F459111

General Info

Members Datasets Scaffolds Average Seq Length
524 377 1048 121

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_102544860|Ga0068852_1025448601
Length 135
Sequence MTNAAVHVEGQATQHALHTYVHDAVASGATHAEGQQHPIKLYLVVWGWLFVLSTCSYLVDYFGFHGYLRWSLILLFMVLKAGLIVAVFMHMAWERLALTYAILLPPTLVLVFVAIMVFESDYTHLLRTIFFAPAA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
112 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
113 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
114 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
305 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
306 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
307 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
336 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
337 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
341 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
342 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
343 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
344 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
345 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
346 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
347 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
348 2643221629 Devosia sp. Root105 Isolate Unclassified
349 2643221662 Devosia sp. Root413D1 Isolate Unclassified
350 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
351 2738543024 Aminobacter sp. AP02 Isolate Unclassified
352 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
353 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
354 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
355 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
356 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
357 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
358 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
359 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
360 2904699407
361 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
362 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
363 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
364 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
365 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
366 2922425934
367 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
368 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
369 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
370 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
371 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
372 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
373 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
374 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
375 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
376 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
377 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.76
Metatranscriptomes 1.34
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 4.96
Rhizoplane 4.58
Rhizosphere 76.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_102544860 3300005616 Bacteria 532
2 LJQas_1006178 3300000549 Bacteria 1500
3 JGI24742J22300_10053170 3300002244 Bacteria 736
4 JGI25406J46586_10009805 3300003203 Bacteria 4276
5 JGI25160J50197_1016585 3300003354 Bacteria 2369
6 Ga0055539_1007298 3300003752 Bacteria 1402
7 Ga0055529_1032847 3300003763 Bacteria 634
8 JGI25405J52794_10065461 3300003911 Bacteria 789
9 Ga0058859_11759064 3300004798 Bacteria 779
10 Ga0058859_11814239 3300004798 Bacteria 1825
11 Ga0058860_11752966 3300004801 Bacteria 714
12 Ga0058862_12336261 3300004803 Bacteria 796
13 Ga0058862_12639219 3300004803 Bacteria 1045
14 Ga0065165_1085466 3300005262 Bacteria 812
15 Ga0065716_1009675 3300005277 Bacteria 671
16 Ga0065707_11057986 3300005295 Bacteria 525
17 Ga0070658_11367860 3300005327 Bacteria 614
18 Ga0070690_100387874 3300005330 Bacteria 1023
19 Ga0070670_100806223 3300005331 Bacteria 848
20 Ga0070677_10412084 3300005333 Bacteria 715
21 Ga0068869_100402146 3300005334 Bacteria 1127
22 Ga0070680_100008151 3300005336 Bacteria 8004
23 Ga0070680_100737727 3300005336 Bacteria 848
24 Ga0070682_100562001 3300005337 Bacteria 895
25 Ga0068868_100654957 3300005338 Bacteria 935
26 Ga0070660_100006027 3300005339 Bacteria 8383
27 Ga0070660_100068185 3300005339 Bacteria 2772
28 Ga0070660_100839132 3300005339 Bacteria 774
29 Ga0070660_101428936 3300005339 Bacteria 588
30 Ga0070660_101749844 3300005339 Bacteria 529
31 Ga0070691_10048366 3300005341 Bacteria 2024
32 Ga0070692_10511778 3300005345 Bacteria 780
33 Ga0070668_100029541 3300005347 Bacteria 4164
34 Ga0070668_100439601 3300005347 Bacteria 1119
35 Ga0070668_100547434 3300005347 Bacteria 1007
36 Ga0070669_100601918 3300005353 Bacteria 921
37 Ga0070674_100005738 3300005356 Bacteria 7203
38 Ga0070659_100022917 3300005366 Bacteria 4773
39 Ga0070667_100072578 3300005367 Bacteria 2933
40 Ga0070703_10068032 3300005406 Bacteria 1182
