F459108

General Info

Members Datasets Scaffolds Average Seq Length
524 232 1048 467

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100161157|Ga0070699_1001611571
Length 517
Sequence LQNEAAIASAGSITSAAQDAPHLRRVLGRMDLVLLFVVAVFNLNVVPSIAANGGVTVWLWIISLALFFWPQGIAVIELAHRYPGEGGVYLWAKEVFGDFHGFLSGWCYWTNNMMYVPTVMLYFVGVSVFALGSGHEGLADNKTFALTASLLLLVFLVVLNIVGLGVGKWINNLGAIGTGIAAAVLIGLGMVVWLRFGTTVTWADFRIPPNPRFVLNSFAVICFGLVGLELASIMGDEIENPQKTLPGAVAWGGVLSGALYIGATLTLLIAINKGDINVLQGIVQAVGHMAGRLGVGWIVAPFALMLSLSIAGIASAWLGGSARIPFVAGLDSYMPSWLGRVHPRYHTPYAALIVHAAVSMVLVVLNFSGWWIWNKLIGLSLVAYILRASGFVVANLMASPTGVQETFQKLLSLAVVLQLIPFLYMFGALLKIAFSDSFAKACYGKTKLILSGASGLITTILGIGLAFFPAQQVTSIFSYEVWMFGGTLFFIGLAAFFFFVYGRHKSARKLAEAVPLL

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
164 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100161157 3300005518 Bacteria 1985
2 JGI24034J26672_10002304 3300002239 Bacteria 2614
3 Ga0070658_10026272 3300005327 Bacteria 4670
4 Ga0070676_10015943 3300005328 Bacteria 4147
5 Ga0070676_10031597 3300005328 Bacteria 3027
6 Ga0070683_100001410 3300005329 Bacteria 18459
7 Ga0070683_100020363 3300005329 Bacteria 5904
8 Ga0070683_100119095 3300005329 Unclassified 2493
9 Ga0070690_100007305 3300005330 Bacteria 6327
10 Ga0070670_100002128 3300005331 Bacteria 16247
11 Ga0070670_100016498 3300005331 Bacteria 6341
12 Ga0068869_100010897 3300005334 Bacteria 5947
13 Ga0068869_100025905 3300005334 Bacteria 4077
14 Ga0068869_100031928 3300005334 Bacteria 3708
15 Ga0070666_10010602 3300005335 Bacteria 5766
16 Ga0070666_10018971 3300005335 Bacteria 4432
17 Ga0070666_10024702 3300005335 Bacteria 3917
18 Ga0070680_100054480 3300005336 Bacteria 3266
19 Ga0068868_100001052 3300005338 Bacteria 18872
20 Ga0068868_100004660 3300005338 Bacteria 9625
21 Ga0070687_100009776 3300005343 Bacteria 4120
22 Ga0070661_100015954 3300005344 Bacteria 5302
23 Ga0070661_100016008 3300005344 Bacteria 5293
24 Ga0070661_100022947 3300005344 Bacteria 4470
25 Ga0070668_100001619 3300005347 Bacteria 16277
26 Ga0070669_100050826 3300005353 Bacteria 3028
27 Ga0070669_100050854 3300005353 Bacteria 3028
28 Ga0070671_100024078 3300005355 Bacteria 4983
29 Ga0070674_100030624 3300005356 Bacteria 3558
30 Ga0070673_100163068 3300005364 Unclassified 1897
31 Ga0070688_100006942 3300005365 Bacteria 6083
32 Ga0070659_100007111 3300005366 Bacteria 8116
33 Ga0070659_100015344 3300005366 Bacteria 5737
34 Ga0070667_100053799 3300005367 Bacteria 3398
35 Ga0070703_10002370 3300005406 Bacteria 5437
36 Ga0070709_10003654 3300005434 Bacteria 8255
37 Ga0070709_10004050 3300005434 Bacteria 7906
38 Ga0070709_10026558 3300005434 Bacteria 3433
39 Ga0070709_10080158 3300005434 Bacteria 2128
40 Ga0070709_10080334 3300005434 Bacteria 2126
41 Ga0070714_100000054 3300005435 Bacteria 104948
42 Ga0070714_100020160 3300005435 Bacteria 5441
43 Ga0070714_100042455 3300005435 Bacteria 3842
44 Ga0070713_100000188 3300005436 Bacteria 40867
45 Ga0070713_100005655 3300005436 Bacteria 8576
46 Ga0070713_100025798 3300005436 Bacteria 4602
47 Ga0070713_100043608 3300005436 Bacteria 3668
48 Ga0070713_100154210 3300005436 Unclassified 2046
49 Ga0070710_10005758 3300005437 Bacteria 5904
50 Ga0070710_10012414 3300005437 Bacteria 4231
51 Ga0070710_10019149 3300005437 Bacteria 3534
52 Ga0070710_10070205 3300005437 Unclassified 2017
53 Ga0070711_100005021 3300005439 Bacteria 7867
54 Ga0070711_100011852 3300005439 Bacteria 5426
55 Ga0070705_100001727 3300005440 Bacteria 11368
56 Ga0070694_100031627 3300005444 Bacteria 3470
57 Ga0070708_100000258 3300005445 Bacteria 39526
58 Ga0070708_100000730 3300005445 Bacteria 24932
59 Ga0070708_100002282 3300005445 Bacteria 14838
60 Ga0070708_100003396 3300005445 Bacteria 12471
61 Ga0070708_100003476 3300005445 Bacteria 12334
62 Ga0070708_100087578 3300005445 Bacteria 2830
63 Ga0070708_100131230 3300005445 Bacteria 2319
64 Ga0070708_100257672 3300005445 Unclassified 1639
65 Ga0070662_100001311 3300005457 Bacteria 15290
66 Ga0070681_10161405 3300005458 Bacteria 2165
67 Ga0068867_100017340 3300005459 Bacteria 5114
68 Ga0068867_100018927 3300005459 Bacteria 4901
69 Ga0068867_100022678 3300005459 Bacteria 4490
70 Ga0068867_100102443 3300005459 Bacteria 2188
71 Ga0070706_100001995 3300005467 Bacteria 21055
72 Ga0070706_100002945 3300005467 Bacteria 16899
73 Ga0070706_100035823 3300005467 Bacteria 4582
74 Ga0070706_100114165 3300005467 Bacteria 2515
75 Ga0070707_100003955 3300005468 Bacteria 13953
76 Ga0070707_100022628 3300005468 Bacteria 5943
77 Ga0070707_100023194 3300005468 Bacteria 5870
78 Ga0070707_100039468 3300005468 Bacteria 4512
79 Ga0070707_100052786 3300005468 Bacteria 3897
80 Ga0070707_100059365 3300005468 Bacteria 3669
81 Ga0070698_100000148 3300005471 Bacteria 63449
82 Ga0070698_100002041 3300005471 Bacteria 22434
83 Ga0070698_100136062 3300005471 Bacteria 2411
84 Ga0070699_100001045 3300005518 Bacteria 25776
85 Ga0070699_100006769 3300005518 Bacteria 9971
86 Ga0070699_100031914 3300005518 Bacteria 4548
