F459122

General Info

Members Datasets Scaffolds Average Seq Length
524 233 1049 325

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10012270|Ga0111539_100122703
Length 335
Sequence MKNVSILIPEGDISIVNVEGLHHIFCETNKALKREGKDPLFYFQVVGKKRSSFLKDFFSIHPNFLIGENVKTDILIIPALHGDIQKAVEINRDLIPWIIEQRDKGAEIISLCTGAFLLAATGLLNGKNCATHWIHAGEFREMFPEVNLVDDQIITDENGIYSSGAAYSYLNLILYVLEKYVRHEIVVFIAKIFAIDMGRSNQSQFMIFQGYKKHGDEYILKAQEYIERSYQQKITIQQLAEYVYLGRRNLERRFKIATAHSITEYIQRVKVEAAKKQLEAGKKIVNEVIYDVGYTDVKSFRDLFKKIVGMSPIEYRSKYKMEVAKLEDYSLWPDK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 2738541278 Niastella sp. CF465 Isolate Unclassified
227 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
228 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
229 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
230 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
231 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
232 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
233 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 0.38
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10012270 3300009094 Bacteria 10743
2 MRS1b_contig_4902935 2162886011 Bacteria 1778
3 rootH1_10014678 3300003316 Bacteria 6641
4 rootH1_10126129 3300003316 Bacteria 2865
5 rootH1_10126129 3300003323 Bacteria 8803
6 rootH2_10049150 3300003320 Bacteria 8057
7 rootH2_10139043 3300003320 Unclassified 3564
8 rootL2_10008888 3300003322 Bacteria 4670
9 rootL2_10062249 3300003322 Bacteria 4131
10 rootL2_10147489 3300003322 Bacteria 5433
11 rootH1_10001058 3300003323 Bacteria 37224
12 rootH1_10002275 3300003323 Bacteria 51459
13 rootH1_10030944 3300003323 Bacteria 14680
14 rootH1_10076350 3300003323 Bacteria 6007
15 rootH1_10165121 3300003323 Bacteria 3408
16 rootH1_10203199 3300003323 Unclassified 3254
17 rootH1_10229201 3300003323 Bacteria 1380
18 Ga0065704_10076714 3300005289 Bacteria 5006
19 Ga0065712_10014608 3300005290 Bacteria 2023
20 Ga0065715_10109530 3300005293 Bacteria 2664
21 Ga0065707_10130432 3300005295 Bacteria 1930
22 Ga0070676_10076169 3300005328 Bacteria 2024
23 Ga0070683_100014906 3300005329 Bacteria 6813
24 Ga0070683_100041045 3300005329 Bacteria 4254
25 Ga0070683_100056650 3300005329 Bacteria 3640
26 Ga0070683_100057436 3300005329 Bacteria 3615
27 Ga0070683_100063559 3300005329 Unclassified 3434
28 Ga0070683_100082822 3300005329 Bacteria 3005
29 Ga0070683_100472952 3300005329 Bacteria 1197
30 Ga0070690_100013716 3300005330 Bacteria 4798
31 Ga0070690_100250981 3300005330 Bacteria 1251
32 Ga0070670_100055573 3300005331 Bacteria 3398
33 Ga0070670_100159036 3300005331 Unclassified 1958
34 Ga0068869_100013282 3300005334 Bacteria 5473
35 Ga0068869_100017437 3300005334 Bacteria 4866
36 Ga0068869_100029105 3300005334 Unclassified 3866
37 Ga0068869_100030879 3300005334 Bacteria 3765
38 Ga0068869_100034805 3300005334 Bacteria 3566
39 Ga0068869_100042536 3300005334 Bacteria 3257
40 Ga0068869_100116170 3300005334 Bacteria 2041
41 Ga0068869_100213465 3300005334 Bacteria 1527
42 Ga0070666_10000208 3300005335 Bacteria 40242
43 Ga0070666_10006995 3300005335 Bacteria 6955
44 Ga0070666_10031840 3300005335 Bacteria 3482
45 Ga0070666_10153159 3300005335 Bacteria 1609
46 Ga0070680_100106900 3300005336 Bacteria 2327
47 Ga0070682_100055401 3300005337 Bacteria 2490
48 Ga0070682_100172875 3300005337 Bacteria 1503
49 Ga0068868_100000427 3300005338 Bacteria 28309
50 Ga0068868_100019813 3300005338 Bacteria 5046
51 Ga0068868_100078084 3300005338 Bacteria 2650
52 Ga0070660_100077672 3300005339 Bacteria 2602
53 Ga0070689_100040436 3300005340 Unclassified 3575
54 Ga0070689_100048329 3300005340 Bacteria 3281
55 Ga0070689_100058141 3300005340 Bacteria 3003
56 Ga0070689_100164063 3300005340 Bacteria 1798
57 Ga0070689_100214641 3300005340 Bacteria 1576
58 Ga0070687_100007962 3300005343 Unclassified 4462
59 Ga0070661_100007478 3300005344 Bacteria 7535
60 Ga0070661_100155967 3300005344 Bacteria 1727
61 Ga0070669_100007374 3300005353 Bacteria 7887
62 Ga0070675_100248350 3300005354 Bacteria 1556
63 Ga0070675_100328062 3300005354 Bacteria 1353
64 Ga0070671_100050535 3300005355 Unclassified 3457
65 Ga0070671_100102214 3300005355 Bacteria 2405
66 Ga0070671_100308567 3300005355 Unclassified 1347
67 Ga0070674_100023073 3300005356 Unclassified 4021
68 Ga0070674_100064756 3300005356 Bacteria 2563
69 Ga0070674_100161452 3300005356 Unclassified 1700
70 Ga0070674_100187714 3300005356 Bacteria 1588
71 Ga0070673_100019144 3300005364 Bacteria 4911
72 Ga0070673_100023671 3300005364 Bacteria 4490
73 Ga0070673_100024137 3300005364 Bacteria 4453
74 Ga0070688_100009259 3300005365 Bacteria 5376
75 Ga0070688_100012327 3300005365 Bacteria 4788
76 Ga0070688_100084311 3300005365 Bacteria 2064
77 Ga0070688_100141236 3300005365 Bacteria 1636
78 Ga0070659_100220940 3300005366 Bacteria 1564
79 Ga0070667_100003194 3300005367 Bacteria 14042
80 Ga0070667_100018071 3300005367 Bacteria 5845
81 Ga0070667_100030647 3300005367 Bacteria 4486
82 Ga0070667_100052519 3300005367 Bacteria 3440