41 Ga0070709_11624099 3300005434 Bacteria 527
42 Ga0070714_100467216 3300005435 Bacteria 1200
43 Ga0070714_100832161 3300005435 Bacteria 895
44 Ga0070714_100879229 3300005435 Bacteria 870
45 Ga0070713_100035183 3300005436 Bacteria 4029
46 Ga0070713_100828651 3300005436 Bacteria 888
47 Ga0070710_10064775 3300005437 Bacteria 2091
48 Ga0070710_10447431 3300005437 Bacteria 875
49 Ga0070710_10551771 3300005437 Bacteria 796
50 Ga0070701_10561049 3300005438 Bacteria 751
51 Ga0070711_100909270 3300005439 Bacteria 751
52 Ga0070705_100303930 3300005440 Bacteria 1144
53 Ga0070700_100458484 3300005441 Bacteria 972
54 Ga0070700_100964741 3300005441 Bacteria 698
55 Ga0070694_100691422 3300005444 Bacteria 829
56 Ga0070708_100148425 3300005445 Bacteria 2179
57 Ga0070708_100357990 3300005445 Bacteria 1375
58 Ga0070663_100589389 3300005455 Bacteria 934
59 Ga0070678_100275881 3300005456 Bacteria 1420
60 Ga0070662_100183148 3300005457 Bacteria 1652
61 Ga0070681_10024150 3300005458 Bacteria 6120
62 Ga0070681_10089558 3300005458 Bacteria 3029
63 Ga0070681_11474173 3300005458 Bacteria 605
64 Ga0068867_100178353 3300005459 Bacteria 1687
65 Ga0070679_100020888 3300005530 Bacteria 6387
66 Ga0070679_100100615 3300005530 Bacteria 2876
67 Ga0070684_100030174 3300005535 Bacteria 4604
68 Ga0068853_100021864 3300005539 Bacteria 5335
69 Ga0068853_100175345 3300005539 Bacteria 1942
70 Ga0068853_100746832 3300005539 Bacteria 935
71 Ga0070672_100025077 3300005543 Bacteria 4417
72 Ga0070686_100120485 3300005544 Bacteria 1801
73 Ga0070686_100924770 3300005544 Bacteria 711
74 Ga0070695_100494835 3300005545 Bacteria 945
75 Ga0070696_100057901 3300005546 Bacteria 2705
76 Ga0070693_100327261 3300005547 Bacteria 1042
77 Ga0070665_100694545 3300005548 Bacteria 1030
78 Ga0070665_102195586 3300005548 Bacteria 556
79 Ga0070704_100279893 3300005549 Bacteria 1382
80 Ga0070704_100943867 3300005549 Bacteria 778
81 Ga0068855_100082367 3300005563 Bacteria 3729
82 Ga0068855_100163194 3300005563 Bacteria 2527
83 Ga0068855_101773669 3300005563 Bacteria 628
84 Ga0068857_100205221 3300005577 Bacteria 1798
85 Ga0068856_100752466 3300005614 Bacteria 994
86 Ga0070702_100411285 3300005615 Bacteria 971
87 Ga0068852_100315150 3300005616 Bacteria 1518
88 Ga0068866_10098123 3300005718 Bacteria 1610
89 Ga0068851_10012797 3300005834 Bacteria 3963
90 Ga0068870_10768063 3300005840 Bacteria 671
91 Ga0068860_100417201 3300005843 Bacteria 1330
92 Ga0068862_100508389 3300005844 Bacteria 1145
93 Ga0081455_10011421 3300005937 Bacteria 8926
94 Ga0081455_10115734 3300005937 Bacteria 2122
95 Ga0081538_10037877 3300005981 Bacteria 3119
96 Ga0081540_1006168 3300005983 Bacteria 8792
97 Ga0081540_1037952 3300005983 Bacteria 2546
98 Ga0081540_1041606 3300005983 Bacteria 2380
99 Ga0081539_10001498 3300005985 Bacteria 39469
100 Ga0081539_10088597 3300005985 Bacteria 1605
101 Ga0070717_10877522 3300006028 Bacteria 817
102 Ga0070717_11707076 3300006028 Bacteria 570
103 Ga0075363_100435290 3300006048 Bacteria 773
104 Ga0070716_100250440 3300006173 Bacteria 1206
105 Ga0070716_100624507 3300006173 Bacteria 814
106 Ga0070712_100057347 3300006175 Bacteria 2735
107 Ga0075367_10224107 3300006178 Bacteria 1177
108 Ga0075367_10581006 3300006178 Bacteria 712
109 Ga0075366_10239926 3300006195 Bacteria 1105
110 Ga0075370_10407713 3300006353 Bacteria 816
111 Ga0075428_100111834 3300006844 Bacteria 2975
112 Ga0075431_102178207 3300006847 Bacteria 509
113 Ga0075433_10326017 3300006852 Bacteria 1358
114 Ga0075433_10632320 3300006852 Bacteria 939
115 Ga0075434_100053677 3300006871 Bacteria 4004
116 Ga0075429_100204204 3300006880 Bacteria 1731
117 Ga0068865_100021082 3300006881 Bacteria 4235
118 Ga0075435_100340810 3300007076 Bacteria 1284
119 Ga0099794_10011698 3300007265 Bacteria 3765
120 Ga0099794_10098265 3300007265 Bacteria 1459
121 Ga0099794_10484394 3300007265 Bacteria 650
122 Ga0099795_10160129 3300007788 Bacteria 928
123 Ga0099795_10264345 3300007788 Bacteria 746
124 Ga0105240_10014043 3300009093 Bacteria 10954
125 Ga0111539_10697485 3300009094 Bacteria 1182
126 Ga0111539_11161118 3300009094 Bacteria 897
127 Ga0105245_10596056 3300009098 Bacteria 1131
128 Ga0105245_11145680 3300009098 Bacteria 825
129 Ga0105245_11825516 3300009098 Bacteria 661
130 Ga0105247_10047833 3300009101 Bacteria 2627
131 Ga0105247_10496130 3300009101 Bacteria 889
132 Ga0105247_10702916 3300009101 Bacteria 761
133 Ga0114129_10527554 3300009147 Bacteria 1539
134 Ga0114129_12567341 3300009147 Bacteria 608
135 Ga0114129_13010029 3300009147 Bacteria 554
136 Ga0105243_10672842 3300009148 Bacteria 1006
137 Ga0105242_10677219 3300009176 Bacteria 1006
138 Ga0105237_10008632 3300009545 Bacteria 11016
139 Ga0105237_10186749 3300009545 Bacteria 2073
140 Ga0105238_10013209 3300009551 Bacteria 8333
141 Ga0105238_10792584 3300009551 Bacteria 963
142 Ga0105249_10216736 3300009553 Bacteria 1882
143 Ga0105249_10603646 3300009553 Bacteria 1152
144 Ga0099796_10067925 3300010159 Bacteria 1280