87 Ga0070699_100067098 3300005518 Bacteria 3115
88 Ga0070699_100116533 3300005518 Bacteria 2348
89 Ga0070684_100029051 3300005535 Bacteria 4682
90 Ga0070684_100040018 3300005535 Bacteria 4033
91 Ga0070684_100072169 3300005535 Bacteria 3039
92 Ga0070697_100000092 3300005536 Bacteria 75107
93 Ga0070697_100000570 3300005536 Bacteria 27832
94 Ga0070697_100000630 3300005536 Bacteria 26714
95 Ga0070697_100000921 3300005536 Bacteria 22143
96 Ga0070697_100062341 3300005536 Bacteria 3043
97 Ga0070697_100118734 3300005536 Bacteria 2210
98 Ga0070697_100221599 3300005536 Unclassified 1612
99 Ga0070686_100011250 3300005544 Bacteria 5070
100 Ga0070695_100035677 3300005545 Bacteria 3124
101 Ga0070696_100000413 3300005546 Bacteria 26661
102 Ga0070696_100121466 3300005546 Unclassified 1891
103 Ga0070696_100158675 3300005546 Bacteria 1665
104 Ga0070693_100000309 3300005547 Bacteria 22684
105 Ga0070693_100010569 3300005547 Bacteria 4628
106 Ga0070693_100028360 3300005547 Bacteria 3043
107 Ga0070665_100002088 3300005548 Bacteria 22395
108 Ga0070665_100009890 3300005548 Bacteria 9644
109 Ga0070704_100000191 3300005549 Bacteria 25096
110 Ga0070704_100042863 3300005549 Bacteria 3133
111 Ga0068855_100005150 3300005563 Bacteria 15945
112 Ga0068855_100055914 3300005563 Bacteria 4632
113 Ga0070664_100001802 3300005564 Bacteria 17165
114 Ga0070664_100017155 3300005564 Bacteria 5944
115 Ga0070664_100030028 3300005564 Bacteria 4533
116 Ga0068857_100068151 3300005577 Bacteria 3167
117 Ga0068857_100112114 3300005577 Bacteria 2452
118 Ga0068857_100182827 3300005577 Bacteria 1908
119 Ga0068854_100007433 3300005578 Bacteria 7000
120 Ga0068856_100000436 3300005614 Bacteria 45887
121 Ga0068856_100090018 3300005614 Bacteria 3052
122 Ga0070702_100019038 3300005615 Bacteria 3572
123 Ga0068852_100018688 3300005616 Bacteria 5464
124 Ga0068852_100026397 3300005616 Bacteria 4720
125 Ga0068852_100096151 3300005616 Unclassified 2661
126 Ga0068852_100132522 3300005616 Bacteria 2297
127 Ga0068859_100011960 3300005617 Bacteria 8717
128 Ga0068859_100035120 3300005617 Bacteria 5030
129 Ga0068859_100047598 3300005617 Bacteria 4309
130 Ga0068864_100006672 3300005618 Bacteria 9449
131 Ga0068864_100038468 3300005618 Bacteria 4085
132 Ga0068864_100051749 3300005618 Bacteria 3539
133 Ga0068866_10065874 3300005718 Unclassified 1896
134 Ga0068851_10010152 3300005834 Bacteria 4388
135 Ga0068870_10010366 3300005840 Bacteria 4280
136 Ga0068870_10029163 3300005840 Bacteria 2777
137 Ga0068863_100006247 3300005841 Bacteria 11704
138 Ga0068863_100034458 3300005841 Bacteria 4822
139 Ga0068858_100001669 3300005842 Bacteria 22692
140 Ga0068858_100005368 3300005842 Bacteria 12563
141 Ga0068858_100050011 3300005842 Bacteria 3869
142 Ga0068860_100027846 3300005843 Bacteria 5442
143 Ga0068860_100059154 3300005843 Bacteria 3644
144 Ga0068860_100135103 3300005843 Bacteria 2368
145 Ga0068862_100022178 3300005844 Bacteria 5313
146 Ga0081540_1030947 3300005983 Bacteria 2954
147 Ga0070717_10000472 3300006028 Bacteria 25636
148 Ga0070717_10001371 3300006028 Bacteria 16788
149 Ga0070717_10007398 3300006028 Bacteria 8152
150 Ga0070717_10014331 3300006028 Bacteria 6098
151 Ga0070717_10068647 3300006028 Bacteria 2951
152 Ga0070717_10267170 3300006028 Bacteria 1514
153 Ga0070715_10009345 3300006163 Bacteria 3454
154 Ga0070715_10012060 3300006163 Bacteria 3131
155 Ga0070715_10030848 3300006163 Bacteria 2171
156 Ga0070716_100000300 3300006173 Bacteria 19983
157 Ga0070716_100009732 3300006173 Bacteria 4799
158 Ga0070716_100013266 3300006173 Bacteria 4196
159 Ga0070716_100044114 3300006173 Bacteria 2497
160 Ga0070712_100006280 3300006175 Bacteria 7362
161 Ga0070712_100009078 3300006175 Bacteria 6260
162 Ga0070712_100009576 3300006175 Bacteria 6107
163 Ga0070712_100166673 3300006175 Bacteria 1706
164 Ga0097621_100000183 3300006237 Bacteria 39949
165 Ga0097621_100001802 3300006237 Bacteria 14707
166 Ga0097621_100004754 3300006237 Bacteria 9496
167 Ga0097621_100013368 3300006237 Bacteria 6118
168 Ga0097621_100101683 3300006237 Bacteria 2419
169 Ga0068871_100002972 3300006358 Bacteria 11632
170 Ga0068871_100007289 3300006358 Bacteria 7891
171 Ga0068871_100029002 3300006358 Bacteria 4344
172 Ga0075434_100046681 3300006871 Bacteria 4298
173 Ga0075436_100006574 3300006914 Bacteria 7961
174 Ga0075436_100007607 3300006914 Bacteria 7402
175 Ga0075436_100011669 3300006914 Bacteria 6029
176 Ga0075436_100014415 3300006914 Bacteria 5412
177 Ga0075436_100143371 3300006914 Unclassified 1680
178 Ga0097620_100011960 3300006931 Bacteria 8717
179 Ga0097620_100035120 3300006931 Bacteria 5030
180 Ga0097620_100047598 3300006931 Bacteria 4309
181 Ga0075435_100008964 3300007076 Bacteria 7213
182 Ga0075435_100011548 3300007076 Bacteria 6504
183 Ga0099794_10000669 3300007265 Bacteria 11473
184 Ga0099794_10009809 3300007265 Bacteria 4044
185 Ga0099794_10027161 3300007265 Bacteria 2651
186 Ga0099795_10021510 3300007788 Bacteria 2117
187 Ga0105251_10055370 3300009011 Bacteria 1881