83 Ga0070667_100120193 3300005367 Bacteria 2285
84 Ga0070667_100335537 3300005367 Unclassified 1366
85 Ga0070701_10039736 3300005438 Bacteria 2388
86 Ga0070700_100248232 3300005441 Bacteria 1275
87 Ga0070663_100038936 3300005455 Bacteria 3320
88 Ga0070663_100234047 3300005455 Bacteria 1448
89 Ga0070678_100099583 3300005456 Bacteria 2249
90 Ga0070662_100016685 3300005457 Bacteria 4935
91 Ga0070662_100023669 3300005457 Bacteria 4221
92 Ga0070662_100053019 3300005457 Bacteria 2935
93 Ga0070662_100119643 3300005457 Bacteria 2017
94 Ga0070662_100178374 3300005457 Bacteria 1673
95 Ga0070662_100280758 3300005457 Bacteria 1348
96 Ga0068867_100023015 3300005459 Bacteria 4458
97 Ga0068867_100064673 3300005459 Unclassified 2720
98 Ga0068867_100071603 3300005459 Bacteria 2594
99 Ga0068867_100088798 3300005459 Bacteria 2343
100 Ga0068867_100119180 3300005459 Unclassified 2037
101 Ga0070679_100000531 3300005530 Bacteria 32408
102 Ga0070679_100016059 3300005530 Bacteria 7212
103 Ga0070679_100039430 3300005530 Bacteria 4694
104 Ga0070684_100006713 3300005535 Bacteria 8923
105 Ga0070684_100052689 3300005535 Bacteria 3539
106 Ga0070684_100073195 3300005535 Bacteria 3019
107 Ga0070684_100090701 3300005535 Unclassified 2718
108 Ga0070684_100201235 3300005535 Unclassified 1814
109 Ga0068853_100020347 3300005539 Bacteria 5518
110 Ga0068853_100168555 3300005539 Unclassified 1980
111 Ga0070672_100124361 3300005543 Unclassified 2114
112 Ga0070686_100014627 3300005544 Bacteria 4527
113 Ga0070686_100188516 3300005544 Bacteria 1470
114 Ga0070693_100003851 3300005547 Bacteria 7031
115 Ga0070665_100020987 3300005548 Bacteria 6566
116 Ga0070665_100334111 3300005548 Bacteria 1520
117 Ga0070704_100421421 3300005549 Bacteria 1143
118 Ga0068855_100000922 3300005563 Bacteria 36594
119 Ga0068855_100024164 3300005563 Bacteria 7274
120 Ga0068855_100160914 3300005563 Bacteria 2548
121 Ga0070664_100007532 3300005564 Bacteria 8786
122 Ga0070664_100166527 3300005564 Bacteria 1953
123 Ga0068857_100031051 3300005577 Bacteria 4721
124 Ga0068857_100034976 3300005577 Unclassified 4446
125 Ga0068857_100055246 3300005577 Bacteria 3524
126 Ga0068857_100059606 3300005577 Bacteria 3391
127 Ga0068857_100193220 3300005577 Bacteria 1854
128 Ga0068854_100046667 3300005578 Bacteria 3085
129 Ga0068854_100080658 3300005578 Bacteria 2402
130 Ga0068854_100189615 3300005578 Unclassified 1610
131 Ga0068856_100046300 3300005614 Bacteria 4284
132 Ga0068856_100064647 3300005614 Unclassified 3615
133 Ga0068856_100137354 3300005614 Unclassified 2450
134 Ga0068856_100284255 3300005614 Bacteria 1671
135 Ga0068852_100000864 3300005616 Bacteria 20133
136 Ga0068852_100004984 3300005616 Bacteria 9446
137 Ga0068852_100005244 3300005616 Bacteria 9245
138 Ga0068852_100077634 3300005616 Bacteria 2936
139 Ga0068852_100097096 3300005616 Bacteria 2650
140 Ga0068852_100142878 3300005616 Bacteria 2217
141 Ga0068852_100246743 3300005616 Unclassified 1709
142 Ga0068852_100291430 3300005616 Bacteria 1577
143 Ga0068859_100000006 3300005617 Bacteria 421509
144 Ga0068859_100011812 3300005617 Bacteria 8771
145 Ga0068859_100050901 3300005617 Unclassified 4162
146 Ga0068859_100056156 3300005617 Bacteria 3961
147 Ga0068859_100069041 3300005617 Bacteria 3568
148 Ga0068859_100132234 3300005617 Unclassified 2567
149 Ga0068864_100000402 3300005618 Bacteria 37620
150 Ga0068864_100010240 3300005618 Bacteria 7744
151 Ga0068864_100044307 3300005618 Bacteria 3812
152 Ga0068864_100360781 3300005618 Bacteria 1373
153 Ga0068866_10057199 3300005718 Unclassified 2008
154 Ga0068861_100003218 3300005719 Bacteria 10803
155 Ga0068851_10005604 3300005834 Bacteria 5698
156 Ga0068851_10031192 3300005834 Unclassified 2645
157 Ga0068851_10166809 3300005834 Bacteria 1213
158 Ga0068870_10040633 3300005840 Bacteria 2413
159 Ga0068863_100011388 3300005841 Bacteria 8607
160 Ga0068863_100088621 3300005841 Unclassified 2933
161 Ga0068863_100295870 3300005841 Bacteria 1570
162 Ga0068858_100011189 3300005842 Bacteria 8479
163 Ga0068858_100015736 3300005842 Bacteria 7114
164 Ga0068858_100148888 3300005842 Unclassified 2200
165 Ga0068858_100438727 3300005842 Unclassified 1257
166 Ga0068860_100000059 3300005843 Bacteria 196400
167 Ga0068860_100000502 3300005843 Bacteria 48523
168 Ga0068860_100003067 3300005843 Bacteria 17262
169 Ga0068860_100004566 3300005843 Bacteria 14129
170 Ga0068860_100014006 3300005843 Bacteria 7866
171 Ga0068860_100162166 3300005843 Bacteria 2156
172 Ga0068860_100701277 3300005843 Bacteria 1022
173 Ga0068862_100004879 3300005844 Bacteria 11295
174 Ga0068862_100029579 3300005844 Bacteria 4616
175 Ga0068862_100165733 3300005844 Bacteria 1975
176 Ga0097621_100002100 3300006237 Bacteria 13657
177 Ga0097621_100159386 3300006237 Bacteria 1939
178 Ga0097621_100325985 3300006237 Bacteria 1361
179 Ga0068871_100001822 3300006358 Bacteria 14384
180 Ga0068871_100034598 3300006358 Bacteria 4010
181 Ga0068871_100166531 3300006358 Unclassified 1887
182 Ga0068871_100320989 3300006358 Bacteria 1364
183 Ga0075434_100102605 3300006871 Bacteria 2868