145 Ga0105239_10049420 3300010375 Bacteria 4612
146 Ga0105239_10090215 3300010375 Bacteria 3382
147 Ga0105239_10213195 3300010375 Bacteria 2165
148 Ga0105239_10684934 3300010375 Bacteria 1172
149 Ga0105239_12794751 3300010375 Bacteria 570
150 Ga0105246_10357233 3300011119 Bacteria 1199
151 Ga0157370_10589574 3300013104 Bacteria 1018
152 Ga0157370_11685192 3300013104 Bacteria 569
153 Ga0157369_10016214 3300013105 Bacteria 8386
154 Ga0157374_11577427 3300013296 Bacteria 680
155 Ga0157374_11985841 3300013296 Bacteria 608
156 Ga0157378_10588202 3300013297 Bacteria 1123
157 Ga0157378_11966149 3300013297 Bacteria 634
158 Ga0163162_10131787 3300013306 Bacteria 2608
159 Ga0163162_10920077 3300013306 Bacteria 987
160 Ga0163162_12320954 3300013306 Bacteria 616
161 Ga0157372_10480933 3300013307 Bacteria 1448
162 Ga0157372_12900741 3300013307 Bacteria 549
163 Ga0157375_10904317 3300013308 Bacteria 1026
164 Ga0157375_12704040 3300013308 Bacteria 593
165 Ga0157380_10011551 3300014326 Bacteria 6382
166 Ga0157380_10806260 3300014326 Bacteria 956
167 Ga0157380_11376991 3300014326 Bacteria 755
168 Ga0182008_10015180 3300014497 Bacteria 4023
169 Ga0182008_10514703 3300014497 Bacteria 660
170 Ga0157379_10780246 3300014968 Bacteria 901
171 Ga0182005_1026567 3300015265 Bacteria 1579
172 Ga0182005_1219863 3300015265 Bacteria 577
173 Ga0163161_10738268 3300017792 Bacteria 823
174 Ga0163161_10809755 3300017792 Bacteria 788
175 Ga0214544_1000002 3300021320 Bacteria 753857
176 Ga0214542_1000001 3300021321 Bacteria 1018696
177 Ga0214545_1000001 3300021324 Bacteria 1092817
178 Ga0214543_1000001 3300021327 Bacteria 776921
179 Ga0209677_105071 3300025253 Bacteria 3561
180 Ga0209233_1004223 3300025261 Bacteria 4922
181 Ga0209455_1002025 3300025272 Bacteria 8274
182 Ga0209455_1027621 3300025272 Bacteria 1002
183 Ga0209130_1000565 3300025284 Bacteria 36601
184 Ga0209025_1000099 3300025294 Bacteria 231353
185 Ga0209758_1002834 3300025297 Bacteria 16851
186 Ga0207426_1000065 3300025302 Bacteria 353625
187 Ga0207656_10010305 3300025321 Bacteria 3498
188 Ga0207653_10002361 3300025885 Bacteria 6017
189 Ga0207692_10223249 3300025898 Bacteria 1118
190 Ga0207692_10960714 3300025898 Bacteria 563
191 Ga0207642_10433401 3300025899 Bacteria 793
192 Ga0207688_10357397 3300025901 Bacteria 901
193 Ga0207685_10499445 3300025905 Bacteria 640
194 Ga0207699_10405483 3300025906 Bacteria 971
195 Ga0207699_10797981 3300025906 Bacteria 694
196 Ga0207643_10172979 3300025908 Bacteria 1304
197 Ga0207643_10544632 3300025908 Bacteria 744
198 Ga0207684_10005128 3300025910 Bacteria 12201
199 Ga0207707_10007364 3300025912 Bacteria 9583
200 Ga0207707_11243518 3300025912 Bacteria 601
201 Ga0207695_10057445 3300025913 Bacteria 4042
202 Ga0207671_10147831 3300025914 Bacteria 1814
203 Ga0207693_10115338 3300025915 Bacteria 2109
204 Ga0207693_10267214 3300025915 Bacteria 1340
205 Ga0207693_10645318 3300025915 Bacteria 822
206 Ga0207663_10244090 3300025916 Bacteria 1319
207 Ga0207660_10003393 3300025917 Bacteria 10382
208 Ga0207657_10005499 3300025919 Bacteria 13230
209 Ga0207657_10012946 3300025919 Bacteria 8202
210 Ga0207652_10003525 3300025921 Bacteria 12905
211 Ga0207652_10103027 3300025921 Bacteria 2523
212 Ga0207646_10009547 3300025922 Bacteria 9580
213 Ga0207681_10381309 3300025923 Bacteria 1135
214 Ga0207694_10081625 3300025924 Bacteria 2540
215 Ga0207694_10622530 3300025924 Bacteria 908
216 Ga0207687_10587768 3300025927 Bacteria 937
217 Ga0207664_10156933 3300025929 Bacteria 1938
218 Ga0207664_11528145 3300025929 Bacteria 589
219 Ga0207706_10100115 3300025933 Bacteria 2550
220 Ga0207706_10758581 3300025933 Bacteria 826
221 Ga0207709_10011619 3300025935 Bacteria 4855
222 Ga0207709_10297911 3300025935 Bacteria 1198
223 Ga0207669_10594548 3300025937 Bacteria 898
224 Ga0207669_11536446 3300025937 Bacteria 568
225 Ga0207665_10089693 3300025939 Bacteria 2130
226 Ga0207665_10946835 3300025939 Bacteria 684
227 Ga0207691_10072869 3300025940 Bacteria 3098
228 Ga0207679_11451412 3300025945 Bacteria 629
229 Ga0207667_10011485 3300025949 Bacteria 10287
230 Ga0207667_10233898 3300025949 Bacteria 1881
231 Ga0207651_10073900 3300025960 Bacteria 2426
232 Ga0207712_10108407 3300025961 Bacteria 2078
233 Ga0207712_10419739 3300025961 Bacteria 1128
234 Ga0207712_11347630 3300025961 Bacteria 638
235 Ga0207668_10139776 3300025972 Bacteria 1860
236 Ga0207668_10370367 3300025972 Bacteria 1203
237 Ga0207668_10615566 3300025972 Bacteria 947
238 Ga0207640_11500683 3300025981 Bacteria 606
239 Ga0207677_10129867 3300026023 Bacteria 1911
240 Ga0207677_10197481 3300026023 Bacteria 1596
241 Ga0207703_10176371 3300026035 Bacteria 1883
242 Ga0207639_10040700 3300026041 Bacteria 3470
243 Ga0207639_11116562 3300026041 Bacteria 739
244 Ga0207678_10830281 3300026067 Bacteria 816
245 Ga0207702_10193667 3300026078 Bacteria 1880
246 Ga0207641_11594772 3300026088 Bacteria 655
247 Ga0207648_10188404 3300026089 Bacteria 1828