188 Ga0105240_10022678 3300009093 Bacteria 8317
189 Ga0105240_10052964 3300009093 Bacteria 5098
190 Ga0105240_10055244 3300009093 Bacteria 4972
191 Ga0105240_10176428 3300009093 Unclassified 2526
192 Ga0105245_10005793 3300009098 Bacteria 10839
193 Ga0105245_10053219 3300009098 Bacteria 3633
194 Ga0105245_10077715 3300009098 Bacteria 3027
195 Ga0105247_10034392 3300009101 Bacteria 3086
196 Ga0105243_10069081 3300009148 Bacteria 2849
197 Ga0105241_10004694 3300009174 Bacteria 10088
198 Ga0105241_10014773 3300009174 Bacteria 5716
199 Ga0105241_10024601 3300009174 Bacteria 4472
200 Ga0105241_10026134 3300009174 Bacteria 4341
201 Ga0105242_10028250 3300009176 Bacteria 4464
202 Ga0105242_10032960 3300009176 Bacteria 4145
203 Ga0105242_10046508 3300009176 Bacteria 3521
204 Ga0105248_10010896 3300009177 Bacteria 10032
205 Ga0105248_10014251 3300009177 Bacteria 8751
206 Ga0105248_10026894 3300009177 Bacteria 6398
207 Ga0105248_10047499 3300009177 Bacteria 4814
208 Ga0105248_10056239 3300009177 Bacteria 4414
209 Ga0105248_10114221 3300009177 Bacteria 3046
210 Ga0105237_10034900 3300009545 Bacteria 5090
211 Ga0105237_10040485 3300009545 Bacteria 4699
212 Ga0105237_10050004 3300009545 Bacteria 4201
213 Ga0105237_10081906 3300009545 Bacteria 3218
214 Ga0105238_10007499 3300009551 Bacteria 10929
215 Ga0105238_10020954 3300009551 Bacteria 6660
216 Ga0105249_10013641 3300009553 Bacteria 7175
217 Ga0105239_10008576 3300010375 Bacteria 11598
218 Ga0105239_10047148 3300010375 Bacteria 4722
219 Ga0105246_10119211 3300011119 Bacteria 1952
220 Ga0157373_10006176 3300013100 Bacteria 8952
221 Ga0157373_10034470 3300013100 Bacteria 3635
222 Ga0157373_10102733 3300013100 Bacteria 2011
223 Ga0157371_10003936 3300013102 Bacteria 13191
224 Ga0157371_10013553 3300013102 Bacteria 6190
225 Ga0157371_10042869 3300013102 Unclassified 3225
226 Ga0157371_10158772 3300013102 Bacteria 1615
227 Ga0157369_10028452 3300013105 Bacteria 6185
228 Ga0157369_10044245 3300013105 Unclassified 4847
229 Ga0157369_10154202 3300013105 Bacteria 2427
230 Ga0157369_10163164 3300013105 Bacteria 2351
231 Ga0157374_10000187 3300013296 Bacteria 57781
232 Ga0157374_10007069 3300013296 Bacteria 9557
233 Ga0157374_10017621 3300013296 Bacteria 6292
234 Ga0157374_10024896 3300013296 Bacteria 5369
235 Ga0157374_10028852 3300013296 Bacteria 5017
236 Ga0157378_10000161 3300013297 Bacteria 63839
237 Ga0157378_10000181 3300013297 Bacteria 60266
238 Ga0157378_10000353 3300013297 Bacteria 45114
239 Ga0157378_10000739 3300013297 Bacteria 30524
240 Ga0157378_10005841 3300013297 Bacteria 10788
241 Ga0157378_10107199 3300013297 Bacteria 2557
242 Ga0157378_10130450 3300013297 Bacteria 2326
243 Ga0163162_10002288 3300013306 Bacteria 17976
244 Ga0163162_10008859 3300013306 Bacteria 9781
245 Ga0163162_10099282 3300013306 Bacteria 3002
246 Ga0157372_10001859 3300013307 Bacteria 22893
247 Ga0157372_10005390 3300013307 Bacteria 13600
248 Ga0157372_10006207 3300013307 Bacteria 12699
249 Ga0157372_10008201 3300013307 Bacteria 11101
250 Ga0157372_10013942 3300013307 Bacteria 8588
251 Ga0157372_10066198 3300013307 Bacteria 4059
252 Ga0157375_10098527 3300013308 Bacteria 3000
253 Ga0163163_10001664 3300014325 Bacteria 18732
254 Ga0163163_10012039 3300014325 Bacteria 7871
255 Ga0163163_10046496 3300014325 Bacteria 4263
256 Ga0163163_10060798 3300014325 Bacteria 3742
257 Ga0163163_10106682 3300014325 Bacteria 2827
258 Ga0157380_10096094 3300014326 Bacteria 2456
259 Ga0157377_10001157 3300014745 Bacteria 11181
260 Ga0157379_10001683 3300014968 Bacteria 18273
261 Ga0157379_10006009 3300014968 Bacteria 10465
262 Ga0157379_10023305 3300014968 Bacteria 5492
263 Ga0157379_10031396 3300014968 Bacteria 4732
264 Ga0157379_10167571 3300014968 Bacteria 1983
265 Ga0157376_10000008 3300014969 Bacteria 351192
266 Ga0157376_10000852 3300014969 Bacteria 20014
267 Ga0157376_10003365 3300014969 Bacteria 11002
268 Ga0157376_10036361 3300014969 Bacteria 3989
269 Ga0157376_10049130 3300014969 Bacteria 3493
270 Ga0213874_10018106 3300021377 Unclassified 1900
271 Ga0213876_10036462 3300021384 Unclassified 2593
272 Ga0228598_1001070 3300024227 Bacteria 6022
273 Ga0228598_1001796 3300024227 Bacteria 4678
274 Ga0207697_10031844 3300025315 Bacteria 2158
275 Ga0207656_10007524 3300025321 Bacteria 3971
276 Ga0207653_10004906 3300025885 Bacteria 4180
277 Ga0207692_10005292 3300025898 Bacteria 5159
278 Ga0207642_10006892 3300025899 Bacteria 3804
279 Ga0207680_10023226 3300025903 Bacteria 3383
280 Ga0207680_10054926 3300025903 Bacteria 2398
281 Ga0207647_10007769 3300025904 Bacteria 7719
282 Ga0207647_10008969 3300025904 Bacteria 7124
283 Ga0207647_10012828 3300025904 Bacteria 5822
284 Ga0207685_10006871 3300025905 Bacteria 3131
285 Ga0207685_10023098 3300025905 Bacteria 2112
286 Ga0207699_10007982 3300025906 Unclassified 5198
287 Ga0207699_10008109 3300025906 Bacteria 5167
288 Ga0207699_10008908 3300025906 Bacteria 4974
289 Ga0207699_10033284 3300025906 Bacteria 2912
290 Ga0207645_10000330 3300025907 Bacteria 39597
