_10048443 | |||
| 711 | Ga0207707_10076984 | |||
| 712 | Ga0207695_10053961 | |||
| 713 | Ga0207695_10064201 | |||
| 714 | Ga0207695_10084164 | |||
| 715 | Ga0207671_10019101 | |||
| 716 | Ga0207671_10023877 | |||
| 717 | Ga0207671_10042102 | |||
| 718 | Ga0207693_10002910 | |||
| 719 | Ga0207693_10006853 | |||
| 720 | Ga0207663_10026639 | |||
| 721 | Ga0207660_10022300 | |||
| 722 | Ga0207657_10014944 | |||
| 723 | Ga0207657_10019727 | |||
| 724 | Ga0207657_10022464 | |||
| 725 | Ga0207657_10194415 | |||
| 726 | Ga0207649_10000220 | |||
| 727 | Ga0207649_10000986 | |||
| 728 | Ga0207652_10000004 | |||
| 729 | Ga0207652_10164725 | |||
| 730 | Ga0207681_10019658 | |||
| 731 | Ga0207681_10131888 | |||
| 732 | Ga0207694_10013789 | |||
| 733 | Ga0207694_10080383 | |||
| 734 | Ga0207694_10169538 | |||
| 735 | Ga0207650_10096664 | |||
| 736 | Ga0207659_10177354 | |||
| 737 | Ga0207700_10000972 | |||
| 738 | Ga0207644_10000025 | |||
| 739 | Ga0207690_10002620 | |||
| 740 | Ga0207706_10153778 | |||
| 741 | Ga0207686_10088543 | |||
| 742 | Ga0207709_10000039 | |||
| 743 | Ga0207669_10001720 | |||
| 744 | Ga0207669_10208516 | |||
| 745 | Ga0207665_10021654 | |||
| 746 | Ga0207711_10001387 | |||
| 747 | Ga0207667_10000006 | |||
| 748 | Ga0207667_10003097 | |||
| 749 | Ga0207667_10009399 | |||
| 750 | Ga0207712_10000149 | |||
| 751 | Ga0207712_10050590 | |||
| 752 | Ga0207712_10226873 | |||
| 753 | Ga0207668_10000085 | |||
| 754 | Ga0207668_10037414 | |||
| 755 | Ga0207640_10000413 | |||
| 756 | Ga0207658_10000022 | |||
| 757 | Ga0207658_10228821 | |||
| 758 | Ga0207639_10003109 | |||
| 759 | Ga0207639_10150567 | |||
| 760 | Ga0207639_10448921 | |||
| 761 | Ga0207702_10000182 | |||
| 762 | Ga0207702_10001450 | |||
| 763 | Ga0207702_10058805 | |||
| 764 | Ga0207702_10076340 | |||
| 765 | Ga0207702_10266123 | |||
| 766 | Ga0207702_10343908 | |||
| 767 | Ga0207641_10000001 | |||
| 768 | Ga0207641_10000139 | |||
| 769 | Ga0207641_10022466 | |||
| 770 | Ga0207674_10000003 | |||
| 771 | Ga0207674_10099388 | |||
| 772 | Ga0207675_100000122 | |||
| 773 | Ga0207675_100141489 | |||
| 774 | Ga0207698_10130092 | |||
| 775 | Ga0209974_10014028 | |||
| 776 | Ga0268266_10000002 | |||
| 777 | Ga0268266_10188781 | |||
| 778 | Ga0268265_10001866 | |||
| 779 | Ga0268265_10005820 | |||
| 780 | Ga0268265_10443654 | |||
| 781 | Ga0268264_10000910 | |||
| 782 | Ga0268264_10009537 | |||
| 783 | Ga0307517_10051484 | |||
| 784 | Ga0265325_10043397 | |||
| 785 | Ga0265340_10026611 | |||
| 786 | Ga0265340_10065942 | |||
| 787 | Ga0265339_10116732 | |||
| 788 | Ga0307513_10011050 | |||
| 789 | Ga0307408_100300628 | |||
| 790 | Ga0307408_100350870 | |||
| 791 | Ga0307408_100397567 | |||
| 792 | Ga0265313_10051589 | |||
| 793 | Ga0265313_10082963 | |||
| 794 | Ga0265314_10189594 | |||
| 795 | Ga0265342_10040124 | |||
| 796 | Ga0307405_10084921 | |||
| 797 | Ga0307410_10257052 | |||
| 798 | Ga0307410_10260920 | |||
| 799 | Ga0307410_10363074 | |||
| 800 | Ga0307406_10386076 | |||
| 801 | Ga0307412_10204884 | |||
| 802 | Ga0307416_100249772 | |||
| 803 | Ga0307416_100290420 | |||
| 804 | Ga0307411_10168733 | |||
| 805 | Ga0307411_10179724 | |||
| 806 | Ga0307411_10543514 | |||