248 Ga0207648_10523933 3300026089 Bacteria 1086
249 Ga0207674_10075973 3300026116 Bacteria 3368
250 Ga0207698_10043253 3300026142 Bacteria 3373
251 Ga0207698_11133650 3300026142 Bacteria 795
252 Ga0209179_1033704 3300027512 Bacteria 1060
253 Ga0209179_1092266 3300027512 Bacteria 672
254 Ga0209588_1008591 3300027671 Bacteria 3031
255 Ga0268265_10672347 3300028380 Bacteria 997
256 Ga0268264_10577484 3300028381 Bacteria 1105
257 Ga0307517_10296419 3300028786 Bacteria 910
258 Ga0307515_10473701 3300028794 Bacteria 865
259 Ga0265328_10265981 3300031239 Bacteria 658
260 Ga0265327_10008003 3300031251 Bacteria 7981
261 Ga0265316_10163786 3300031344 Bacteria 1662
262 Ga0307408_100101998 3300031548 Bacteria 2188
263 Ga0307408_100366579 3300031548 Bacteria 1227
264 Ga0307408_100415066 3300031548 Bacteria 1159
265 Ga0307408_101777318 3300031548 Bacteria 589
266 Ga0307413_10883749 3300031824 Bacteria 758
267 Ga0307406_10299527 3300031901 Bacteria 1235
268 Ga0307406_10397907 3300031901 Bacteria 1091
269 Ga0307406_10516029 3300031901 Bacteria 972
270 Ga0307406_10876277 3300031901 Bacteria 763
271 Ga0307407_10636701 3300031903 Bacteria 797
272 Ga0307412_10658231 3300031911 Bacteria 894
273 Ga0307412_10858579 3300031911 Bacteria 792
274 Ga0307409_100294384 3300031995 Bacteria 1507
275 Ga0307409_100895825 3300031995 Bacteria 900
276 Ga0307416_100049781 3300032002 Bacteria 3334
277 Ga0307416_100123710 3300032002 Bacteria 2312
278 Ga0307416_100577392 3300032002 Bacteria 1201
279 Ga0307416_101369547 3300032002 Bacteria 813
280 Ga0307416_101685928 3300032002 Bacteria 739
281 Ga0307416_101749538 3300032002 Bacteria 726
282 Ga0307414_10755670 3300032004 Bacteria 884
283 Ga0307414_11473261 3300032004 Bacteria 633
284 Ga0307415_100138775 3300032126 Bacteria 1853
285 Ga0307415_100291016 3300032126 Bacteria 1348
286 Ga0307415_100759200 3300032126 Bacteria 881
287 Ga0307415_101148261 3300032126 Bacteria 729
288 Ga0315911_1000009 3300033442 Bacteria 379354
289 Ga0373923_0235622 3300035111 Bacteria 854
290 Ga0373945_0060589 3300035116 Bacteria 1412
291 Ga0373954_0227944 3300035118 Bacteria 917
292 Ga0373943_0052460 3300035170 Bacteria 2011
293 Ga0373943_0094638 3300035170 Bacteria 1553
294 Ga0373955_0030305 3300035172 Bacteria 2823
295 Ga0373935_0192602 3300035692 Bacteria 1405
296 Ga0373927_0028596 3300035695 Bacteria 3636
297 Ga0373927_0042274 3300035695 Bacteria 2953
298 Ga0373927_0370321 3300035695 Bacteria 944
299 Ga0373927_1059579 3300035695 Bacteria 535
300 Ga0373947_0059315 3300035725 Bacteria 2320
301 Ga0373925_0308472 3300037068 Bacteria 1279
302 Ga0395900_0099451 3300037418 Bacteria 2988
303 Ga0395900_0137113 3300037418 Bacteria 2507
304 Ga0395898_0033916 3300037466 Bacteria 5091
305 Ga0395901_0036715 3300038443 Bacteria 5065
306 Ga0395901_0377898 3300038443 Bacteria 1459
307 Ga0242420_005082 3300038996 Bacteria 2021
308 Ga0436360_1366726 3300039438 Bacteria 2269
309 Ga0436361_0060433 3300039447 Bacteria 16066
310 Ga0436361_0135686 3300039447 Bacteria 1560
311 Ga0436361_1009582 3300039447 Bacteria 3528
312 Ga0439465_0043400 3300041413 Bacteria 1459
313 Ga0451795_0701693 3300041456 Bacteria 515
314 Ga0451802_1018590 3300041460 Bacteria 779
315 Ga0439445_0133568 3300042004 Bacteria 717
316 Ga0439432_105518 3300042006 Bacteria 841
317 Ga0450900_083457 3300042136 Bacteria 515
318 Ga0439458_0045626 3300042157 Bacteria 1072
319 Ga0466969_0088693 3300044656 Bacteria 1468
320 Ga0466972_0136223 3300044658 Bacteria 1156
321 Ga0466966_0152513 3300044684 Bacteria 1409
322 Ga0466966_0165307 3300044684 Bacteria 1346
323 Ga0466970_0155115 3300044765 Bacteria 1265
324 Ga0466970_0429498 3300044765 Bacteria 756
325 Ga0466970_0786431 3300044765 Bacteria 557
326 Ga0466957_0487295 3300044842 Bacteria 853
327 Ga0466967_0673331 3300045976 Bacteria 1024
328 Ga0466967_1573302 3300045976 Bacteria 655
329 Ga0495603_0064724 3300046455 Bacteria 2155
330 Ga0495629_0109490 3300046459 Bacteria 1926
331 Ga0495638_0011225 3300046460 Bacteria 6182
332 Ga0495641_0293061 3300046461 Bacteria 733
333 Ga0495641_0492546 3300046461 Bacteria 559
334 Ga0495653_0109117 3300046463 Bacteria 1992
335 Ga0495580_0622365 3300046472 Bacteria 712
336 Ga0495580_0660792 3300046472 Bacteria 687
337 Ga0495605_0020857 3300046474 Bacteria 3477
338 Ga0495662_0229531 3300046476 Bacteria 915
339 Ga0495664_0260211 3300046477 Bacteria 1049
340 Ga0495584_0004237 3300046491 Bacteria 7736
341 Ga0495585_0124172 3300046492 Bacteria 1363
342 Ga0495594_0267238 3300046499 Bacteria 974
343 Ga0495616_0121192 3300046513 Bacteria 1207
344 Ga0495618_0017817 3300046514 Bacteria 4358
345 Ga0495620_0066141 3300046515 Bacteria 1490
346 Ga0495628_0083936 3300046516 Bacteria 2472
347 Ga0495630_0036826 3300046517 Bacteria 3657
348 Ga0495631_0011013 3300046518 Bacteria 4464
349 Ga0495637_0034570 3300046520 Bacteria 2212
350 Ga0495637_0161978 3300046520 Bacteria 839
351 Ga0495644_0016846 3300046523 Bacteria 2796
352 Ga0495648_0201144 3300046524 Bacteria 997