291 Ga0207645_10010617 3300025907 Bacteria 6318
292 Ga0207643_10000975 3300025908 Bacteria 17195
293 Ga0207643_10035523 3300025908 Bacteria 2795
294 Ga0207684_10000447 3300025910 Bacteria 54429
295 Ga0207684_10002057 3300025910 Bacteria 20692
296 Ga0207684_10002811 3300025910 Bacteria 17297
297 Ga0207684_10082853 3300025910 Bacteria 2732
298 Ga0207654_10014519 3300025911 Bacteria 4070
299 Ga0207654_10018553 3300025911 Bacteria 3653
300 Ga0207654_10023554 3300025911 Bacteria 3299
301 Ga0207654_10034960 3300025911 Bacteria 2796
302 Ga0207695_10035323 3300025913 Bacteria 5423
303 Ga0207695_10046682 3300025913 Bacteria 4589
304 Ga0207695_10070215 3300025913 Unclassified 3582
305 Ga0207695_10127400 3300025913 Unclassified 2506
306 Ga0207671_10022269 3300025914 Bacteria 4792
307 Ga0207671_10022952 3300025914 Bacteria 4711
308 Ga0207671_10045342 3300025914 Bacteria 3251
309 Ga0207693_10001184 3300025915 Bacteria 23296
310 Ga0207693_10003013 3300025915 Bacteria 14570
311 Ga0207693_10007281 3300025915 Bacteria 9106
312 Ga0207693_10016219 3300025915 Bacteria 5957
313 Ga0207663_10003294 3300025916 Bacteria 7871
314 Ga0207663_10033563 3300025916 Bacteria 3059
315 Ga0207663_10039944 3300025916 Bacteria 2847
316 Ga0207663_10054423 3300025916 Bacteria 2506
317 Ga0207662_10007683 3300025918 Bacteria 5874
318 Ga0207657_10000458 3300025919 Bacteria 43216
319 Ga0207657_10002016 3300025919 Bacteria 21946
320 Ga0207657_10002563 3300025919 Bacteria 19662
321 Ga0207649_10002595 3300025920 Bacteria 10036
322 Ga0207649_10053224 3300025920 Bacteria 2515
323 Ga0207652_10005526 3300025921 Bacteria 10247
324 Ga0207646_10000676 3300025922 Bacteria 44173
325 Ga0207646_10001577 3300025922 Bacteria 27856
326 Ga0207646_10005589 3300025922 Bacteria 13200
327 Ga0207646_10071315 3300025922 Bacteria 3103
328 Ga0207646_10079657 3300025922 Bacteria 2929
329 Ga0207646_10092553 3300025922 Bacteria 2706
330 Ga0207681_10039151 3300025923 Bacteria 3145
331 Ga0207650_10000058 3300025925 Bacteria 153056
332 Ga0207650_10009443 3300025925 Bacteria 6666
333 Ga0207659_10014384 3300025926 Bacteria 5102
334 Ga0207687_10025104 3300025927 Bacteria 3987
335 Ga0207687_10025467 3300025927 Bacteria 3958
336 Ga0207700_10004881 3300025928 Bacteria 7966
337 Ga0207700_10037500 3300025928 Bacteria 3511
338 Ga0207700_10058095 3300025928 Bacteria 2921
339 Ga0207700_10072857 3300025928 Bacteria 2650
340 Ga0207700_10145613 3300025928 Bacteria 1952
341 Ga0207664_10000954 3300025929 Bacteria 19503
342 Ga0207664_10004842 3300025929 Bacteria 9154
343 Ga0207664_10012565 3300025929 Bacteria 6058
344 Ga0207644_10013643 3300025931 Bacteria 5422
345 Ga0207706_10000245 3300025933 Bacteria 59509
346 Ga0207706_10000676 3300025933 Bacteria 35793
347 Ga0207706_10016843 3300025933 Bacteria 6596
348 Ga0207706_10192365 3300025933 Bacteria 1790
349 Ga0207686_10012288 3300025934 Bacteria 4705
350 Ga0207709_10015686 3300025935 Bacteria 4204
351 Ga0207670_10007488 3300025936 Bacteria 6095
352 Ga0207669_10033410 3300025937 Bacteria 2903
353 Ga0207665_10000049 3300025939 Bacteria 76350
354 Ga0207665_10000080 3300025939 Bacteria 62639
355 Ga0207665_10005337 3300025939 Bacteria 8587
356 Ga0207665_10021778 3300025939 Bacteria 4216
357 Ga0207665_10056305 3300025939 Bacteria 2654
358 Ga0207691_10031536 3300025940 Bacteria 4946
359 Ga0207711_10018376 3300025941 Bacteria 5812
360 Ga0207711_10021120 3300025941 Bacteria 5438
361 Ga0207689_10000734 3300025942 Bacteria 31550
362 Ga0207689_10004057 3300025942 Bacteria 13302
363 Ga0207689_10010914 3300025942 Bacteria 7810
364 Ga0207689_10027907 3300025942 Bacteria 4722
365 Ga0207661_10000551 3300025944 Bacteria 23963
366 Ga0207661_10222751 3300025944 Bacteria 1668
367 Ga0207679_10000170 3300025945 Bacteria 53584
368 Ga0207679_10053668 3300025945 Bacteria 2963
369 Ga0207667_10000694 3300025949 Bacteria 43647
370 Ga0207667_10022433 3300025949 Bacteria 6974
371 Ga0207667_10088311 3300025949 Bacteria 3207
372 Ga0207651_10017392 3300025960 Bacteria 4248
373 Ga0207712_10076207 3300025961 Bacteria 2427
374 Ga0207668_10056982 3300025972 Bacteria 2724
375 Ga0207640_10001398 3300025981 Bacteria 13020
376 Ga0207640_10037304 3300025981 Bacteria 3057
377 Ga0207640_10044511 3300025981 Bacteria 2845
378 Ga0207677_10001639 3300026023 Bacteria 11858
379 Ga0207677_10002373 3300026023 Bacteria 9859
380 Ga0207677_10010595 3300026023 Bacteria 5222
381 Ga0207677_10052811 3300026023 Bacteria 2763
382 Ga0207703_10003415 3300026035 Bacteria 13332
383 Ga0207703_10213856 3300026035 Bacteria 1720
384 Ga0207639_10039043 3300026041 Unclassified 3535
385 Ga0207639_10141830 3300026041 Bacteria 2003
386 Ga0207678_10000666 3300026067 Bacteria 31531
387 Ga0207678_10005878 3300026067 Bacteria 10936
388 Ga0207708_10077133 3300026075 Bacteria 2557
389 Ga0207702_10000657 3300026078 Bacteria 37655
390 Ga0207702_10009897 3300026078 Bacteria 7993
391 Ga0207702_10013784 3300026078 Bacteria 6714
392 Ga0207641_10000323 3300026088 Bacteria 58693