| 807 | Ga0307415_100227181 | |||
| 808 | Ga0316593_10012562 | |||
| 809 | Ga0307510_10032156 | |||
| 810 | Ga0373946_0154957 | |||
| 811 | Ga0373924_0129500 | |||
| 812 | Ga0373931_0087396 | |||
| 813 | Ga0373935_0032086 | |||
| 814 | Ga0373935_0131151 | |||
| 815 | Ga0373927_0118392 | |||
| 816 | Ga0373933_0032856 | |||
| 817 | Ga0373947_0143436 | |||
| 818 | Ga0373925_0095947 | |||
| 819 | Ga0373925_0129870 | |||
| 820 | Ga0395900_0001580 | |||
| 821 | Ga0395900_0370977 | |||
| 822 | Ga0395905_0000538 | |||
| 823 | Ga0436364_0333182 | |||
| 824 | Ga0436364_1265123 | |||
| 825 | Ga0395901_0001664 | |||
| 826 | Ga0400483_031499 | |||
| 827 | Ga0400483_119336 | |||
| 828 | Ga0400483_170323 | |||
| 829 | Ga0400483_201528 | |||
| 830 | Ga0400483_204155 | |||
| 831 | Ga0400483_252307 | |||
| 832 | Ga0400483_282374 | |||
| 833 | Ga0436365_0477684 | |||
| 834 | Ga0436365_1257511 | |||
| 835 | Ga0436365_1739626 | |||
| 836 | Ga0436363_0656603 | |||
| 837 | Ga0436363_1509974 | |||
| 838 | Ga0436362_0451893 | |||
| 839 | Ga0451802_1305520 | |||
| 840 | Ga0451806_696590 | |||
| 841 | Ga0451807_2598915 | |||
| 842 | Ga0451839_0640379 | |||
| 843 | Ga0439433_0037298 | |||
| 844 | Ga0466966_0014386 | |||
| 845 | Ga0466968_0126260 | |||
| 846 | Ga0466967_0098402 | |||
| 847 | Ga0495627_017065 | |||
| 848 | Ga0495603_0178135 | |||
| 849 | Ga0495629_0185012 | |||
| 850 | Ga0495638_0000880 | |||
| 851 | Ga0495638_0107971 | |||
| 852 | Ga0495650_0009791 | |||
| 853 | Ga0495650_0016554 | |||
| 854 | Ga0495584_0074913 | |||
| 855 | Ga0495583_0017427 | |||
| 856 | Ga0495583_0044038 | |||
| 857 | Ga0495583_0150050 | |||
| 858 | Ga0495606_0010652 | |||
| 859 | Ga0495618_0038799 | |||
| 860 | Ga0495630_0182949 | |||
| 861 | Ga0495631_0017612 | |||
| 862 | Ga0495637_0020860 | |||
| 863 | Ga0495643_0010747 | |||
| 864 | Ga0495643_0068761 | |||
| 865 | Ga0495648_0000189 | |||
| 866 | Ga0495663_0027967 | |||
| 867 | Ga0495663_0100391 | |||
| 868 | Ga0495652_0024549 | |||
| 869 | Ga0495586_0046653 | |||
| 870 | Ga0495587_0050347 | |||
| 871 | Ga0495597_0035459 | |||
| 872 | Ga0495633_0000547 | |||
| 873 | Ga0495668_0000181 | |||
| 874 | Ga0495634_0110315 | |||
| 875 | Ga0495625_0000069 | |||
| 876 | Ga0495625_0000312 | |||
| 877 | Ga0495625_0020815 | |||
| 878 | Ga0495661_0064542 | |||
| 879 | Ga0495661_0126449 | |||
| 880 | Ga0495657_0037118 | |||
| 881 | Ga0495599_0095460 | |||
| 882 | Ga0495669_0000179 | |||
| 883 | Ga0495670_0000037 | |||
| 884 | Ga0495670_0004999 | |||
| 885 | Ga0495649_0116620 | |||
| 886 | Ga0495600_0010218 | |||
| 887 | Ga0495660_0029133 | |||
| 888 | Ga0495604_0017212 | |||
| 889 | Ga0495683_0039227 | |||
| 890 | Ga0495687_001524 | |||
| 891 | Ga0495687_019736 | |||
| 892 | Ga0495687_096452 | |||
| 893 | Ga0495681_0031838 | |||
| 894 | Ga0495684_0163614 | |||
| 895 | Ga0495686_0000733 | |||
| 896 | Ga0495686_0086989 | |||
| 897 | Ga0495602_0180704 | |||
| 898 | Ga0495602_0318774 | |||
| 899 | Ga0495615_0001828 | |||
| 900 | Ga0496101_0144474 | |||
| 901 | Ga0496102_0020799 | |||
| 902 | Ga0496103_0009250 | |||
| 903 | Ga0496104_0020854 | |||
| 904 | Ga0496105_0016339 | |||
| 905 | Ga0496110_0059344 | |||