184 Ga0068865_100061758 3300006881 Bacteria 2628
185 Ga0068865_100070582 3300006881 Bacteria 2475
186 Ga0068865_100127689 3300006881 Unclassified 1901
187 Ga0068865_100304529 3300006881 Bacteria 1277
188 Ga0097620_100000006 3300006931 Bacteria 421509
189 Ga0097620_100011813 3300006931 Bacteria 8771
190 Ga0097620_100050902 3300006931 Unclassified 4162
191 Ga0097620_100055021 3300006931 Bacteria 4003
192 Ga0097620_100056155 3300006931 Bacteria 3961
193 Ga0097620_100069042 3300006931 Bacteria 3568
194 Ga0097620_100132235 3300006931 Unclassified 2567
195 Ga0105240_10020193 3300009093 Bacteria 8892
196 Ga0105240_10085328 3300009093 Bacteria 3869
197 Ga0105240_10088307 3300009093 Bacteria 3794
198 Ga0105240_10212268 3300009093 Bacteria 2261
199 Ga0105240_10226959 3300009093 Bacteria 2172
200 Ga0111539_10152824 3300009094 Bacteria 2701
201 Ga0105247_10000721 3300009101 Bacteria 25734
202 Ga0114129_10025243 3300009147 Bacteria 8419
203 Ga0105241_10004686 3300009174 Bacteria 10099
204 Ga0105241_10006148 3300009174 Bacteria 8852
205 Ga0105241_10013982 3300009174 Bacteria 5885
206 Ga0105241_10059814 3300009174 Bacteria 2930
207 Ga0105242_10041632 3300009176 Unclassified 3706
208 Ga0105242_10126109 3300009176 Unclassified 2203
209 Ga0105248_10222493 3300009177 Unclassified 2125
210 Ga0105237_10001752 3300009545 Bacteria 28057
211 Ga0105237_10004863 3300009545 Bacteria 15410
212 Ga0105237_10011754 3300009545 Bacteria 9262
213 Ga0105237_10043122 3300009545 Bacteria 4546
214 Ga0105237_10130315 3300009545 Bacteria 2509
215 Ga0105238_10002718 3300009551 Bacteria 17614
216 Ga0105249_10004744 3300009553 Bacteria 11735
217 Ga0105249_10006626 3300009553 Bacteria 10077
218 Ga0105249_10031267 3300009553 Bacteria 4814
219 Ga0105249_10244869 3300009553 Bacteria 1774
220 Ga0105249_10443082 3300009553 Unclassified 1336
221 Ga0105239_10000432 3300010375 Bacteria 61084
222 Ga0105239_10013995 3300010375 Bacteria 8909
223 Ga0105239_10037142 3300010375 Bacteria 5342
224 Ga0105239_10058511 3300010375 Bacteria 4229
225 Ga0105239_10059236 3300010375 Bacteria 4203
226 Ga0105239_10255092 3300010375 Bacteria 1970
227 Ga0105239_10347208 3300010375 Bacteria 1675
228 Ga0105239_10631395 3300010375 Bacteria 1223
229 Ga0105246_10152787 3300011119 Bacteria 1749
230 Ga0105246_10201741 3300011119 Unclassified 1547
231 Ga0157373_10027805 3300013100 Unclassified 4080
232 Ga0157373_10092545 3300013100 Bacteria 2129
233 Ga0157373_10116298 3300013100 Bacteria 1879
234 Ga0157371_10000942 3300013102 Bacteria 32494
235 Ga0157371_10002496 3300013102 Bacteria 17483
236 Ga0157371_10018489 3300013102 Bacteria 5151
237 Ga0157370_10000847 3300013104 Bacteria 38795
238 Ga0157370_10005645 3300013104 Bacteria 13992
239 Ga0157370_10030479 3300013104 Bacteria 5285
240 Ga0157370_10106927 3300013104 Bacteria 2618
241 Ga0157370_10134729 3300013104 Unclassified 2303
242 Ga0157370_10216480 3300013104 Unclassified 1775
243 Ga0157369_10010693 3300013105 Bacteria 10443
244 Ga0157369_10062946 3300013105 Bacteria 3997
245 Ga0157369_10470688 3300013105 Bacteria 1301
246 Ga0157374_10058040 3300013296 Bacteria 3617
247 Ga0157374_10152126 3300013296 Bacteria 2250
248 Ga0157378_10016853 3300013297 Bacteria 6405
249 Ga0157378_10035756 3300013297 Bacteria 4395
250 Ga0157378_10186844 3300013297 Bacteria 1952
251 Ga0157378_10268869 3300013297 Bacteria 1639
252 Ga0163162_10000519 3300013306 Bacteria 35771
253 Ga0163162_10000953 3300013306 Bacteria 26826
254 Ga0163162_10008578 3300013306 Bacteria 9962
255 Ga0163162_10129261 3300013306 Bacteria 2634
256 Ga0163162_10138826 3300013306 Bacteria 2542
257 Ga0163162_10191402 3300013306 Unclassified 2173
258 Ga0163162_10699405 3300013306 Bacteria 1135
259 Ga0157372_10000029 3300013307 Bacteria 180371
260 Ga0157372_10007421 3300013307 Bacteria 11660
261 Ga0157372_10045776 3300013307 Unclassified 4855
262 Ga0157372_10206281 3300013307 Bacteria 2277
263 Ga0157372_10233908 3300013307 Bacteria 2131
264 Ga0157372_10402595 3300013307 Bacteria 1595
265 Ga0157375_10003254 3300013308 Bacteria 14102
266 Ga0157375_10008312 3300013308 Bacteria 9087
267 Ga0157375_10088567 3300013308 Bacteria 3150
268 Ga0157375_10251848 3300013308 Unclassified 1927
269 Ga0157375_10482746 3300013308 Unclassified 1404
270 Ga0163163_10000279 3300014325 Bacteria 50882
271 Ga0163163_10045276 3300014325 Unclassified 4318
272 Ga0163163_10565361 3300014325 Bacteria 1200
273 Ga0157380_10003645 3300014326 Bacteria 10592
274 Ga0157380_10014350 3300014326 Bacteria 5796
275 Ga0157377_10001928 3300014745 Bacteria 9074
276 Ga0157377_10009750 3300014745 Bacteria 4727
277 Ga0157379_10041094 3300014968 Bacteria 4128
278 Ga0157379_10261135 3300014968 Bacteria 1574
279 Ga0157376_10004296 3300014969 Bacteria 9899
280 Ga0157376_10009061 3300014969 Bacteria 7209
281 Ga0157376_10012829 3300014969 Bacteria 6233
282 Ga0157376_10189380 3300014969 Bacteria 1886
283 Ga0157376_10478543 3300014969 Bacteria 1220
284 Ga0163161_10002427 3300017792 Bacteria 13331
285 Ga0163161_10177876 3300017792 Bacteria 1630
286 Ga0213876_10054110 3300021384 Bacteria 2119