393 Ga0207641_10008200 3300026088 Bacteria 8635
394 Ga0207641_10020160 3300026088 Bacteria 5474
395 Ga0207648_10001360 3300026089 Bacteria 27048
396 Ga0207648_10012134 3300026089 Bacteria 8079
397 Ga0207648_10019307 3300026089 Bacteria 6152
398 Ga0207648_10022125 3300026089 Bacteria 5711
399 Ga0207676_10000163 3300026095 Bacteria 58243
400 Ga0207676_10004714 3300026095 Bacteria 9662
401 Ga0207674_10000164 3300026116 Bacteria 79381
402 Ga0207674_10000905 3300026116 Bacteria 38684
403 Ga0207674_10058520 3300026116 Bacteria 3903
404 Ga0207675_100032027 3300026118 Bacteria 4898
405 Ga0207683_10006145 3300026121 Bacteria 10290
406 Ga0207698_10052865 3300026142 Bacteria 3114
407 Ga0209179_1009170 3300027512 Unclassified 1688
408 Ga0209588_1001776 3300027671 Bacteria 5724
409 Ga0209588_1002774 3300027671 Bacteria 4794
410 Ga0265354_1002457 3300028016 Bacteria 2287
411 Ga0265357_1000346 3300028023 Bacteria 2530
412 Ga0268266_10000227 3300028379 Bacteria 97786
413 Ga0268266_10046087 3300028379 Bacteria 3732
414 Ga0268265_10021199 3300028380 Bacteria 4548
415 Ga0268265_10031505 3300028380 Bacteria 3829
416 Ga0268264_10029558 3300028381 Bacteria 4489
417 Ga0268264_10030611 3300028381 Bacteria 4411
418 Ga0268264_10042130 3300028381 Bacteria 3779
419 Ga0268264_10125159 3300028381 Bacteria 2271
420 Ga0265338_10004188 3300028800 Bacteria 19676
421 Ga0265338_10035922 3300028800 Bacteria 4752
422 Ga0265338_10069365 3300028800 Bacteria 3029
423 Ga0265762_1000325 3300030760 Bacteria 8066
424 Ga0265770_1000601 3300030878 Bacteria 4986
425 Ga0265770_1002307 3300030878 Bacteria 2593
426 Ga0265765_1000384 3300030879 Bacteria 3369
427 Ga0265760_10000141 3300031090 Bacteria 18302
428 Ga0265760_10003719 3300031090 Bacteria 4414
429 Ga0265316_10004327 3300031344 Bacteria 14159
430 Ga0265316_10042197 3300031344 Bacteria 3647
431 Ga0265314_10032002 3300031711 Bacteria 3875
432 Ga0316212_1000580 3300033547 Bacteria 4555
433 Ga0373936_0008709 3300035113 Bacteria 3820
434 Ga0373945_0000496 3300035116 Bacteria 11179
435 Ga0373953_0035093 3300035117 Bacteria 1969
436 Ga0373954_0036245 3300035118 Bacteria 2289
437 Ga0373956_0005475 3300035119 Bacteria 5084
438 Ga0373957_0005562 3300035120 Bacteria 3911
439 Ga0373943_0000045 3300035170 Bacteria 42005
440 Ga0373943_0004997 3300035170 Bacteria 5985
441 Ga0373946_0002383 3300035171 Bacteria 6649
442 Ga0373946_0003252 3300035171 Bacteria 5771
443 Ga0373931_0016020 3300035691 Bacteria 3685
444 Ga0373935_0018520 3300035692 Bacteria 4236
445 Ga0373927_0000094 3300035695 Bacteria 66764
446 Ga0373927_0002440 3300035695 Bacteria 13559
447 Ga0373927_0018433 3300035695 Bacteria 4588
448 Ga0373933_0028200 3300035724 Bacteria 3237
449 Ga0373947_0006702 3300035725 Bacteria 6683
450 Ga0373937_0000555 3300036401 Bacteria 33153
451 Ga0373937_0064562 3300036401 Bacteria 3368
452 Ga0373937_0255139 3300036401 Unclassified 1653
453 Ga0373925_0000297 3300037068 Bacteria 52136
454 Ga0373925_0003730 3300037068 Bacteria 11699
455 Ga0373925_0007729 3300037068 Bacteria 7829
456 Ga0373925_0024183 3300037068 Bacteria 4434
457 Ga0436364_0831126 3300037853 Bacteria 1725
458 Ga0436365_0942396 3300039437 Bacteria 6505
459 Ga0436363_0665316 3300039450 Bacteria 4015
460 Ga0495629_0015435 3300046459 Bacteria 5485
461 Ga0495653_0125873 3300046463 Unclassified 1820
462 Ga0495580_0000037 3300046472 Bacteria 71995
463 Ga0495580_0008672 3300046472 Bacteria 8060
464 Ga0495580_0008800 3300046472 Bacteria 7992
465 Ga0495580_0011396 3300046472 Bacteria 6880
466 Ga0495580_0014399 3300046472 Bacteria 5999
467 Ga0495580_0066309 3300046472 Bacteria 2527
468 Ga0495639_0002138 3300046475 Bacteria 8715
469 Ga0495662_0037673 3300046476 Bacteria 2336
470 Ga0495664_0026856 3300046477 Bacteria 3355
471 Ga0495594_0015281 3300046499 Unclassified 4030
472 Ga0495628_0004325 3300046516 Bacteria 12607
473 Ga0495630_0017481 3300046517 Bacteria 5254
474 Ga0495640_0002276 3300046533 Bacteria 15394
475 Ga0495586_0010064 3300046535 Bacteria 5034
476 Ga0495587_0002499 3300046536 Bacteria 12276
477 Ga0495647_0002553 3300046681 Bacteria 5769
478 Ga0495669_0048049 3300046684 Unclassified 1908
479 Ga0495613_0056299 3300046689 Bacteria 2887
480 Ga0495581_0046568 3300047315 Bacteria 2506
481 Ga0495674_0016465 3300047319 Bacteria 6896
482 Ga0495676_0047424 3300047321 Bacteria 3474
483 Ga0495675_0003992 3300047444 Bacteria 8941
484 Ga0495684_0047632 3300047471 Bacteria 3278
485 Ga0495602_0001204 3300048088 Bacteria 25464
486 Ga0495602_0150745 3300048088 Bacteria 1828
487 Ga0496100_0008437 3300048903 Bacteria 5747
488 Ga0496100_0042229 3300048903 Bacteria 2912
489 Ga0496101_0062585 3300048904 Bacteria 2706
490 Ga0496102_0004513 3300048905 Bacteria 11761
491 Ga0496102_0019020 3300048905 Bacteria 6044
492 Ga0496102_0041183 3300048905 Unclassified 4182
493 Ga0496102_0100259 3300048905 Unclassified 2689
494 Ga0496103_0008179 3300048906 Bacteria 6208
495 Ga0496103_0008280 3300048906 Bacteria 6175
496 Ga0496104_0172237 3300048907 Bacteria 2075