353 Ga0495663_0001423 3300046525 Bacteria 7552
354 Ga0495666_0192277 3300046526 Bacteria 940
355 Ga0495652_0030532 3300046529 Bacteria 4725
356 Ga0495640_0048473 3300046533 Bacteria 2935
357 Ga0495587_0012614 3300046536 Bacteria 5315
358 Ga0495598_0000455 3300046537 Bacteria 7448
359 Ga0495609_0138533 3300046538 Bacteria 1039
360 Ga0495621_0143203 3300046539 Bacteria 936
361 Ga0495597_0390608 3300046542 Bacteria 530
362 Ga0495633_0075780 3300046558 Bacteria 1566
363 Ga0495667_0165643 3300046559 Bacteria 1421
364 Ga0495656_0002385 3300046615 Bacteria 6228
365 Ga0495668_0007245 3300046616 Bacteria 7117
366 Ga0495634_0010343 3300046642 Bacteria 6836
367 Ga0495611_0006444 3300046648 Bacteria 5005
368 Ga0495635_0088404 3300046663 Bacteria 2120
369 Ga0495659_0190282 3300046664 Bacteria 838
370 Ga0495661_0020592 3300046665 Bacteria 4304
371 Ga0495599_0019202 3300046678 Bacteria 4262
372 Ga0495623_0137482 3300046679 Bacteria 1457
373 Ga0495646_0165314 3300046680 Bacteria 1222
374 Ga0495647_0171298 3300046681 Bacteria 940
375 Ga0495658_0014776 3300046683 Bacteria 3994
376 Ga0495658_0156820 3300046683 Bacteria 1401
377 Ga0495669_0007762 3300046684 Bacteria 4505
378 Ga0495669_0015487 3300046684 Bacteria 3266
379 Ga0495613_0080074 3300046689 Bacteria 2375
380 Ga0495624_0598065 3300046690 Bacteria 657
381 Ga0495624_0754533 3300046690 Bacteria 576
382 Ga0495670_0164820 3300046691 Bacteria 1165
383 Ga0495671_0005180 3300046692 Bacteria 7670
384 Ga0495671_0460312 3300046692 Bacteria 608
385 Ga0495660_0074144 3300046810 Bacteria 1798
386 Ga0495604_0078148 3300047317 Bacteria 2484
387 Ga0495636_0206868 3300047318 Bacteria 897
388 Ga0495674_0117406 3300047319 Bacteria 2250
389 Ga0495672_0080207 3300047320 Bacteria 1821
390 Ga0495672_0106137 3300047320 Bacteria 1514
391 Ga0495672_0295024 3300047320 Bacteria 770
392 Ga0495676_0211815 3300047321 Bacteria 1340
393 Ga0495680_0066552 3300047322 Bacteria 2757
394 Ga0495675_0059618 3300047444 Bacteria 2420
395 Ga0495677_0013807 3300047445 Bacteria 2940
396 Ga0495679_044877 3300047446 Bacteria 1352
397 Ga0495673_0186138 3300047469 Bacteria 784
398 Ga0495684_0446021 3300047471 Bacteria 900
399 Ga0495686_0275259 3300047472 Bacteria 937
400 Ga0495593_0358398 3300047673 Bacteria 729
401 Ga0495602_0039597 3300048088 Bacteria 4338
402 Ga0495626_0187386 3300048091 Bacteria 855
403 Ga0496101_0224719 3300048904 Bacteria 1458
404 Ga0496101_0484918 3300048904 Bacteria 976
405 Ga0496102_0457608 3300048905 Bacteria 1197
406 Ga0496102_0562109 3300048905 Bacteria 1063
407 Ga0496102_0661458 3300048905 Bacteria 968
408 Ga0496105_0854648 3300048908 Bacteria 688
409 Ga0496106_0951871 3300048909 Bacteria 677
410 Ga0496107_0213239 3300048910 Bacteria 1436
411 Ga0496107_0433229 3300048910 Bacteria 977
412 Ga0496108_0082076 3300048911 Bacteria 2733
413 Ga0496109_0040022 3300048912 Bacteria 4245
414 Ga0496110_0169179 3300048913 Bacteria 1982
415 Ga0496110_0872015 3300048913 Bacteria 806
416 Ga0496111_0007449 3300048914 Bacteria 7176
417 Ga0496111_0313031 3300048914 Bacteria 1163
418 Ga0496112_0152437 3300048915 Bacteria 2279
419 Ga0496113_0999472 3300048916 Bacteria 659
420 Ga0496114_0707278 3300048917 Bacteria 883
421 Ga0496114_1096525 3300048917 Bacteria 681
422 Ga0496115_0211115 3300048918 Bacteria 1603
423 Ga0496115_0348103 3300048918 Bacteria 1209
424 Ga0496115_1427948 3300048918 Bacteria 510
425 Ga0496116_0203912 3300048919 Bacteria 1032
426 Ga0496118_0092392 3300048921 Bacteria 2077
427 Ga0496121_0052002 3300048924 Bacteria 3445
428 Ga0496121_0116822 3300048924 Bacteria 2022
429 Ga0496122_0364244 3300048925 Bacteria 749
430 Ga0496125_0094138 3300048928 Bacteria 2233
431 Ga0496126_0237138 3300048929 Bacteria 1526
432 Ga0496126_0249698 3300048929 Bacteria 1479
433 Ga0496126_0497411 3300048929 Bacteria 975
434 Ga0496126_0841165 3300048929 Bacteria 701
435 Ga0501032_0430035 3300049569 Bacteria 847
436 Ga0501034_0891910 3300049571 Bacteria 778
437 Ga0501038_0140995 3300049574 Bacteria 1972
438 Ga0501039_0311911 3300049575 Bacteria 1237
439 Ga0501047_0034832 3300049581 Bacteria 4861
440 Ga0501067_0032780 3300049583 Bacteria 2883
441 Ga0501069_0020859 3300049585 Bacteria 3553
442 Ga0501074_1239625 3300049590 Bacteria 523
443 Ga0501076_1297946 3300049592 Bacteria 599
444 Ga0501238_001956 3300049671 Bacteria 2414
445 Ga0501252_002633 3300049682 Bacteria 1798
446 Ga0501253_108796 3300049683 Bacteria 658
447 Ga0501269_021109 3300049766 Bacteria 813
448 Ga0501044_0043293 3300049823 Bacteria 4678
449 nmdc:mga03n38_25931_c1 3300050490 Bacteria 2414
450 nmdc:mga00v17_424793_c1 3300050491 Bacteria 863
451 nmdc:mga0k408_161240_c1 3300050493 Bacteria 1336
452 nmdc:mga06z11_240788_c1 3300050494 Bacteria 1062
453 nmdc:mga06z11_591543_c1 3300050494 Bacteria 675
454 nmdc:mga06z11_994925_c1 3300050494 Bacteria 511
455 nmdc:mga07m45_211772_c1 3300050496 Bacteria 1127
456 nmdc:mga07m45_32404_c1 3300050496 Bacteria 2474
457 nmdc:mga05p37_496504_c1 3300050507 Bacteria 1402