287 Ga0209050_1012460 3300025298 Bacteria 3895
288 Ga0207697_10022561 3300025315 Bacteria 2578
289 Ga0207697_10024802 3300025315 Bacteria 2453
290 Ga0207656_10011807 3300025321 Unclassified 3306
291 Ga0207710_10003603 3300025900 Bacteria 6866
292 Ga0207688_10038458 3300025901 Bacteria 2655
293 Ga0207680_10000072 3300025903 Bacteria 44683
294 Ga0207680_10093521 3300025903 Unclassified 1918
295 Ga0207680_10136447 3300025903 Bacteria 1622
296 Ga0207680_10192525 3300025903 Unclassified 1385
297 Ga0207645_10000622 3300025907 Bacteria 29378
298 Ga0207645_10029639 3300025907 Bacteria 3527
299 Ga0207705_10087126 3300025909 Bacteria 2283
300 Ga0207654_10001247 3300025911 Bacteria 13552
301 Ga0207654_10002604 3300025911 Bacteria 9150
302 Ga0207707_10001394 3300025912 Bacteria 22410
303 Ga0207695_10000060 3300025913 Bacteria 360217
304 Ga0207695_10000425 3300025913 Bacteria 93523
305 Ga0207695_10004871 3300025913 Bacteria 18105
306 Ga0207695_10017803 3300025913 Bacteria 8244
307 Ga0207695_10131495 3300025913 Bacteria 2460
308 Ga0207671_10000438 3300025914 Bacteria 57265
309 Ga0207671_10001370 3300025914 Bacteria 28347
310 Ga0207671_10159664 3300025914 Unclassified 1745
311 Ga0207660_10037644 3300025917 Bacteria 3373
312 Ga0207660_10037808 3300025917 Bacteria 3366
313 Ga0207662_10019717 3300025918 Unclassified 3842
314 Ga0207662_10028994 3300025918 Bacteria 3204
315 Ga0207662_10040120 3300025918 Bacteria 2750
316 Ga0207657_10223291 3300025919 Bacteria 1508
317 Ga0207652_10000482 3300025921 Bacteria 40894
318 Ga0207652_10010130 3300025921 Bacteria 7594
319 Ga0207652_10017413 3300025921 Bacteria 5880
320 Ga0207681_10011851 3300025923 Bacteria 5366
321 Ga0207650_10060408 3300025925 Bacteria 2829
322 Ga0207659_10154048 3300025926 Bacteria 1797
323 Ga0207659_10373232 3300025926 Bacteria 1188
324 Ga0207644_10069822 3300025931 Unclassified 2566
325 Ga0207644_10173067 3300025931 Unclassified 1687
326 Ga0207706_10060740 3300025933 Bacteria 3329
327 Ga0207706_10156409 3300025933 Bacteria 2004
328 Ga0207686_10050708 3300025934 Bacteria 2582
329 Ga0207670_10024349 3300025936 Bacteria 3783
330 Ga0207670_10031209 3300025936 Unclassified 3411
331 Ga0207670_10252511 3300025936 Bacteria 1364
332 Ga0207669_10041296 3300025937 Unclassified 2684
333 Ga0207704_10027385 3300025938 Bacteria 3144
334 Ga0207704_10148909 3300025938 Bacteria 1649
335 Ga0207691_10012744 3300025940 Bacteria 8052
336 Ga0207691_10043501 3300025940 Bacteria 4139
337 Ga0207691_10216193 3300025940 Unclassified 1663
338 Ga0207689_10000383 3300025942 Bacteria 41569
339 Ga0207689_10009787 3300025942 Bacteria 8259
340 Ga0207689_10011548 3300025942 Bacteria 7564
341 Ga0207689_10018630 3300025942 Bacteria 5857
342 Ga0207689_10022912 3300025942 Bacteria 5246
343 Ga0207689_10037486 3300025942 Bacteria 4021
344 Ga0207689_10039660 3300025942 Bacteria 3898
345 Ga0207689_10057294 3300025942 Bacteria 3206
346 Ga0207689_10191190 3300025942 Bacteria 1689
347 Ga0207689_10208849 3300025942 Bacteria 1613
348 Ga0207661_10017013 3300025944 Bacteria 5371
349 Ga0207661_10033245 3300025944 Bacteria 4001
350 Ga0207661_10092904 3300025944 Bacteria 2516
351 Ga0207661_10363334 3300025944 Bacteria 1308
352 Ga0207679_10003138 3300025945 Bacteria 10204
353 Ga0207679_10150331 3300025945 Bacteria 1894
354 Ga0207667_10001324 3300025949 Bacteria 31105
355 Ga0207667_10006621 3300025949 Bacteria 14003
356 Ga0207667_10035372 3300025949 Bacteria 5358
357 Ga0207667_10054655 3300025949 Bacteria 4199
358 Ga0207667_10096030 3300025949 Bacteria 3059
359 Ga0207667_10447561 3300025949 Unclassified 1313
360 Ga0207651_10011611 3300025960 Bacteria 4939
361 Ga0207651_10055046 3300025960 Unclassified 2730
362 Ga0207651_10175088 3300025960 Bacteria 1696
363 Ga0207712_10089840 3300025961 Bacteria 2259
364 Ga0207668_10027267 3300025972 Bacteria 3720
365 Ga0207668_10253842 3300025972 Bacteria 1430
366 Ga0207640_10033763 3300025981 Bacteria 3186
367 Ga0207658_10004378 3300025986 Bacteria 9819
368 Ga0207677_10043162 3300026023 Bacteria 2996
369 Ga0207677_10167466 3300026023 Unclassified 1714
370 Ga0207703_10009492 3300026035 Bacteria 7635
371 Ga0207703_10427614 3300026035 Unclassified 1233
372 Ga0207639_10063685 3300026041 Bacteria 2856
373 Ga0207639_10244512 3300026041 Bacteria 1562
374 Ga0207639_10306757 3300026041 Bacteria 1405
375 Ga0207678_10072767 3300026067 Bacteria 2945
376 Ga0207678_10076146 3300026067 Bacteria 2874
377 Ga0207641_10000280 3300026088 Bacteria 64281
378 Ga0207641_10065259 3300026088 Bacteria 3114
379 Ga0207641_10353000 3300026088 Bacteria 1402
380 Ga0207641_10391477 3300026088 Bacteria 1333
381 Ga0207648_10014895 3300026089 Bacteria 7168
382 Ga0207648_10044852 3300026089 Bacteria 3879
383 Ga0207648_10079221 3300026089 Unclassified 2866
384 Ga0207648_10111243 3300026089 Bacteria 2405
385 Ga0207648_10327521 3300026089 Bacteria 1377
386 Ga0207648_10450980 3300026089 Bacteria 1171
387 Ga0207676_10028558 3300026095 Bacteria 4168
388 Ga0207676_10043738 3300026095 Unclassified 3450