497 Ga0496106_0154965 3300048909 Bacteria 1809
498 Ga0496107_0043185 3300048910 Bacteria 3239
499 Ga0496107_0062791 3300048910 Unclassified 2691
500 Ga0496108_0010617 3300048911 Bacteria 7471
501 Ga0496109_0000169 3300048912 Bacteria 64301
502 Ga0496110_0001005 3300048913 Bacteria 19871
503 Ga0496110_0053160 3300048913 Bacteria 3560
504 Ga0496110_0204277 3300048913 Unclassified 1795
505 Ga0496111_0022660 3300048914 Bacteria 4399
506 Ga0496112_0000060 3300048915 Bacteria 74795
507 Ga0496112_0015045 3300048915 Bacteria 7203
508 Ga0496112_0040983 3300048915 Bacteria 4530
509 Ga0496112_0068355 3300048915 Bacteria 3508
510 Ga0496112_0083892 3300048915 Bacteria 3152
511 Ga0496112_0095150 3300048915 Bacteria 2949
512 Ga0496112_0220833 3300048915 Bacteria 1851
513 Ga0496113_0000553 3300048916 Bacteria 18549
514 Ga0496115_0003103 3300048918 Bacteria 11938
515 Ga0496115_0004025 3300048918 Bacteria 10613
516 Ga0501083_0064688 3300049744 Bacteria 2437
517 nmdc:mga0rr50_55056_c1 3300050513 Bacteria 2966
518 nmdc:mga08x19_12310_c1 3300050514 Bacteria 5151
519 nmdc:mga08x19_21384_c1 3300050514 Bacteria 3993
520 nmdc:mga08x19_242_c1 3300050514 Bacteria 41716
521 nmdc:mga08x19_4630_c1 3300050514 Bacteria 8163
522 nmdc:mga08x19_6770_c1 3300050514 Bacteria 6806
523 Ga0495619_0118663 3300053085 Bacteria 1813
524 Ga0495619_0129158 3300053085 Bacteria 1736
525 Ga0070699_100161157
526 JGI24034J26672_10002304
527 Ga0070658_10026272
528 Ga0070676_10015943
529 Ga0070676_10031597
530 Ga0070683_100001410
531 Ga0070683_100020363
532 Ga0070683_100119095
533 Ga0070690_100007305
534 Ga0070670_100002128
535 Ga0070670_100016498
536 Ga0068869_100010897
537 Ga0068869_100025905
538 Ga0068869_100031928
539 Ga0070666_10010602
540 Ga0070666_10018971
541 Ga0070666_10024702
542 Ga0070680_100054480
543 Ga0068868_100001052
544 Ga0068868_100004660
545 Ga0070687_100009776
546 Ga0070661_100015954
547 Ga0070661_100016008
548 Ga0070661_100022947
549 Ga0070668_100001619
550 Ga0070669_100050826
551 Ga0070669_100050854
552 Ga0070671_100024078
553 Ga0070674_100030624
554 Ga0070673_100163068
555 Ga0070688_100006942
556 Ga0070659_100007111
557 Ga0070659_100015344
558 Ga0070667_100053799
559 Ga0070703_10002370
560 Ga0070709_10003654
561 Ga0070709_10004050
562 Ga0070709_10026558
563 Ga0070709_10080158
564 Ga0070709_10080334
565 Ga0070714_100000054
566 Ga0070714_100020160
567 Ga0070714_100042455
568 Ga0070713_100000188
569 Ga0070713_100005655
570 Ga0070713_100025798
571 Ga0070713_100043608
572 Ga0070713_100154210
573 Ga0070710_10005758
574 Ga0070710_10012414
575 Ga0070710_10019149
576 Ga0070710_10070205
577 Ga0070711_100005021
578 Ga0070711_100011852
579 Ga0070705_100001727
580 Ga0070694_100031627
581 Ga0070708_100000258
582 Ga0070708_100000730
583 Ga0070708_100002282
584 Ga0070708_100003396
585 Ga0070708_100003476
586 Ga0070708_100087578
587 Ga0070708_100131230
588 Ga0070708_100257672
589 Ga0070662_100001311
590 Ga0070681_10161405
591 Ga0068867_100017340
592 Ga0068867_100018927
593 Ga0068867_100022678
594 Ga0068867_100102443
595 Ga0070706_100001995
596 Ga0070706_100002945
597 Ga0070706_100035823
598 Ga0070706_100114165
599 Ga0070707_100003955
600 Ga0070707_100022628
601 Ga0070707_100023194
602 Ga0070707_100039468
603 Ga0070707_100052786
604 Ga0070707_100059365
605 Ga0070698_100000148
606 Ga0070698_100002041
607 Ga0070698_100136062
608 Ga0070699_100001045
609 Ga0070699_100006769
610 Ga0070699_100031914
611 Ga0070699_100067098
612 Ga0070699_100116533
613 Ga0070684_100029051
614 Ga0070684_100040018
615 Ga0070684_100072169
616 Ga0070697_100000092
617 Ga0070697_100000570
618 Ga0070697_100000630
619 Ga0070697_100000921
620 Ga0070697_100062341
621 Ga0070697_100118734
622 Ga0070697_100221599
623 Ga0070686_100011250
624 Ga0070695_100035677
625 Ga0070696_100000413
626 Ga0070696_100121466
627 Ga0070696_100158675
628 Ga0070693_100000309
629 Ga0070693_100010569
630 Ga0070693_100028360
631 Ga0070665_100002088
632 Ga0070665_100009890
633 Ga0070704_100000191
634 Ga0070704_100042863
635 Ga0068855_100005150
636 Ga0068855_100055914
637 Ga0070664_100001802
638 Ga0070664_100017155
639 Ga0070664_100030028
640 Ga0068857_100068151
641 Ga0068857_100112114
642 Ga0068857_100182827
643 Ga0068854_100007433
644 Ga0068856_100000436
645 Ga0068856_100090018
646 Ga0070702_100019038
647 Ga0068852_100018688
648 Ga0068852_100026397
649 Ga0068852_100096151
650 Ga0068852_100132522
651 Ga0068859_100011960
652 Ga0068859_100035120
653 Ga0068859_100047598
654 Ga0068864_100006672
655 Ga0068864_100038468
656 Ga0068864_100051749
657 Ga0068866_10065874
658 Ga0068851_10010152
659 Ga0068870_10010366
660 Ga0068870_10029163
661 Ga0068863_100006247
662 Ga0068863_100034458
663 Ga0068858_100001669
664 Ga0068858_100005368
665 Ga0068858_100050011
666 Ga0068860_100027846
667 Ga0068860_100059154
668 Ga0068860_100135103
669 Ga0068862_100022178
670 Ga0081540_1030947
671 Ga0070717_10000472
672 Ga0070717_10001371
673 Ga0070717_10007398
674 Ga0070717_10014331
675 Ga0070717_10068647
676 Ga0070717_10267170