458 nmdc:mga09592_241464_c1 3300050508 Bacteria 1565
459 nmdc:mga0qj67_965871_c1 3300050509 Bacteria 669
460 nmdc:mga06r32_331505_c1 3300050510 Bacteria 1507
461 nmdc:mga08y16_1887773_c1 3300050511 Bacteria 548
462 nmdc:mga0n895_125177_c1 3300050512 Bacteria 2594
463 nmdc:mga0n895_2057225_c1 3300050512 Bacteria 528
464 nmdc:mga0a205_92846_c1 3300050515 Bacteria 2916
465 Ga0495601_0044625 3300053077 Bacteria 2786
466 Ga0495612_0011383 3300053078 Bacteria 3587
467 Ga0500610_0338120 3300053079 Bacteria 644
468 Ga0495655_0003591 3300053083 Bacteria 2572
469 Ga0495595_0023049 3300053084 Bacteria 2738
470 Ga0495619_0082025 3300053085 Bacteria 2172
471 Ga0500646_0154072 3300053090 Bacteria 763
472 Ga0500641_0004116 3300053096 Bacteria 5134
473 Ga0500556_0000130 3300053104 Bacteria 63676
474 Ga0500577_0000790 3300053142 Bacteria 8156
475 Ga0500603_176099 3300053150 Bacteria 672
476 Ga0500616_0011185 3300053153 Bacteria 5323
477 Ga0500616_0015905 3300053153 Bacteria 4293
478 Ga0500616_0365363 3300053153 Bacteria 584
479 Ga0500622_0288863 3300053156 Bacteria 704
480 Ga0500636_0043890 3300053177 Bacteria 2638
481 Ga0500636_0156123 3300053177 Bacteria 1249
482 Ga0500645_090877 3300053730 Bacteria 866
483 Ga0500601_013850 3300053737 Bacteria 914
484 Ga0587070_220047 3300059491 Bacteria 514
485 Ga0587079_212267 3300059647 Bacteria 534
486 Ga0466962_0288761 3300061719 Bacteria 810
487 2513638829 2513237094 Bacteria 8789602
488 2513658246 2513237096 Bacteria 8722461
489 2513694234 2513237101 Bacteria 7952346
490 2513861711 2513237137 Bacteria 9558895
491 2513920262 2513237145 Bacteria 8979722
492 2517893688 2517572143 Bacteria 9484767
493 2524535915 2524023228 Bacteria 10118060
494 2617375370 2617270741 Bacteria 8201522
495 2644169738 2643221629 Bacteria 5850260
496 2644350371 2643221662 Bacteria 5851492
497 2723846600 2721755755 Bacteria 8322773
498 2739309755 2738543024 Bacteria 5603683
499 2821446338 2821443989 Bacteria 7658172
500 2824602313 2824600985 Bacteria 8488197
501 2824610593 2824609381 Bacteria 8672835
502 2824734559 2824732956 Bacteria 7810675
503 2824749851 2824746037 Bacteria 7911610
504 2844539984 2844533157 Bacteria 7517899
505 2888424967 2888419890 Bacteria 7857137
506 2904697632 2904690495 Bacteria 9412302
507 2904701416
508 2906638573 2906635258 Bacteria 8601019
509 2906666074 2906660503 Bacteria 8595048
510 2908757739 2908756301 Bacteria 8864324
511 2908780574 2908775508 Bacteria 8092255
512 2922365802 2922361189 Bacteria 7436256
513 2922428770
514 2935635562 2935630451 Bacteria 8169952
515 2941509211 2941507105 Bacteria 8166816
516 2941517040 2941515067 Bacteria 8166720
517 2941524865 2941523033 Bacteria 8169134
518 2958069492 2958064165 Bacteria 7158582
519 3005478896 3005474847 Bacteria 9259049
520 8006942441 8006933436 Bacteria 10410654
521 8006982168 8006973647 Bacteria 10679141
522 8019558204 8019555841 Bacteria 9642137
523 8019567090 8019565922 Bacteria 9639779
524 8056676984 8056673599 Bacteria 7871253
525 Ga0068852_102544860
526 LJQas_1006178
527 JGI24742J22300_10053170
528 JGI25406J46586_10009805
529 JGI25160J50197_1016585
530 Ga0055539_1007298
531 Ga0055529_1032847
532 JGI25405J52794_10065461
533 Ga0058859_11759064
534 Ga0058859_11814239
535 Ga0058860_11752966
536 Ga0058862_12336261
537 Ga0058862_12639219
538 Ga0065165_1085466
539 Ga0065716_1009675
540 Ga0065707_11057986
541 Ga0070658_11367860
542 Ga0070690_100387874
543 Ga0070670_100806223
544 Ga0070677_10412084
545 Ga0068869_100402146
546 Ga0070680_100008151
547 Ga0070680_100737727
548 Ga0070682_100562001
549 Ga0068868_100654957
550 Ga0070660_100006027
551 Ga0070660_100068185
552 Ga0070660_100839132
553 Ga0070660_101428936
554 Ga0070660_101749844
555 Ga0070691_10048366
556 Ga0070692_10511778
557 Ga0070668_100029541
558 Ga0070668_100439601
559 Ga0070668_100547434
560 Ga0070669_100601918
561 Ga0070674_100005738
562 Ga0070659_100022917
563 Ga0070667_100072578
564 Ga0070703_10068032
565 Ga0070709_11624099
566 Ga0070714_100467216
567 Ga0070714_100832161
568 Ga0070714_100879229
569 Ga0070713_100035183
570 Ga0070713_100828651
571 Ga0070710_10064775
572 Ga0070710_10447431
573 Ga0070710_10551771
574 Ga0070701_10561049
575 Ga0070711_100909270
576 Ga0070705_100303930
577 Ga0070700_100458484
578 Ga0070700_100964741
579 Ga0070694_100691422
580 Ga0070708_100148425
581 Ga0070708_100357990
582 Ga0070663_100589389
583 Ga0070678_100275881
584 Ga0070662_100183148
585 Ga0070681_10024150
586 Ga0070681_10089558
587 Ga0070681_11474173
588 Ga0068867_100178353
589 Ga0070679_100020888
590 Ga0070679_100100615
591 Ga0070684_100030174
592 Ga0068853_100021864
593 Ga0068853_100175345
594 Ga0068853_100746832
595 Ga0070672_100025077
596 Ga0070686_100120485
597 Ga0070686_100924770
598 Ga0070695_100494835
599 Ga0070696_100057901
600 Ga0070693_100327261
601 Ga0070665_100694545
602 Ga0070665_102195586
603 Ga0070704_100279893
604 Ga0070704_100943867
605 Ga0068855_100082367
606 Ga0068855_100163194