| 906 | Ga0496111_0211076 | |||
| 907 | Ga0496114_0254748 | |||
| 908 | Ga0496115_0023531 | |||
| 909 | Ga0496115_0122170 | |||
| 910 | Ga0496115_0134511 | |||
| 911 | Ga0496116_0050896 | |||
| 912 | Ga0496117_0017135 | |||
| 913 | Ga0496118_0002303 | |||
| 914 | Ga0496118_0138372 | |||
| 915 | Ga0496119_0000709 | |||
| 916 | Ga0496119_0006343 | |||
| 917 | Ga0496119_0099574 | |||
| 918 | Ga0496120_0066963 | |||
| 919 | Ga0496121_0028100 | |||
| 920 | Ga0496121_0042369 | |||
| 921 | Ga0496122_0002977 | |||
| 922 | Ga0496122_0027958 | |||
| 923 | Ga0496122_0028769 | |||
| 924 | Ga0496122_0036712 | |||
| 925 | Ga0496123_0001738 | |||
| 926 | Ga0496123_0006131 | |||
| 927 | Ga0496123_0016942 | |||
| 928 | Ga0496123_0081756 | |||
| 929 | Ga0496123_0184192 | |||
| 930 | Ga0496124_0000041 | |||
| 931 | Ga0496124_0132316 | |||
| 932 | Ga0496124_0144999 | |||
| 933 | Ga0496125_0091644 | |||
| 934 | Ga0496125_0093451 | |||
| 935 | Ga0496125_0135487 | |||
| 936 | Ga0496126_0023311 | |||
| 937 | Ga0496126_0315944 | |||
| 938 | Ga0495682_0032610 | |||
| 939 | Ga0501031_0026677 | |||
| 940 | Ga0501033_0044178 | |||
| 941 | Ga0501034_0168221 | |||
| 942 | Ga0501034_0228932 | |||
| 943 | Ga0501034_0275716 | |||
| 944 | Ga0501034_0287800 | |||
| 945 | Ga0501034_0308712 | |||
| 946 | Ga0501036_0018011 | |||
| 947 | Ga0501037_0052290 | |||
| 948 | Ga0501038_0000045 | |||
| 949 | Ga0501038_0115359 | |||
| 950 | Ga0501038_0488468 | |||
| 951 | Ga0501039_0002298 | |||
| 952 | Ga0501040_0041762 | |||
| 953 | Ga0501040_0387449 | |||
| 954 | Ga0501041_0025595 | |||
| 955 | Ga0501042_0042874 | |||
| 956 | Ga0501043_0083200 | |||
| 957 | Ga0501046_0009232 | |||
| 958 | Ga0501047_0187626 | |||
| 959 | Ga0501047_0220089 | |||
| 960 | Ga0501047_0732207 | |||
| 961 | Ga0501048_0012542 | |||
| 962 | Ga0501068_0020446 | |||
| 963 | Ga0501069_0161715 | |||
| 964 | Ga0501070_0086584 | |||
| 965 | Ga0501070_0401927 | |||
| 966 | Ga0501071_0003945 | |||
| 967 | Ga0501072_0012326 | |||
| 968 | Ga0501073_0068029 | |||
| 969 | Ga0501073_0116432 | |||
| 970 | Ga0501073_0118126 | |||
| 971 | Ga0501075_0033152 | |||
| 972 | Ga0501075_0150364 | |||
| 973 | Ga0501077_0004830 | |||
| 974 | Ga0501249_000467 | |||
| 975 | Ga0501079_0011483 | |||
| 976 | Ga0501080_0015858 | |||
| 977 | Ga0501080_0154983 | |||
| 978 | Ga0501081_0080531 | |||
| 979 | Ga0501083_0002667 | |||
| 980 | Ga0501083_0067310 | |||
| 981 | Ga0501241_013007 | |||
| 982 | Ga0501035_0091932 | |||
| 983 | Ga0501035_0127867 | |||
| 984 | Ga0501044_0113591 | |||
| 985 | Ga0501044_0377706 | |||
| 986 | Ga0501045_0005934 | |||
| 987 | nmdc:mga00v17_10584_c1 | |||
| 988 | nmdc:mga0k408_22257_c2 | |||
| 989 | nmdc:mga0k408_85039_c1 | |||
| 990 | nmdc:mga07m45_64995_c1 | |||
| 991 | nmdc:mga0qj67_103718_c1 | |||
| 992 | nmdc:mga0n895_61594_c1 | |||
| 993 | nmdc:mga08x19_65610_c1 | |||
| 994 | nmdc:mga08x19_89_c1 | |||
| 995 | nmdc:mga0sz30_43297_c1 | |||
| 996 | Ga0500610_0000436 | |||
| 997 | Ga0495619_0151904 | |||
| 998 | Ga0500643_000112 | |||
| 999 | Ga0500643_003022 | |||
| 1000 | Ga0500643_014901 | |||
| 1001 | Ga0500643_018918 | |||
| 1002 | Ga0500566_0018190 | |||
| 1003 | Ga0500566_0022608 | |||