677 Ga0070715_10009345
678 Ga0070715_10012060
679 Ga0070715_10030848
680 Ga0070716_100000300
681 Ga0070716_100009732
682 Ga0070716_100013266
683 Ga0070716_100044114
684 Ga0070712_100006280
685 Ga0070712_100009078
686 Ga0070712_100009576
687 Ga0070712_100166673
688 Ga0097621_100000183
689 Ga0097621_100001802
690 Ga0097621_100004754
691 Ga0097621_100013368
692 Ga0097621_100101683
693 Ga0068871_100002972
694 Ga0068871_100007289
695 Ga0068871_100029002
696 Ga0075434_100046681
697 Ga0075436_100006574
698 Ga0075436_100007607
699 Ga0075436_100011669
700 Ga0075436_100014415
701 Ga0075436_100143371
702 Ga0097620_100011960
703 Ga0097620_100035120
704 Ga0097620_100047598
705 Ga0075435_100008964
706 Ga0075435_100011548
707 Ga0099794_10000669
708 Ga0099794_10009809
709 Ga0099794_10027161
710 Ga0099795_10021510
711 Ga0105251_10055370
712 Ga0105240_10022678
713 Ga0105240_10052964
714 Ga0105240_10055244
715 Ga0105240_10176428
716 Ga0105245_10005793
717 Ga0105245_10053219
718 Ga0105245_10077715
719 Ga0105247_10034392
720 Ga0105243_10069081
721 Ga0105241_10004694
722 Ga0105241_10014773
723 Ga0105241_10024601
724 Ga0105241_10026134
725 Ga0105242_10028250
726 Ga0105242_10032960
727 Ga0105242_10046508
728 Ga0105248_10010896
729 Ga0105248_10014251
730 Ga0105248_10026894
731 Ga0105248_10047499
732 Ga0105248_10056239
733 Ga0105248_10114221
734 Ga0105237_10034900
735 Ga0105237_10040485
736 Ga0105237_10050004
737 Ga0105237_10081906
738 Ga0105238_10007499
739 Ga0105238_10020954
740 Ga0105249_10013641
741 Ga0105239_10008576
742 Ga0105239_10047148
743 Ga0105246_10119211
744 Ga0157373_10006176
745 Ga0157373_10034470
746 Ga0157373_10102733
747 Ga0157371_10003936
748 Ga0157371_10013553
749 Ga0157371_10042869
750 Ga0157371_10158772
751 Ga0157369_10028452
752 Ga0157369_10044245
753 Ga0157369_10154202
754 Ga0157369_10163164
755 Ga0157374_10000187
756 Ga0157374_10007069
757 Ga0157374_10017621
758 Ga0157374_10024896
759 Ga0157374_10028852
760 Ga0157378_10000161
761 Ga0157378_10000181
762 Ga0157378_10000353
763 Ga0157378_10000739
764 Ga0157378_10005841
765 Ga0157378_10107199
766 Ga0157378_10130450
767 Ga0163162_10002288
768 Ga0163162_10008859
769 Ga0163162_10099282
770 Ga0157372_10001859
771 Ga0157372_10005390
772 Ga0157372_10006207
773 Ga0157372_10008201
774 Ga0157372_10013942
775 Ga0157372_10066198
776 Ga0157375_10098527
777 Ga0163163_10001664
778 Ga0163163_10012039
779 Ga0163163_10046496
780 Ga0163163_10060798
781 Ga0163163_10106682
782 Ga0157380_10096094
783 Ga0157377_10001157
784 Ga0157379_10001683
785 Ga0157379_10006009
786 Ga0157379_10023305
787 Ga0157379_10031396
788 Ga0157379_10167571
789 Ga0157376_10000008
790 Ga0157376_10000852
791 Ga0157376_10003365
792 Ga0157376_10036361
793 Ga0157376_10049130
794 Ga0213874_10018106
795 Ga0213876_10036462
796 Ga0228598_1001070
797 Ga0228598_1001796
798 Ga0207697_10031844
799 Ga0207656_10007524
800 Ga0207653_10004906
801 Ga0207692_10005292
802 Ga0207642_10006892
803 Ga0207680_10023226
804 Ga0207680_10054926
805 Ga0207647_10007769
806 Ga0207647_10008969
807 Ga0207647_10012828
808 Ga0207685_10006871
809 Ga0207685_10023098
810 Ga0207699_10007982
811 Ga0207699_10008109
812 Ga0207699_10008908
813 Ga0207699_10033284
814 Ga0207645_10000330
815 Ga0207645_10010617
816 Ga0207643_10000975
817 Ga0207643_10035523
818 Ga0207684_10000447
819 Ga0207684_10002057
820 Ga0207684_10002811
821 Ga0207684_10082853
822 Ga0207654_10014519
823 Ga0207654_10018553
824 Ga0207654_10023554
825 Ga0207654_10034960
826 Ga0207695_10035323
827 Ga0207695_10046682
828 Ga0207695_10070215
829 Ga0207695_10127400
830 Ga0207671_10022269
831 Ga0207671_10022952
832 Ga0207671_10045342
833 Ga0207693_10001184
834 Ga0207693_10003013
835 Ga0207693_10007281
836 Ga0207693_10016219
837 Ga0207663_10003294
838 Ga0207663_10033563
839 Ga0207663_10039944
840 Ga0207663_10054423
841 Ga0207662_10007683
842 Ga0207657_10000458
843 Ga0207657_10002016
844 Ga0207657_10002563
845 Ga0207649_10002595
846 Ga0207649_10053224
847 Ga0207652_10005526
848 Ga0207646_10000676
849 Ga0207646_10001577
850 Ga0207646_10005589
851 Ga0207646_10071315
852 Ga0207646_10079657
853 Ga0207646_10092553
854 Ga0207681_10039151
855 Ga0207650_10000058
856 Ga0207650_10009443
857 Ga0207659_10014384
858 Ga0207687_10025104
859 Ga0207687_10025467
860 Ga0207700_10004881
861 Ga0207700_10037500
862 Ga0207700_10058095
863 Ga0207700_10072857
864 Ga0207700_10145613
865 Ga0207664_10000954
866 Ga0207664_10004842
867 Ga0207664_10012565
868 Ga0207644_10013643
869 Ga0207706_10000245
870 Ga0207706_10000676
871 Ga0207706_10016843
872 Ga0207706_10192365
873 Ga0207686_10012288
874 Ga0207709_10015686
875 Ga0207670_10007488
876 Ga0207669_10033410
877 Ga0207665_10000049
878 Ga0207665_10000080
879 Ga0207665_10005337
880 Ga0207665_10021778
881 Ga0207665_10056305
882 Ga0207691_10031536
883 Ga0207711_10018376
884 Ga0207711_10021120
885 Ga0207689_10000734
886 Ga0207689_10004057
887 Ga0207689_10010914
888 Ga0207689_10027907
889 Ga0207661_10000551
890 Ga0207661_10222751
891 Ga0207679_10000170