607 Ga0068855_101773669
608 Ga0068857_100205221
609 Ga0068856_100752466
610 Ga0070702_100411285
611 Ga0068852_100315150
612 Ga0068866_10098123
613 Ga0068851_10012797
614 Ga0068870_10768063
615 Ga0068860_100417201
616 Ga0068862_100508389
617 Ga0081455_10011421
618 Ga0081455_10115734
619 Ga0081538_10037877
620 Ga0081540_1006168
621 Ga0081540_1037952
622 Ga0081540_1041606
623 Ga0081539_10001498
624 Ga0081539_10088597
625 Ga0070717_10877522
626 Ga0070717_11707076
627 Ga0075363_100435290
628 Ga0070716_100250440
629 Ga0070716_100624507
630 Ga0070712_100057347
631 Ga0075367_10224107
632 Ga0075367_10581006
633 Ga0075366_10239926
634 Ga0075370_10407713
635 Ga0075428_100111834
636 Ga0075431_102178207
637 Ga0075433_10326017
638 Ga0075433_10632320
639 Ga0075434_100053677
640 Ga0075429_100204204
641 Ga0068865_100021082
642 Ga0075435_100340810
643 Ga0099794_10011698
644 Ga0099794_10098265
645 Ga0099794_10484394
646 Ga0099795_10160129
647 Ga0099795_10264345
648 Ga0105240_10014043
649 Ga0111539_10697485
650 Ga0111539_11161118
651 Ga0105245_10596056
652 Ga0105245_11145680
653 Ga0105245_11825516
654 Ga0105247_10047833
655 Ga0105247_10496130
656 Ga0105247_10702916
657 Ga0114129_10527554
658 Ga0114129_12567341
659 Ga0114129_13010029
660 Ga0105243_10672842
661 Ga0105242_10677219
662 Ga0105237_10008632
663 Ga0105237_10186749
664 Ga0105238_10013209
665 Ga0105238_10792584
666 Ga0105249_10216736
667 Ga0105249_10603646
668 Ga0099796_10067925
669 Ga0105239_10049420
670 Ga0105239_10090215
671 Ga0105239_10213195
672 Ga0105239_10684934
673 Ga0105239_12794751
674 Ga0105246_10357233
675 Ga0157370_10589574
676 Ga0157370_11685192
677 Ga0157369_10016214
678 Ga0157374_11577427
679 Ga0157374_11985841
680 Ga0157378_10588202
681 Ga0157378_11966149
682 Ga0163162_10131787
683 Ga0163162_10920077
684 Ga0163162_12320954
685 Ga0157372_10480933
686 Ga0157372_12900741
687 Ga0157375_10904317
688 Ga0157375_12704040
689 Ga0157380_10011551
690 Ga0157380_10806260
691 Ga0157380_11376991
692 Ga0182008_10015180
693 Ga0182008_10514703
694 Ga0157379_10780246
695 Ga0182005_1026567
696 Ga0182005_1219863
697 Ga0163161_10738268
698 Ga0163161_10809755
699 Ga0214544_1000002
700 Ga0214542_1000001
701 Ga0214545_1000001
702 Ga0214543_1000001
703 Ga0209677_105071
704 Ga0209233_1004223
705 Ga0209455_1002025
706 Ga0209455_1027621
707 Ga0209130_1000565
708 Ga0209025_1000099
709 Ga0209758_1002834
710 Ga0207426_1000065
711 Ga0207656_10010305
712 Ga0207653_10002361
713 Ga0207692_10223249
714 Ga0207692_10960714
715 Ga0207642_10433401
716 Ga0207688_10357397
717 Ga0207685_10499445
718 Ga0207699_10405483
719 Ga0207699_10797981
720 Ga0207643_10172979
721 Ga0207643_10544632
722 Ga0207684_10005128
723 Ga0207707_10007364
724 Ga0207707_11243518
725 Ga0207695_10057445
726 Ga0207671_10147831
727 Ga0207693_10115338
728 Ga0207693_10267214
729 Ga0207693_10645318
730 Ga0207663_10244090
731 Ga0207660_10003393
732 Ga0207657_10005499
733 Ga0207657_10012946
734 Ga0207652_10003525
735 Ga0207652_10103027
736 Ga0207646_10009547
737 Ga0207681_10381309
738 Ga0207694_10081625
739 Ga0207694_10622530
740 Ga0207687_10587768
741 Ga0207664_10156933
742 Ga0207664_11528145
743 Ga0207706_10100115
744 Ga0207706_10758581
745 Ga0207709_10011619
746 Ga0207709_10297911
747 Ga0207669_10594548
748 Ga0207669_11536446
749 Ga0207665_10089693
750 Ga0207665_10946835
751 Ga0207691_10072869
752 Ga0207679_11451412
753 Ga0207667_10011485
754 Ga0207667_10233898
755 Ga0207651_10073900
756 Ga0207712_10108407
757 Ga0207712_10419739
758 Ga0207712_11347630
759 Ga0207668_10139776
760 Ga0207668_10370367
761 Ga0207668_10615566
762 Ga0207640_11500683
763 Ga0207677_10129867
764 Ga0207677_10197481
765 Ga0207703_10176371
766 Ga0207639_10040700
767 Ga0207639_11116562
768 Ga0207678_10830281
769 Ga0207702_10193667
770 Ga0207641_11594772
771 Ga0207648_10188404
772 Ga0207648_10523933
773 Ga0207674_10075973
774 Ga0207698_10043253
775 Ga0207698_11133650
776 Ga0209179_1033704
777 Ga0209179_1092266
778 Ga0209588_1008591
779 Ga0268265_10672347
780 Ga0268264_10577484
781 Ga0307517_10296419
782 Ga0307515_10473701
783 Ga0265328_10265981
784 Ga0265327_10008003
785 Ga0265316_10163786
786 Ga0307408_100101998
787 Ga0307408_100366579
788 Ga0307408_100415066
789 Ga0307408_101777318
790 Ga0307413_10883749
791 Ga0307406_10299527
792 Ga0307406_10397907
793 Ga0307406_10516029
794 Ga0307406_10876277
795 Ga0307407_10636701
796 Ga0307412_10658231
797 Ga0307412_10858579
798 Ga0307409_100294384
799 Ga0307409_100895825
800 Ga0307416_100049781
801 Ga0307416_100123710
802 Ga0307416_100577392
803 Ga0307416_101369547
804 Ga0307416_101685928
805 Ga0307416_101749538
806 Ga0307414_10755670
807 Ga0307414_11473261
808 Ga0307415_100138775
809 Ga0307415_100291016
810 Ga0307415_100759200
811 Ga0307415_101148261
812 Ga0315911_1000009
813 Ga0373923_0235622
814 Ga0373945_0060589
815 Ga0373954_0227944
816 Ga0373943_0052460
817 Ga0373943_0094638
818 Ga0373955_0030305
819 Ga0373935_0192602
820 Ga0373927_0028596
821 Ga0373927_0042274