389 Ga0207676_10064576 3300026095 Bacteria 2912
390 Ga0207674_10017919 3300026116 Bacteria 7719
391 Ga0207674_10029358 3300026116 Bacteria 5789
392 Ga0207674_10039406 3300026116 Bacteria 4897
393 Ga0207674_10044333 3300026116 Bacteria 4581
394 Ga0207674_10106194 3300026116 Bacteria 2786
395 Ga0207674_10130802 3300026116 Bacteria 2473
396 Ga0207675_100001450 3300026118 Bacteria 23772
397 Ga0207675_100664408 3300026118 Bacteria 1049
398 Ga0207683_10001791 3300026121 Bacteria 19012
399 Ga0207683_10285490 3300026121 Bacteria 1508
400 Ga0207683_10396396 3300026121 Unclassified 1270
401 Ga0207698_10001957 3300026142 Bacteria 12099
402 Ga0207698_10004934 3300026142 Bacteria 8178
403 Ga0207698_10044573 3300026142 Bacteria 3334
404 Ga0207698_10049326 3300026142 Bacteria 3203
405 Ga0207428_10301767 3300027907 Bacteria 1185
406 Ga0268266_10000016 3300028379 Bacteria 629101
407 Ga0268265_10019687 3300028380 Bacteria 4698
408 Ga0268265_10049964 3300028380 Bacteria 3148
409 Ga0268265_10122004 3300028380 Bacteria 2149
410 Ga0268264_10000015 3300028381 Bacteria 508501
411 Ga0268264_10004703 3300028381 Bacteria 11599
412 Ga0268264_10007504 3300028381 Bacteria 9098
413 Ga0268264_10009646 3300028381 Bacteria 7998
414 Ga0268264_10077056 3300028381 Bacteria 2839
415 Ga0268264_10115537 3300028381 Bacteria 2358
416 Ga0268264_10352073 3300028381 Unclassified 1402
417 Ga0307515_10000021 3300028794 Bacteria 406008
418 Ga0265338_10119048 3300028800 Bacteria 2109
419 Ga0316177_1175081 3300030731 Bacteria 8786
420 Ga0316176_1084232 3300030732 Bacteria 4588
421 Ga0316183_1004801 3300030742 Bacteria 53681
422 Ga0316183_1119266 3300030742 Bacteria 42152
423 Ga0316181_1054008 3300030744 Bacteria 6507
424 Ga0316181_1138860 3300030744 Bacteria 58548
425 Ga0316182_1328893 3300030745 Bacteria 1871
426 Ga0265327_10000097 3300031251 Bacteria 193156
427 Ga0307513_10032711 3300031456 Bacteria 5859
428 Ga0307509_10088479 3300031507 Bacteria 3179
429 Ga0307414_10014839 3300032004 Bacteria 4685
430 Ga0307411_10050859 3300032005 Unclassified 2701
431 Ga0373934_0008765 3300035086 Bacteria 3778
432 Ga0373955_0009256 3300035172 Bacteria 4612
433 Ga0373935_0230393 3300035692 Unclassified 1290
434 Ga0373927_0166603 3300035695 Bacteria 1444
435 Ga0373933_0052630 3300035724 Bacteria 2437
436 Ga0373937_0013853 3300036401 Bacteria 7107
437 Ga0373925_0136837 3300037068 Unclassified 1915
438 Ga0395899_0000024 3300037312 Bacteria 357402
439 Ga0436365_0038471 3300039437 Bacteria 1996
440 Ga0439431_0001870 3300041997 Bacteria 4669
441 Ga0439445_0068458 3300042004 Bacteria 979
442 Ga0439449_0051261 3300042007 Bacteria 1526
443 Ga0439457_002323 3300042014 Bacteria 5467
444 Ga0451577_0043504 3300042876 Bacteria 4023
445 Ga0466972_0000075 3300044658 Bacteria 94290
446 Ga0466972_0001391 3300044658 Bacteria 11729
447 Ga0466972_0003007 3300044658 Bacteria 8355
448 Ga0453683_0016447 3300044673 Bacteria 4772
449 Ga0466966_0000167 3300044684 Bacteria 43046
450 Ga0466961_0040681 3300044693 Unclassified 2980
451 Ga0466961_0050724 3300044693 Bacteria 2650
452 Ga0453684_0260636 3300044712 Bacteria 1986
453 Ga0466971_0072281 3300044719 Unclassified 1567
454 Ga0466957_0012228 3300044842 Bacteria 4968
455 Ga0466959_0000003 3300045049 Bacteria 285164
456 Ga0466959_0016615 3300045049 Bacteria 5381
457 Ga0451576_0088032 3300045051 Bacteria 3230
458 Ga0495638_0000005 3300046460 Bacteria 680627
459 Ga0495638_0239355 3300046460 Bacteria 1006
460 Ga0495653_0022623 3300046463 Bacteria 5084
461 Ga0495618_0010411 3300046514 Bacteria 5624
462 Ga0495628_0012568 3300046516 Bacteria 7134
463 Ga0495630_0012031 3300046517 Bacteria 6276
464 Ga0495648_0002202 3300046524 Bacteria 18263
465 Ga0495586_0186305 3300046535 Bacteria 1175
466 Ga0495667_0061046 3300046559 Bacteria 2472
467 Ga0495668_0000310 3300046616 Bacteria 67405
468 Ga0495668_0008257 3300046616 Bacteria 6525
469 Ga0495634_0095271 3300046642 Unclassified 1928
470 Ga0495625_0035075 3300046660 Bacteria 3699
471 Ga0495625_0235845 3300046660 Bacteria 1193
472 Ga0495635_0194701 3300046663 Bacteria 1376
473 Ga0495661_0000305 3300046665 Bacteria 55940
474 Ga0495657_0120832 3300046675 Bacteria 1650
475 Ga0495646_0044637 3300046680 Bacteria 2710
476 Ga0495600_0049467 3300046809 Bacteria 2743
477 Ga0495687_000004 3300047443 Bacteria 779298
478 Ga0495684_0021949 3300047471 Bacteria 4915
479 Ga0495686_0088094 3300047472 Bacteria 1888
480 Ga0496110_0144654 3300048913 Bacteria 2150
481 Ga0496115_0002465 3300048918 Bacteria 13299
482 Ga0501032_0173668 3300049569 Bacteria 1412
483 Ga0501034_0130856 3300049571 Unclassified 2492
484 Ga0501034_0451117 3300049571 Bacteria 1204
485 Ga0501037_0019649 3300049573 Bacteria 4984
486 Ga0501038_0098547 3300049574 Bacteria 2437
487 Ga0501039_0038185 3300049575 Bacteria 3710
488 Ga0501043_0019817 3300049579 Bacteria 5282
489 Ga0501043_0153678 3300049579 Bacteria 1800
490 Ga0501047_0006205 3300049581 Bacteria 11238
491 Ga0501047_0031404 3300049581 Bacteria 5123
492 Ga0501047_0163170 3300049581 Bacteria 2100
493 Ga0501257_010457 3300049686 Bacteria 2106