892 Ga0207679_10053668
893 Ga0207667_10000694
894 Ga0207667_10022433
895 Ga0207667_10088311
896 Ga0207651_10017392
897 Ga0207712_10076207
898 Ga0207668_10056982
899 Ga0207640_10001398
900 Ga0207640_10037304
901 Ga0207640_10044511
902 Ga0207677_10001639
903 Ga0207677_10002373
904 Ga0207677_10010595
905 Ga0207677_10052811
906 Ga0207703_10003415
907 Ga0207703_10213856
908 Ga0207639_10039043
909 Ga0207639_10141830
910 Ga0207678_10000666
911 Ga0207678_10005878
912 Ga0207708_10077133
913 Ga0207702_10000657
914 Ga0207702_10009897
915 Ga0207702_10013784
916 Ga0207641_10000323
917 Ga0207641_10008200
918 Ga0207641_10020160
919 Ga0207648_10001360
920 Ga0207648_10012134
921 Ga0207648_10019307
922 Ga0207648_10022125
923 Ga0207676_10000163
924 Ga0207676_10004714
925 Ga0207674_10000164
926 Ga0207674_10000905
927 Ga0207674_10058520
928 Ga0207675_100032027
929 Ga0207683_10006145
930 Ga0207698_10052865
931 Ga0209179_1009170
932 Ga0209588_1001776
933 Ga0209588_1002774
934 Ga0265354_1002457
935 Ga0265357_1000346
936 Ga0268266_10000227
937 Ga0268266_10046087
938 Ga0268265_10021199
939 Ga0268265_10031505
940 Ga0268264_10029558
941 Ga0268264_10030611
942 Ga0268264_10042130
943 Ga0268264_10125159
944 Ga0265338_10004188
945 Ga0265338_10035922
946 Ga0265338_10069365
947 Ga0265762_1000325
948 Ga0265770_1000601
949 Ga0265770_1002307
950 Ga0265765_1000384
951 Ga0265760_10000141
952 Ga0265760_10003719
953 Ga0265316_10004327
954 Ga0265316_10042197
955 Ga0265314_10032002
956 Ga0316212_1000580
957 Ga0373936_0008709
958 Ga0373945_0000496
959 Ga0373953_0035093
960 Ga0373954_0036245
961 Ga0373956_0005475
962 Ga0373957_0005562
963 Ga0373943_0000045
964 Ga0373943_0004997
965 Ga0373946_0002383
966 Ga0373946_0003252
967 Ga0373931_0016020
968 Ga0373935_0018520
969 Ga0373927_0000094
970 Ga0373927_0002440
971 Ga0373927_0018433
972 Ga0373933_0028200
973 Ga0373947_0006702
974 Ga0373937_0000555
975 Ga0373937_0064562
976 Ga0373937_0255139
977 Ga0373925_0000297
978 Ga0373925_0003730
979 Ga0373925_0007729
980 Ga0373925_0024183
981 Ga0436364_0831126
982 Ga0436365_0942396
983 Ga0436363_0665316
984 Ga0495629_0015435
985 Ga0495653_0125873
986 Ga0495580_0000037
987 Ga0495580_0008672
988 Ga0495580_0008800
989 Ga0495580_0011396
990 Ga0495580_0014399
991 Ga0495580_0066309
992 Ga0495639_0002138
993 Ga0495662_0037673
994 Ga0495664_0026856
995 Ga0495594_0015281
996 Ga0495628_0004325
997 Ga0495630_0017481
998 Ga0495640_0002276
999 Ga0495586_0010064
1000 Ga0495587_0002499
1001 Ga0495647_0002553
1002 Ga0495669_0048049
1003 Ga0495613_0056299
1004 Ga0495581_0046568
1005 Ga0495674_0016465
1006 Ga0495676_0047424
1007 Ga0495675_0003992
1008 Ga0495684_0047632
1009 Ga0495602_0001204
1010 Ga0495602_0150745
1011 Ga0496100_0008437
1012 Ga0496100_0042229
1013 Ga0496101_0062585
1014 Ga0496102_0004513
1015 Ga0496102_0019020
1016 Ga0496102_0041183
1017 Ga0496102_0100259
1018 Ga0496103_0008179
1019 Ga0496103_0008280
1020 Ga0496104_0172237
1021 Ga0496106_0154965
1022 Ga0496107_0043185
1023 Ga0496107_0062791
1024 Ga0496108_0010617
1025 Ga0496109_0000169
1026 Ga0496110_0001005
1027 Ga0496110_0053160
1028 Ga0496110_0204277
1029 Ga0496111_0022660
1030 Ga0496112_0000060
1031 Ga0496112_0015045
1032 Ga0496112_0040983
1033 Ga0496112_0068355
1034 Ga0496112_0083892
1035 Ga0496112_0095150
1036 Ga0496112_0220833
1037 Ga0496113_0000553
1038 Ga0496115_0003103
1039 Ga0496115_0004025
1040 Ga0501083_0064688
1041 nmdc:mga0rr50_55056_c1
1042 nmdc:mga08x19_12310_c1
1043 nmdc:mga08x19_21384_c1
1044 nmdc:mga08x19_242_c1
1045 nmdc:mga08x19_4630_c1
1046 nmdc:mga08x19_6770_c1
1047 Ga0495619_0118663
1048 Ga0495619_0129158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

26

502

0.85

PF00324

AA_permease

Amino acid permease

42

510

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8598 16 460
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8514 14 460
4dji-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8478 16 460
4djk-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8396 16 464
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8296 16 460
ID Description Score Start End Superfamily
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9078 19 460 1.20.1740.10
af_P39282_4_494_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.882 15 460 1.20.1740.10
af_P42590_4_465_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8781 13 457 1.20.1740.10
af_P75835_4_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8737 13 463 1.20.1740.10
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8466 19 460 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V9DJ03-F1-model_v4 Amino acid permease 0.9582 1 464 GO:0005886
GO:0022857
AF-A0A2V9TW08-F1-model_v4 Amino acid permease 0.9568 1 475 GO:0005886
GO:0022857
AF-A0A2V9GU99-F1-model_v4 Amino acid permease 0.9511 1 470 GO:0005886
GO:0022857
AF-A0A1Q7ZAR3-F1-model_v4 Amino acid permease 0.9417 12 462 GO:0005886
GO:0022857
AF-A0A2V9TW08-F1-model_v4 Amino acid permease 0.9412 1 475 GO:0005886
GO:0022857

Map