822 Ga0373927_0370321
823 Ga0373927_1059579
824 Ga0373947_0059315
825 Ga0373925_0308472
826 Ga0395900_0099451
827 Ga0395900_0137113
828 Ga0395898_0033916
829 Ga0395901_0036715
830 Ga0395901_0377898
831 Ga0242420_005082
832 Ga0436360_1366726
833 Ga0436361_0060433
834 Ga0436361_0135686
835 Ga0436361_1009582
836 Ga0439465_0043400
837 Ga0451795_0701693
838 Ga0451802_1018590
839 Ga0439445_0133568
840 Ga0439432_105518
841 Ga0450900_083457
842 Ga0439458_0045626
843 Ga0466969_0088693
844 Ga0466972_0136223
845 Ga0466966_0152513
846 Ga0466966_0165307
847 Ga0466970_0155115
848 Ga0466970_0429498
849 Ga0466970_0786431
850 Ga0466957_0487295
851 Ga0466967_0673331
852 Ga0466967_1573302
853 Ga0495603_0064724
854 Ga0495629_0109490
855 Ga0495638_0011225
856 Ga0495641_0293061
857 Ga0495641_0492546
858 Ga0495653_0109117
859 Ga0495580_0622365
860 Ga0495580_0660792
861 Ga0495605_0020857
862 Ga0495662_0229531
863 Ga0495664_0260211
864 Ga0495584_0004237
865 Ga0495585_0124172
866 Ga0495594_0267238
867 Ga0495616_0121192
868 Ga0495618_0017817
869 Ga0495620_0066141
870 Ga0495628_0083936
871 Ga0495630_0036826
872 Ga0495631_0011013
873 Ga0495637_0034570
874 Ga0495637_0161978
875 Ga0495644_0016846
876 Ga0495648_0201144
877 Ga0495663_0001423
878 Ga0495666_0192277
879 Ga0495652_0030532
880 Ga0495640_0048473
881 Ga0495587_0012614
882 Ga0495598_0000455
883 Ga0495609_0138533
884 Ga0495621_0143203
885 Ga0495597_0390608
886 Ga0495633_0075780
887 Ga0495667_0165643
888 Ga0495656_0002385
889 Ga0495668_0007245
890 Ga0495634_0010343
891 Ga0495611_0006444
892 Ga0495635_0088404
893 Ga0495659_0190282
894 Ga0495661_0020592
895 Ga0495599_0019202
896 Ga0495623_0137482
897 Ga0495646_0165314
898 Ga0495647_0171298
899 Ga0495658_0014776
900 Ga0495658_0156820
901 Ga0495669_0007762
902 Ga0495669_0015487
903 Ga0495613_0080074
904 Ga0495624_0598065
905 Ga0495624_0754533
906 Ga0495670_0164820
907 Ga0495671_0005180
908 Ga0495671_0460312
909 Ga0495660_0074144
910 Ga0495604_0078148
911 Ga0495636_0206868
912 Ga0495674_0117406
913 Ga0495672_0080207
914 Ga0495672_0106137
915 Ga0495672_0295024
916 Ga0495676_0211815
917 Ga0495680_0066552
918 Ga0495675_0059618
919 Ga0495677_0013807
920 Ga0495679_044877
921 Ga0495673_0186138
922 Ga0495684_0446021
923 Ga0495686_0275259
924 Ga0495593_0358398
925 Ga0495602_0039597
926 Ga0495626_0187386
927 Ga0496101_0224719
928 Ga0496101_0484918
929 Ga0496102_0457608
930 Ga0496102_0562109
931 Ga0496102_0661458
932 Ga0496105_0854648
933 Ga0496106_0951871
934 Ga0496107_0213239
935 Ga0496107_0433229
936 Ga0496108_0082076
937 Ga0496109_0040022
938 Ga0496110_0169179
939 Ga0496110_0872015
940 Ga0496111_0007449
941 Ga0496111_0313031
942 Ga0496112_0152437
943 Ga0496113_0999472
944 Ga0496114_0707278
945 Ga0496114_1096525
946 Ga0496115_0211115
947 Ga0496115_0348103
948 Ga0496115_1427948
949 Ga0496116_0203912
950 Ga0496118_0092392
951 Ga0496121_0052002
952 Ga0496121_0116822
953 Ga0496122_0364244
954 Ga0496125_0094138
955 Ga0496126_0237138
956 Ga0496126_0249698
957 Ga0496126_0497411
958 Ga0496126_0841165
959 Ga0501032_0430035
960 Ga0501034_0891910
961 Ga0501038_0140995
962 Ga0501039_0311911
963 Ga0501047_0034832
964 Ga0501067_0032780
965 Ga0501069_0020859
966 Ga0501074_1239625
967 Ga0501076_1297946
968 Ga0501238_001956
969 Ga0501252_002633
970 Ga0501253_108796
971 Ga0501269_021109
972 Ga0501044_0043293
973 nmdc:mga03n38_25931_c1
974 nmdc:mga00v17_424793_c1
975 nmdc:mga0k408_161240_c1
976 nmdc:mga06z11_240788_c1
977 nmdc:mga06z11_591543_c1
978 nmdc:mga06z11_994925_c1
979 nmdc:mga07m45_211772_c1
980 nmdc:mga07m45_32404_c1
981 nmdc:mga05p37_496504_c1
982 nmdc:mga09592_241464_c1
983 nmdc:mga0qj67_965871_c1
984 nmdc:mga06r32_331505_c1
985 nmdc:mga08y16_1887773_c1
986 nmdc:mga0n895_125177_c1
987 nmdc:mga0n895_2057225_c1
988 nmdc:mga0a205_92846_c1
989 Ga0495601_0044625
990 Ga0495612_0011383
991 Ga0500610_0338120
992 Ga0495655_0003591
993 Ga0495595_0023049
994 Ga0495619_0082025
995 Ga0500646_0154072
996 Ga0500641_0004116
997 Ga0500556_0000130
998 Ga0500577_0000790
999 Ga0500603_176099
1000 Ga0500616_0011185
1001 Ga0500616_0015905
1002 Ga0500616_0365363
1003 Ga0500622_0288863
1004 Ga0500636_0043890
1005 Ga0500636_0156123
1006 Ga0500645_090877
1007 Ga0500601_013850
1008 Ga0587070_220047
1009 Ga0587079_212267
1010 Ga0466962_0288761
1011 2513638829
1012 2513658246
1013 2513694234
1014 2513861711
1015 2513920262
1016 2517893688
1017 2524535915
1018 2617375370
1019 2644169738
1020 2644350371
1021 2723846600
1022 2739309755
1023 2821446338
1024 2824602313
1025 2824610593
1026 2824734559
1027 2824749851
1028 2844539984
1029 2888424967
1030 2904697632
1031 2904701416
1032 2906638573
1033 2906666074
1034 2908757739
1035 2908780574
1036 2922365802
1037 2922428770
1038 2935635562
1039 2941509211
1040 2941517040
1041 2941524865
1042 2958069492
1043 3005478896
1044 8006942441
1045 8006982168
1046 8019558204
1047 8019567090
1048 8056676984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

43

114

0.91

Map