494 Ga0501225_0000597 3300049705 Bacteria 11258
495 Ga0501080_0233465 3300049742 Bacteria 1681
496 Ga0501035_0005968 3300049822 Bacteria 11465
497 nmdc:mga05p37_18942_c2 3300050507 Bacteria 5690
498 nmdc:mga09592_245344_c1 3300050508 Bacteria 1552
499 nmdc:mga08y16_202169_c1 3300050511 Bacteria 2059
500 nmdc:mga08y16_211360_c1 3300050511 Bacteria 2009
501 nmdc:mga08y16_376002_c1 3300050511 Unclassified 1457
502 nmdc:mga0n895_101966_c1 3300050512 Bacteria 2880
503 Ga0495619_0131389 3300053085 Bacteria 1721
504 Ga0500646_0005754 3300053090 Bacteria 3141
505 Ga0500583_0000011 3300053092 Bacteria 160380
506 Ga0500583_0019694 3300053092 Unclassified 2771
507 Ga0500556_0029456 3300053104 Bacteria 1852
508 Ga0500642_0003074 3300053130 Unclassified 4991
509 Ga0500573_0117561 3300053140 Bacteria 1483
510 Ga0500588_0001617 3300053146 Archaea 4348
511 Ga0500616_0000003 3300053153 Bacteria 1220687
512 Ga0500622_0000175 3300053156 Bacteria 69363
513 Ga0500622_0063648 3300053156 Bacteria 1877
514 Ga0500637_0134123 3300053178 Bacteria 1435
515 Ga0466962_0021438 3300061719 Unclassified 3102
516 2738724894 2738541278 Bacteria 9755573
517 2833643505 2833640130 Bacteria 4858325
518 2842906384 2842903701 Bacteria 6986368
519 2852626672 2852623160 Bacteria 4376875
520 2884791857 2884791551 Bacteria 8511252
521 2884793775 2884791551 Bacteria 8511252
522 2884935103 2884933994 Bacteria 4535041
523 2896090048 2896085136 Bacteria 6129793
524 2896111373 2896109856 Bacteria 7140722
525 2896115205 2896109856 Bacteria 7140722
526 Ga0111539_10012270
527 MRS1b_contig_4902935
528 rootH1_10014678
529 rootH1_10126129
530 rootH2_10049150
531 rootH2_10139043
532 rootL2_10008888
533 rootL2_10062249
534 rootL2_10147489
535 rootH1_10001058
536 rootH1_10002275
537 rootH1_10030944
538 rootH1_10076350
539 rootH1_10165121
540 rootH1_10203199
541 rootH1_10229201
542 Ga0065704_10076714
543 Ga0065712_10014608
544 Ga0065715_10109530
545 Ga0065707_10130432
546 Ga0070676_10076169
547 Ga0070683_100014906
548 Ga0070683_100041045
549 Ga0070683_100056650
550 Ga0070683_100057436
551 Ga0070683_100063559
552 Ga0070683_100082822
553 Ga0070683_100472952
554 Ga0070690_100013716
555 Ga0070690_100250981
556 Ga0070670_100055573
557 Ga0070670_100159036
558 Ga0068869_100013282
559 Ga0068869_100017437
560 Ga0068869_100029105
561 Ga0068869_100030879
562 Ga0068869_100034805
563 Ga0068869_100042536
564 Ga0068869_100116170
565 Ga0068869_100213465
566 Ga0070666_10000208
567 Ga0070666_10006995
568 Ga0070666_10031840
569 Ga0070666_10153159
570 Ga0070680_100106900
571 Ga0070682_100055401
572 Ga0070682_100172875
573 Ga0068868_100000427
574 Ga0068868_100019813
575 Ga0068868_100078084
576 Ga0070660_100077672
577 Ga0070689_100040436
578 Ga0070689_100048329
579 Ga0070689_100058141
580 Ga0070689_100164063
581 Ga0070689_100214641
582 Ga0070687_100007962
583 Ga0070661_100007478
584 Ga0070661_100155967
585 Ga0070669_100007374
586 Ga0070675_100248350
587 Ga0070675_100328062
588 Ga0070671_100050535
589 Ga0070671_100102214
590 Ga0070671_100308567
591 Ga0070674_100023073
592 Ga0070674_100064756
593 Ga0070674_100161452
594 Ga0070674_100187714
595 Ga0070673_100019144
596 Ga0070673_100023671
597 Ga0070673_100024137
598 Ga0070688_100009259
599 Ga0070688_100012327
600 Ga0070688_100084311
601 Ga0070688_100141236
602 Ga0070659_100220940
603 Ga0070667_100003194
604 Ga0070667_100018071
605 Ga0070667_100030647
606 Ga0070667_100052519
607 Ga0070667_100120193
608 Ga0070667_100335537
609 Ga0070701_10039736
610 Ga0070700_100248232
611 Ga0070663_100038936
612 Ga0070663_100234047
613 Ga0070678_100099583
614 Ga0070662_100016685
615 Ga0070662_100023669
616 Ga0070662_100053019
617 Ga0070662_100119643
618 Ga0070662_100178374
619 Ga0070662_100280758
620 Ga0068867_100023015
621 Ga0068867_100064673
622 Ga0068867_100071603
623 Ga0068867_100088798
624 Ga0068867_100119180
625 Ga0070679_100000531
626 Ga0070679_100016059
627 Ga0070679_100039430
628 Ga0070684_100006713
629 Ga0070684_100052689
630 Ga0070684_100073195
631 Ga0070684_100090701
632 Ga0070684_100201235
633 Ga0068853_100020347
634 Ga0068853_100168555
635 Ga0070672_100124361
636 Ga0070686_100014627
637 Ga0070686_100188516
638 Ga0070693_100003851
639 Ga0070665_100020987
640 Ga0070665_100334111
641 Ga0070704_100421421
642 Ga0068855_100000922
643 Ga0068855_100024164
644 Ga0068855_100160914
645 Ga0070664_100007532
646 Ga0070664_100166527
647 Ga0068857_100031051
648 Ga0068857_100034976
649 Ga0068857_100055246
650 Ga0068857_100059606
651 Ga0068857_100193220
652 Ga0068854_100046667
653 Ga0068854_100080658
654 Ga0068854_100189615
655 Ga0068856_100046300
656 Ga0068856_100064647
657 Ga0068856_100137354
658 Ga0068856_100284255
659 Ga0068852_100000864
660 Ga0068852_100004984
661 Ga0068852_100005244
662 Ga0068852_100077634
663 Ga0068852_100097096
664 Ga0068852_100142878
665 Ga0068852_100246743
666 Ga0068852_100291430
667 Ga0068859_100000006
668 Ga0068859_100011812
669 Ga0068859_100050901
670 Ga0068859_100056156
671 Ga0068859_100069041
672 Ga0068859_100132234
673 Ga0068864_100000402
674 Ga0068864_100010240
675 Ga0068864_100044307
676 Ga0068864_100360781
677 Ga0068866_10057199
678 Ga0068861_100003218
679 Ga0068851_10005604
680 Ga0068851_10031192
681 Ga0068851_10166809
682 Ga0068870_10040633
683 Ga0068863_100011388
684 Ga0068863_100088621
685 Ga0068863_100295870
686 Ga0068858_100011189
687 Ga0068858_100015736
688 Ga0068858_100148888
689 Ga0068858_100438727
690 Ga0068860_100000059
691 Ga0068860_100000502
692 Ga0068860_100003067
693 Ga0068860_100004566
694 Ga0068860_100014006
695 Ga0068860_100162166
696 Ga0068860_100701277
697 Ga0068862_100004879
698 Ga0068862_100029579
699 Ga0068862_100165733
700 Ga0097621_100002100
701 Ga0097621_100159386
702 Ga0097621_100325985
703 Ga0068871_100001822
704 Ga0068871_100034598
705 Ga0068871_100166531
706 Ga0068871_100320989
707 Ga0075434_100102605
708 Ga0068865_100061758
709 Ga0068865_100070582
710 Ga0068865_100127689
711 Ga0068865_100304529
712 Ga0097620_100000006
713 Ga0097620_100011813
714 Ga0097620_100050902
715 Ga0097620_100055021
716 Ga0097620_100056155
717 Ga0097620_100069042
718 Ga0097620_100132235
719 Ga0105240_10020193
720 Ga0105240_10085328
721 Ga0105240_10088307
722 Ga0105240_10212268
723 Ga0105240_10226959
724 Ga0111539_10152824
725 Ga0105247_10000721
726 Ga0114129_10025243
727 Ga0105241_10004686
728 Ga0105241_10006148
729 Ga0105241_10013982
730 Ga0105241_10059814
731 Ga0105242_10041632
732 Ga0105242_10126109
733 Ga0105248_10222493
734 Ga0105237_10001752
735 Ga0105237_10004863
736 Ga0105237_10011754
737 Ga0105237_10043122
738 Ga0105237_10130315
739 Ga0105238_10002718
740 Ga0105249_10004744
741 Ga0105249_10006626
742 Ga0105249_10031267
743 Ga0105249_10244869
744 Ga0105249_10443082
745 Ga0105239_10000432
746 Ga0105239_10013995
747 Ga0105239_10037142
748 Ga0105239_10058511
749 Ga0105239_10059236
750 Ga0105239_10255092
751 Ga0105239_10347208
752 Ga0105239_10631395
753 Ga0105246_10152787
754 Ga0105246_10201741
755 Ga0157373_10027805
756 Ga0157373_10092545
757 Ga0157373_10116298
758 Ga0157371_10000942
759 Ga0157371_10002496
760 Ga0157371_10018489
761 Ga0157370_10000847
762 Ga0157370_10005645
763 Ga0157370_10030479
764 Ga0157370_10106927
765 Ga0157370_10134729
766 Ga0157370_10216480
767 Ga0157369_10010693
768 Ga0157369_10062946
769 Ga0157369_10470688
770 Ga0157374_10058040
771 Ga0157374_10152126
772 Ga0157378_10016853
773 Ga0157378_10035756
774 Ga0157378_10186844
775 Ga0157378_10268869
776 Ga0163162_10000519
777 Ga0163162_10000953
778 Ga0163162_10008578
779 Ga0163162_10129261
780 Ga0163162_10138826
781 Ga0163162_10191402
782 Ga0163162_10699405
783 Ga0157372_10000029
784 Ga0157372_10007421
785 Ga0157372_10045776
786 Ga0157372_10206281
787 Ga0157372_10233908
788 Ga0157372_10402595
789 Ga0157375_10003254
790 Ga0157375_10008312
791 Ga0157375_10088567
792 Ga0157375_10251848
793 Ga0157375_10482746
794 Ga0163163_10000279
795 Ga0163163_10045276
796 Ga0163163_10565361
797 Ga0157380_10003645
798 Ga0157380_10014350
799 Ga0157377_10001928
800 Ga0157377_10009750
801 Ga0157379_10041094
802 Ga0157379_10261135
803 Ga0157376_10004296
804 Ga0157376_10009061
805 Ga0157376_10012829
806 Ga0157376_10189380
807 Ga0157376_10478543
808 Ga0163161_10002427
809 Ga0163161_10177876
810 Ga0213876_10054110
811 Ga0209050_1012460
812 Ga0207697_10022561
813 Ga0207697_10024802
814 Ga0207656_10011807
815 Ga0207710_10003603
816 Ga0207688_10038458
817 Ga0207680_10000072
818 Ga0207680_10093521
819 Ga0207680_10136447
820 Ga0207680_10192525
821 Ga0207645_10000622
822 Ga0207645_10029639
823 Ga0207705_10087126
824 Ga0207654_10001247
825 Ga0207654_10002604
826 Ga0207707_10001394
827 Ga0207695_10000060
828 Ga0207695_10000425
829 Ga0207695_10004871
830 Ga0207695_10017803
831 Ga0207695_10131495
832 Ga0207671_10000438
833 Ga0207671_10001370
834 Ga0207671_10159664
835 Ga0207660_10037644
836 Ga0207660_10037808
837 Ga0207662_10019717
838 Ga0207662_10028994
839 Ga0207662_10040120
840 Ga0207657_10223291
841 Ga0207652_10000482
842 Ga0207652_10010130
843 Ga0207652_10017413
844 Ga0207681_10011851
845 Ga0207650_10060408
846 Ga0207659_10154048
847 Ga0207659_10373232
848 Ga0207644_10069822
849 Ga0207644_10173067
850 Ga0207706_10060740
851 Ga0207706_10156409
852 Ga0207686_10050708
853 Ga0207670_10024349
854 Ga0207670_10031209
855 Ga0207670_10252511
856 Ga0207669_10041296
857 Ga0207704_10027385
858 Ga0207704_10148909
859 Ga0207691_10012744
860 Ga0207691_10043501
861 Ga0207691_10216193
862 Ga0207689_10000383
863 Ga0207689_10009787
864 Ga0207689_10011548
865 Ga0207689_10018630
866 Ga0207689_10022912
867 Ga0207689_10037486
868 Ga0207689_10039660
869 Ga0207689_10057294
870 Ga0207689_10191190
871 Ga0207689_10208849
872 Ga0207661_10017013
873 Ga0207661_10033245
874 Ga0207661_10092904
875 Ga0207661_10363334
876 Ga0207679_10003138
877 Ga0207679_10150331
878 Ga0207667_10001324
879 Ga0207667_10006621
880 Ga0207667_10035372
881 Ga0207667_10054655
882 Ga0207667_10096030
883 Ga0207667_10447561
884 Ga0207651_10011611
885 Ga0207651_10055046
886 Ga0207651_10175088
887 Ga0207712_10089840
888 Ga0207668_10027267
889 Ga0207668_10253842
890 Ga0207640_10033763
891 Ga0207658_10004378
892 Ga0207677_10043162
893 Ga0207677_10167466
894 Ga0207703_10009492
895 Ga0207703_10427614
896 Ga0207639_10063685
897 Ga0207639_10244512
898 Ga0207639_10306757
899 Ga0207678_10072767
900 Ga0207678_10076146
901 Ga0207641_10000280
902 Ga0207641_10065259
903 Ga0207641_10353000
904 Ga0207641_10391477
905 Ga0207648_10014895
906 Ga0207648_10044852
907 Ga0207648_10079221
908 Ga0207648_10111243
909 Ga0207648_10327521
910 Ga0207648_10450980
911 Ga0207676_10028558
912 Ga0207676_10043738
913 Ga0207676_10064576
914 Ga0207674_10017919
915 Ga0207674_10029358
916 Ga0207674_10039406
917 Ga0207674_10044333
918 Ga0207674_10106194
919 Ga0207674_10130802
920 Ga0207675_100001450
921 Ga0207675_100664408
922 Ga0207683_10001791
923 Ga0207683_10285490
924 Ga0207683_10396396
925 Ga0207698_10001957
926 Ga0207698_10004934
927 Ga0207698_10044573
928 Ga0207698_10049326
929 Ga0207428_10301767
930 Ga0268266_10000016
931 Ga0268265_10019687
932 Ga0268265_10049964
933 Ga0268265_10122004
934 Ga0268264_10000015
935 Ga0268264_10004703
936 Ga0268264_10007504
937 Ga0268264_10009646
938 Ga0268264_10077056
939 Ga0268264_10115537
940 Ga0268264_10352073
941 Ga0307515_10000021
942 Ga0265338_10119048
943 Ga0316177_1175081
944 Ga0316176_1084232
945 Ga0316183_1004801
946 Ga0316183_1119266
947 Ga0316181_1054008
948 Ga0316181_1138860
949 Ga0316182_1328893
950 Ga0265327_10000097
951 Ga0307513_10032711
952 Ga0307509_10088479
953 Ga0307414_10014839
954 Ga0307411_10050859
955 Ga0373934_0008765
956 Ga0373955_0009256
957 Ga0373935_0230393
958 Ga0373927_0166603
959 Ga0373933_0052630
960 Ga0373937_0013853
961 Ga0373925_0136837
962 Ga0395899_0000024
963 Ga0436365_0038471
964 Ga0439431_0001870
965 Ga0439445_0068458
966 Ga0439449_0051261
967 Ga0439457_002323
968 Ga0451577_0043504
969 Ga0466972_0000075
970 Ga0466972_0001391
971 Ga0466972_0003007
972 Ga0453683_0016447
973 Ga0466966_0000167
974 Ga0466961_0040681
975 Ga0466961_0050724
976 Ga0453684_0260636
977 Ga0466971_0072281
978 Ga0466957_0012228
979 Ga0466959_0000003
980 Ga0466959_0016615
981 Ga0451576_0088032
982 Ga0495638_0000005
983 Ga0495638_0239355
984 Ga0495653_0022623
985 Ga0495618_0010411
986 Ga0495628_0012568
987 Ga0495630_0012031
988 Ga0495648_0002202
989 Ga0495586_0186305
990 Ga0495667_0061046
991 Ga0495668_0000310
992 Ga0495668_0008257
993 Ga0495634_0095271
994 Ga0495625_0035075
995 Ga0495625_0235845
996 Ga0495635_0194701
997 Ga0495661_0000305
998 Ga0495657_0120832
999 Ga0495646_0044637
1000 Ga0495600_0049467
1001 Ga0495687_000004
1002 Ga0495684_0021949
1003 Ga0495686_0088094
1004 Ga0496110_0144654
1005 Ga0496115_0002465
1006 Ga0501032_0173668
1007 Ga0501034_0130856
1008 Ga0501034_0451117
1009 Ga0501037_0019649
1010 Ga0501038_0098547
1011 Ga0501039_0038185
1012 Ga0501043_0019817
1013 Ga0501043_0153678
1014 Ga0501047_0006205
1015 Ga0501047_0031404
1016 Ga0501047_0163170
1017 Ga0501257_010457
1018 Ga0501225_0000597
1019 Ga0501080_0233465
1020 Ga0501035_0005968
1021 nmdc:mga05p37_18942_c2
1022 nmdc:mga09592_245344_c1
1023 nmdc:mga08y16_202169_c1
1024 nmdc:mga08y16_211360_c1
1025 nmdc:mga08y16_376002_c1
1026 nmdc:mga0n895_101966_c1
1027 Ga0495619_0131389
1028 Ga0500646_0005754
1029 Ga0500583_0000011
1030 Ga0500583_0019694
1031 Ga0500556_0029456
1032 Ga0500642_0003074
1033 Ga0500573_0117561
1034 Ga0500588_0001617
1035 Ga0500616_0000003
1036 Ga0500622_0000175
1037 Ga0500622_0063648
1038 Ga0500637_0134123
1039 Ga0466962_0021438
1040 2738724894
1041 2833643505
1042 2842906384
1043 2852626672
1044 2884791857
1045 2884793775
1046 2884935103
1047 2896090048
1048 2896111373
1049 2896115205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

239

318

0.97

PF01965

DJ-1_PfpI

DJ-1/PfpI family

32

179

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9527 220 321
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9503 219 321
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9366 219 320
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.923 217 317
1u8b-assembly1.cif.gz_A crystal structure of the methylated n-ada/dna complex 0.9197 218 270
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9536 217 270 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.948 264 320 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 218 320 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9428 269 320 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9366 219 320 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2N5I3E9-F1-model_v4 AraC family transcriptional regulator 0.9749 218 320 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-Q82IY2-F1-model_v4 AraC-family transcriptional regulator 0.9713 218 317 GO:0003700
GO:0043565
AF-A0A239B962-F1-model_v4 Transcriptional regulator, AraC family 0.9628 218 320 GO:0003700
GO:0043565
AF-A0A7X4YMM4-F1-model_v4 Helix-turn-helix domain-containing protein 0.962 217 322 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A7R7EJ50-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9594 217 320 GO:0003700
GO:0043565

Map