| 1004 | Ga0500566_0073865 | |||
| 1005 | Ga0500556_0000077 | |||
| 1006 | Ga0500556_0004003 | |||
| 1007 | Ga0500592_003045 | |||
| 1008 | Ga0500595_017878 | |||
| 1009 | Ga0500595_027337 | |||
| 1010 | Ga0500618_015818 | |||
| 1011 | Ga0500621_087436 | |||
| 1012 | Ga0500642_0014330 | |||
| 1013 | Ga0500658_0007887 | |||
| 1014 | Ga0500559_0022633 | |||
| 1015 | Ga0500559_0064670 | |||
| 1016 | Ga0500568_0059284 | |||
| 1017 | Ga0500573_0007085 | |||
| 1018 | Ga0500577_0055348 | |||
| 1019 | Ga0500590_028920 | |||
| 1020 | Ga0500616_0006367 | |||
| 1021 | Ga0500616_0045815 | |||
| 1022 | Ga0500622_0003668 | |||
| 1023 | Ga0500624_000100 | |||
| 1024 | Ga0500627_0050590 | |||
| 1025 | Ga0500636_0006048 | |||
| 1026 | Ga0500636_0064566 | |||
| 1027 | Ga0500645_000132 | |||
| 1028 | Ga0500645_008234 | |||
| 1029 | Ga0500645_014763 | |||
| 1030 | Ga0500596_007330 | |||
| 1031 | Ga0500599_000339 | |||
| 1032 | Ga0501084_0020696 | |||
| 1033 | Ga0500661_004776 | |||
| 1034 | Ga0587068_011041 | |||
| 1035 | Ga0501082_0010226 | |||
| 1036 | Ga0501082_0149490 | |||
| 1037 | Ga0530510_0006210 | |||
| 1038 | 2509152192 | |||
| 1039 | 2511125468 | |||
| 1040 | 2644128194 | |||
| 1041 | 2819553029 | |||
| 1042 | 2840880322 | |||
| 1043 | 2885428637 | |||
| 1044 | 2885430251 | |||
| 1045 | 2919452702 | |||
| 1046 | 2919681939 | |||
| 1047 | 2935774274 | |||
| 1048 | 8016565814 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tsf-assembly1.cif.gz_G | the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase | 0.8971 | 2 | 296 |
| 4tsf-assembly1.cif.gz_G | the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase | 0.8929 | 2 | 296 |
| 5dn6-assembly1.cif.gz_G | atp synthase from paracoccus denitrificans | 0.8877 | 3 | 296 |
| 5dn6-assembly1.cif.gz_G | atp synthase from paracoccus denitrificans | 0.8845 | 3 | 296 |
| 6foc-assembly1.cif.gz_G | f1-atpase from mycobacterium smegmatis | 0.8836 | 3 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KY89_89_218_3.40.1380.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9092 | 75 | 197 | 3.40.1380.10 |
| 5dn6G02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8957 | 28 | 253 | 3.40.1380.10 |
| 5dn6G02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8826 | 28 | 253 | 3.40.1380.10 |
| af_A0A1D6QQB0_1_102_3.40.1380.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8707 | 77 | 175 | 3.40.1380.10 |
| 3oaaG02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8671 | 75 | 197 | 3.40.1380.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E3C4P0-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.9391 | 1 | 296 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |
| AF-A0A2E3C4P0-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.936 | 1 | 296 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |
| AF-A0A355USC6-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.9356 | 1 | 296 |
GO:0005524
GO:0031676 GO:0045261 GO:0046933 |
| AF-A0A258XLR0-F1-model_v4 | ATP synthase F1 subunit gamma | 0.9333 | 1 | 251 |
GO:0045261
GO:0046933 |
| AF-A0A7C3K599-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.928 | 1 | 295 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |