F459130

General Info

Members Datasets Scaffolds Average Seq Length
524 232 1048 116

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10203167|Ga0157370_102031672
Length 123
Sequence MNDDKHGQTMSSPGAEITWADFEKIVIAAGTVTRVEAFPEARKPAWKLWVDFGPYGERKTSAQIAALYGAEELVGRQIVGVINFPEKQIGPFRSQFLLTGFATAQGVVITTLERPVPNGTRMT

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
66 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
67 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
225 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
226 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
227 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
228 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
229 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
230 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
231 2928963466 Dyella japonica 1073 Isolate Unclassified
232 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.38
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.36
Nodule 0
Rhizoplane 2.86
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10203167 3300013104 Bacteria 1838
2 JGI24740J21852_10007799 3300001979 Bacteria 4323
3 JGI24739J22299_10000033 3300001989 Bacteria 38389
4 JGI24737J22298_10013123 3300001990 Bacteria 2699
5 JGI24737J22298_10021419 3300001990 Bacteria 2061
6 JGI25156J39149_1051552 3300002705 Bacteria 539
7 JGI25162J39368_1000807 3300002737 Bacteria 20744
8 JGI25162J39368_1001350 3300002737 Bacteria 13599
9 JGI25162J39368_1001755 3300002737 Bacteria 10338
10 JGI25157J39369_1001042 3300002741 Bacteria 12663
11 JGI25157J39369_1001056 3300002741 Bacteria 12500
12 JGI25157J39369_1009836 3300002741 Bacteria 1272
13 JGI25163J39215_1001074 3300002771 Bacteria 5739
14 JGI25164J39214_1000049 3300002772 Bacteria 123464
15 JGI25164J39214_1000313 3300002772 Bacteria 31898
16 JGI25164J39214_1001055 3300002772 Bacteria 8240
17 JGI25165J46597_1000009 3300003214 Bacteria 467965
18 JGI25165J46597_1001249 3300003214 Bacteria 15023
19 JGI25165J46597_1009148 3300003214 Bacteria 1507
20 JGI25165J46597_1016339 3300003214 Bacteria 996
21 JGI25153J46596_10010577 3300003215 Bacteria 4160
22 rootH1_10014550 3300003316 Bacteria 3415
23 rootH2_10125304 3300003320 Bacteria 1685
24 rootH2_10214389 3300003320 Bacteria 2550
25 rootH2_10222491 3300003320 Bacteria 1003
26 rootL2_10244164 3300003322 Bacteria 3422
27 Ga0055538_1001554 3300003751 Bacteria 4223
28 Ga0055539_1008633 3300003752 Bacteria 1273
29 Ga0055533_1001321 3300003756 Bacteria 6722
30 Ga0055527_1000329 3300003760 Bacteria 25482
31 Ga0055527_1012851 3300003760 Bacteria 941
32 Ga0055535_1000082 3300003761 Bacteria 106958
33 Ga0055535_1000621 3300003761 Bacteria 28838
34 Ga0055535_1000709 3300003761 Bacteria 25482
35 Ga0055542_1000151 3300003762 Bacteria 87857
36 Ga0055542_1000732 3300003762 Bacteria 25482
37 Ga0055542_1000882 3300003762 Bacteria 20744
38 Ga0055529_1000020 3300003763 Bacteria 324857
39 Ga0055529_1000643 3300003763 Bacteria 25482
40 Ga0055529_1002129 3300003763 Bacteria 4170
41 Ga0055530_10081420 3300003791 Bacteria 679
42 Ga0055531_10024457 3300003794 Bacteria 2228
43 Ga0065165_1008327 3300005262 Bacteria 4878
44 Ga0070658_10002748 3300005327 Bacteria 14650
45 Ga0070658_10135831 3300005327 Bacteria 2052
46 Ga0070658_10638668 3300005327 Bacteria 923
47 Ga0070683_101492413 3300005329 Bacteria 650
48 Ga0070666_10000003 3300005335 Bacteria 463666
49 Ga0070682_100003242 3300005337 Bacteria 9029
50 Ga0070682_100319903 3300005337 Bacteria 1145
51 Ga0070660_100097823 3300005339 Bacteria 2322
52 Ga0070660_100176126 3300005339 Bacteria 1730
53 Ga0070660_100468098 3300005339 Bacteria 1047
54 Ga0070661_100253535 3300005344 Bacteria 1359
55 Ga0070661_100530397 3300005344 Bacteria 945
56 Ga0070661_101080727 3300005344 Bacteria 668
57 Ga0070692_10100591 3300005345 Bacteria 1584
58 Ga0070668_100058952 3300005347 Bacteria 2971
59 Ga0070668_100084582 3300005347 Bacteria 2492
60 Ga0070668_100393917 3300005347 Unclassified 1181
61 Ga0070669_100277379 3300005353 Bacteria 1342
62 Ga0070671_100128118 3300005355 Bacteria 2137
63 Ga0070659_100004655 3300005366 Bacteria 9798
64 Ga0070659_100025540 3300005366 Bacteria 4539
65 Ga0070659_100218200 3300005366 Bacteria 1573
66 Ga0070659_100628625 3300005366 Bacteria 924
67 Ga0070659_101846942 3300005366 Bacteria 541
68 Ga0070667_100000090 3300005367 Bacteria 112981
69 Ga0070667_100073924 3300005367 Bacteria 2907
70 Ga0070714_100000068 3300005435 Bacteria 94765
71 Ga0070714_100044958 3300005435 Bacteria 3740
72 Ga0070710_10204700 3300005437 Bacteria 1248
73 Ga0070694_100108194 3300005444 Bacteria 1977
74 Ga0070663_100001470 3300005455 Bacteria 12959
75 Ga0070663_100658249 3300005455 Bacteria 886
76 Ga0070662_100234447 3300005457 Bacteria 1469
77 Ga0070662_100592297 3300005457 Bacteria 932
78 Ga0070681_10253313 3300005458 Bacteria 1673
79 Ga0068867_100446701 3300005459 Bacteria 1101
80 Ga0070679_100129545 3300005530 Bacteria 2505
81 Ga0068853_100000795 3300005539 Bacteria 21890
82 Ga0068853_100007996 3300005539 Bacteria 8482
83 Ga0068853_100122239 3300005539 Bacteria 2323
84 Ga0068853_100310484 3300005539 Bacteria 1460
85 Ga0068853_100557827 3300005539 Bacteria 1086
86 Ga0068853_101866436 3300005539 Bacteria 583
87 Ga0068853_102115948 3300005539 Bacteria 546
88 Ga0070696_101008472 3300005546 Bacteria 696
89 Ga0070665_100015364 3300005548 Bacteria 7688
90 Ga0070665_100063376 3300005548 Bacteria 3706
91 Ga0070665_100271289 3300005548 Bacteria 1698
92 Ga0070665_100900187 3300005548 Bacteria 897
93 Ga0070665_101956295 3300005548 Bacteria 592
94 Ga0068855_100006982 3300005563 Bacteria 13708
95 Ga0068855_100010376 3300005563 Bacteria 11238
96 Ga0068855_100035861 3300005563 Bacteria 5906
97 Ga0068855_100482344 3300005563 Bacteria 1349
98 Ga0068855_100534727 3300005563 Bacteria 1270
99 Ga0068855_100904024 3300005563 Bacteria 932
100 Ga0068855_101706820 3300005563 Bacteria 642
101 Ga0070664_100199995 3300005564 Bacteria 1783
102 Ga0068857_100000799 3300005577 Bacteria 23528
103 Ga0068857_100120856 3300005577 Bacteria 2358
104 Ga0068854_100000905 3300005578 Bacteria 17838
105 Ga0068854_100007293 3300005578 Bacteria 7063
106 Ga0068854_100497616 3300005578 Bacteria 1026
107 Ga0068854_100671601 3300005578 Bacteria 891
108 Ga0068856_100001223 3300005614 Bacteria 26898
109 Ga0068856_100038472 3300005614 Bacteria 4696
110 Ga0068856_100282002 3300005614 Bacteria 1678
111 Ga0068852_100068970 3300005616 Bacteria 3097
112 Ga0068851_10001583 3300005834 Bacteria 9986
113 Ga0068863_100439726 3300005841 Bacteria 1279
114 Ga0068858_100104061 3300005842 Bacteria 2649
115 Ga0068860_100393563 3300005843 Bacteria 1370
116 Ga0068860_101161603 3300005843 Bacteria 792
117 Ga0105240_10004700 3300009093 Bacteria 20645
118 Ga0105240_10019619 3300009093 Bacteria 9031
119 Ga0105240_10140729 3300009093 Bacteria 2885
120 Ga0105240_10149436 3300009093 Bacteria 2784
121 Ga0105241_10040077 3300009174 Bacteria 3535
122 Ga0105241_10941961 3300009174 Bacteria 804
123 Ga0105248_10074223 3300009177 Bacteria 3823
124 Ga0105248_10150983 3300009177 Bacteria 2621
125 Ga0105248_11409479 3300009177 Bacteria 788
126 Ga0105237_10000016 3300009545 Bacteria 256506
127 Ga0105237_10000345 3300009545 Bacteria 65477
128 Ga0105237_10000371 3300009545 Bacteria 63699
129 Ga0105237_10169593 3300009545 Bacteria 2182
130 Ga0105237_10392862 3300009545 Bacteria 1392
131 Ga0105238_10001660 3300009551 Bacteria 22345
132 Ga0105238_10009092 3300009551 Bacteria 9943
133 Ga0105238_10035682 3300009551 Bacteria 5054
134 Ga0105238_10113504 3300009551 Bacteria 2689
135 Ga0105238_10309338 3300009551 Bacteria 1565
136 Ga0105238_10531907 3300009551 Bacteria 1179
137 Ga0105238_10593886 3300009551 Bacteria 1115
138 Ga0105238_11968598 3300009551 Bacteria 618
139 Ga0105249_10003742 3300009553 Bacteria 13128
140 Ga0105239_10000063 3300010375 Bacteria 151845
141 Ga0105239_10121167 3300010375 Bacteria 2905
142 Ga0105239_10195692 3300010375 Bacteria 2264
143 Ga0105239_10706102 3300010375 Bacteria 1153
144 Ga0105239_12197853 3300010375 Bacteria 642
145 Ga0157314_1000404 3300012500 Bacteria 4355
146 Ga0157347_1006181 3300012502 Bacteria 1166
147 Ga0157339_1056366 3300012505 Bacteria 534
148 Ga0157373_10023464 3300013100 Bacteria 4472
149 Ga0157373_10103511 3300013100 Bacteria 2002
150 Ga0157373_10471023 3300013100 Bacteria 905
151 Ga0157371_10078870 3300013102 Bacteria 2333
152 Ga0157371_10081064 3300013102 Bacteria 2298
153 Ga0157370_10007514 3300013104 Bacteria 11841
154 Ga0157370_10018266 3300013104 Bacteria 7053
155 Ga0157370_10062160 3300013104 Bacteria 3542
156 Ga0157370_10200144 3300013104 Bacteria 1853
157 Ga0157370_10427079 3300013104 Unclassified 1219
158 Ga0157370_10448563 3300013104 Bacteria 1186
159 Ga0157369_10014122 3300013105 Bacteria 9027
160 Ga0157369_10122787 3300013105 Bacteria 2755
161 Ga0157369_10640360 3300013105 Bacteria 1097
162 Ga0157369_10678711 3300013105 Bacteria 1061
163 Ga0157369_10726832 3300013105 Bacteria 1022
164 Ga0163162_10000532 3300013306 Bacteria 35291
165 Ga0157372_10538647 3300013307 Bacteria 1361
166 Ga0157372_11015924 3300013307 Bacteria 960
167 Ga0157372_11336230 3300013307 Bacteria 827
168 Ga0157372_11705253 3300013307 Bacteria 725
169 Ga0157372_12017477 3300013307 Bacteria 663
170 Ga0182008_10023932 3300014497 Bacteria 3113
171 Ga0182008_10088317 3300014497 Bacteria 1527
172 Ga0182008_10213764 3300014497 Bacteria 985
173 Ga0182006_1008631 3300015261 Bacteria 4616
174 Ga0182007_10008724 3300015262 Bacteria 4140
175 Ga0182007_10009117 3300015262 Bacteria 4032
176 Ga0182007_10040931 3300015262 Bacteria 1546
177 Ga0182007_10114430 3300015262 Bacteria 900
178 Ga0182007_10198418 3300015262 Bacteria 700
179 Ga0183368_1004 3300015687 Bacteria 1211761
180 Ga0206356_11568625 3300020070 Bacteria 3873
181 Ga0206353_11584667 3300020082 Bacteria 3657
182 Ga0209435_101084 3300025206 Bacteria 3777
183 Ga0209760_100481 3300025207 Bacteria 8558
184 Ga0209784_100013 3300025224 Bacteria 518664
185 Ga0209674_100026 3300025226 Bacteria 490631
186 Ga0209674_100062 3300025226 Bacteria 276316
187 Ga0209672_100017 3300025228 Bacteria 514236
188 Ga0209672_101880 3300025228 Bacteria 6177
189 Ga0207427_100073 3300025231 Bacteria 156503
190 Ga0207427_100229 3300025231 Bacteria 47034
191 Ga0207427_100396 3300025231 Bacteria 25810
192 Ga0209437_100012 3300025233 Bacteria 792625
193 Ga0209437_100039 3300025233 Bacteria 448321
194 Ga0209437_100129 3300025233 Bacteria 184661
195 Ga0209258_100019 3300025242 Bacteria 566728
196 Ga0209258_100213 3300025242 Bacteria 115394
197 Ga0209258_100272 3300025242 Bacteria 88382
198 Ga0209258_101145 3300025242 Bacteria 10883
199 Ga0209646_1000735 3300025246 Bacteria 11511
200 Ga0209646_1002693 3300025246 Bacteria 3804
201 Ga0209026_1000125 3300025250 Bacteria 124729
202 Ga0209026_1000207 3300025250 Bacteria 81332
203 Ga0209677_101574 3300025253 Bacteria 9683
204 Ga0209148_1000001 3300025254 Bacteria 2545271
205 Ga0209148_1000009 3300025254 Bacteria 1395625
206 Ga0209148_1000185 3300025254 Bacteria 118117
207 Ga0209759_1000595 3300025256 Bacteria 35053
208 Ga0209759_1003876 3300025256 Bacteria 5779
209 Ga0209129_1002584 3300025258 Bacteria 8697
210 Ga0209233_1000002 3300025261 Bacteria 2501366
211 Ga0209233_1000020 3300025261 Bacteria 798224
212 Ga0209233_1000090 3300025261 Bacteria 315680
213 Ga0209233_1022045 3300025261 Bacteria 1637
214 Ga0209455_1000027 3300025272 Bacteria 566710
215 Ga0209455_1000032 3300025272 Bacteria 514243
216 Ga0209455_1000535 3300025272 Bacteria 26363
217 Ga0209455_1003416 3300025272 Bacteria 5626
218 Ga0209758_1001236 3300025297 Bacteria 31915
219 Ga0209758_1015642 3300025297 Bacteria 3913
220 Ga0209050_1038478 3300025298 Bacteria 1363
221 Ga0209051_1023642 3300025303 Bacteria 2549
222 Ga0209257_1000179 3300025304 Bacteria 158484
223 Ga0207656_10001923 3300025321 Bacteria 6910
224 Ga0207692_10726804 3300025898 Bacteria 646
225 Ga0207680_10000006 3300025903 Bacteria 635950
226 Ga0207680_10933683 3300025903 Bacteria 622
227 Ga0207647_10002923 3300025904 Bacteria 12866
228 Ga0207647_10025409 3300025904 Bacteria 3892
229 Ga0207647_10052653 3300025904 Bacteria 2512
230 Ga0207647_10054149 3300025904 Bacteria 2469
231 Ga0207705_10004426 3300025909 Bacteria 10619
232 Ga0207705_10170764 3300025909 Bacteria 1637
233 Ga0207705_10299090 3300025909 Bacteria 1234
234 Ga0207654_10049669 3300025911 Bacteria 2407
235 Ga0207654_10383024 3300025911 Bacteria 974
236 Ga0207707_10233465 3300025912 Bacteria 1600
237 Ga0207695_10000405 3300025913 Bacteria 96061
238 Ga0207695_10000493 3300025913 Bacteria 84173
239 Ga0207695_10002440 3300025913 Bacteria 27479
240 Ga0207695_10005605 3300025913 Bacteria 16583
241 Ga0207695_10114722 3300025913 Bacteria 2668
242 Ga0207671_10000137 3300025914 Bacteria 112029
243 Ga0207671_10000490 3300025914 Bacteria 53783
244 Ga0207671_10001184 3300025914 Bacteria 31016
245 Ga0207671_10047325 3300025914 Bacteria 3183
246 Ga0207671_10589551 3300025914 Bacteria 886
247 Ga0207657_10070116 3300025919 Bacteria 2972
248 Ga0207657_10714954 3300025919 Bacteria 777
249 Ga0207649_10132794 3300025920 Bacteria 1693
250 Ga0207649_10385391 3300025920 Bacteria 1046
251 Ga0207652_10825962 3300025921 Bacteria 822
252 Ga0207694_10000438 3300025924 Bacteria 38673
253 Ga0207694_10050013 3300025924 Bacteria 3236
254 Ga0207694_10131526 3300025924 Bacteria 2006
255 Ga0207694_10201754 3300025924 Bacteria 1618
256 Ga0207664_10000056 3300025929 Bacteria 125763
257 Ga0207664_10004243 3300025929 Bacteria 9692
258 Ga0207644_10743333 3300025931 Bacteria 819
259 Ga0207690_10001320 3300025932 Bacteria 15606
260 Ga0207690_10072858 3300025932 Bacteria 2373
261 Ga0207690_10136541 3300025932 Bacteria 1801
262 Ga0207690_10530352 3300025932 Bacteria 955
263 Ga0207690_10805869 3300025932 Bacteria 776
264 Ga0207706_10066673 3300025933 Bacteria 3168
265 Ga0207706_10128099 3300025933 Bacteria 2232
266 Ga0207711_10001221 3300025941 Bacteria 24350
267 Ga0207711_10087318 3300025941 Bacteria 2736
268 Ga0207661_11249758 3300025944 Bacteria 683
269 Ga0207679_10249687 3300025945 Bacteria 1508
270 Ga0207667_10001885 3300025949 Bacteria 26382
271 Ga0207667_10002174 3300025949 Bacteria 24585
272 Ga0207667_10033011 3300025949 Bacteria 5570
273 Ga0207667_10046572 3300025949 Bacteria 4592
274 Ga0207667_10053720 3300025949 Bacteria 4238
275 Ga0207667_10143554 3300025949 Bacteria 2457
276 Ga0207667_10619864 3300025949 Bacteria 1090
277 Ga0207667_10836558 3300025949 Bacteria 915
278 Ga0207712_10004404 3300025961 Bacteria 8901
279 Ga0207668_10001027 3300025972 Bacteria 16669
280 Ga0207668_10233282 3300025972 Unclassified 1485
281 Ga0207640_10000408 3300025981 Bacteria 27247
282 Ga0207640_10017160 3300025981 Bacteria 4229
283 Ga0207640_10095783 3300025981 Bacteria 2068
284 Ga0207640_10154610 3300025981 Bacteria 1689
285 Ga0207640_10643045 3300025981 Bacteria 903
286 Ga0207658_10000111 3300025986 Bacteria 89180
287 Ga0207658_10338296 3300025986 Bacteria 1307
288 Ga0207658_11636910 3300025986 Bacteria 588
289 Ga0207703_10190969 3300026035 Bacteria 1814
290 Ga0207703_10927014 3300026035 Bacteria 834
291 Ga0207639_10070671 3300026041 Bacteria 2727
292 Ga0207639_10081698 3300026041 Bacteria 2560
293 Ga0207639_10445954 3300026041 Bacteria 1174
294 Ga0207639_10801587 3300026041 Bacteria 878
295 Ga0207639_10901975 3300026041 Bacteria 826
296 Ga0207678_10004034 3300026067 Bacteria 13211
297 Ga0207678_10006781 3300026067 Bacteria 10151
298 Ga0207678_10036117 3300026067 Bacteria 4301
299 Ga0207702_10000104 3300026078 Bacteria 98370
300 Ga0207702_10001817 3300026078 Bacteria 21006
301 Ga0207702_10270493 3300026078 Bacteria 1603
302 Ga0207702_11643926 3300026078 Bacteria 635
303 Ga0207641_10723968 3300026088 Bacteria 981
304 Ga0207674_10000818 3300026116 Bacteria 40463
305 Ga0207674_10021120 3300026116 Bacteria 7019
306 Ga0207674_11228141 3300026116 Bacteria 719
307 Ga0207698_10300123 3300026142 Bacteria 1495
308 Ga0268266_10000043 3300028379 Bacteria 316604
309 Ga0268266_10499300 3300028379 Bacteria 1161
310 Ga0268265_10057018 3300028380 Bacteria 2975
311 Ga0268264_11087416 3300028381 Bacteria 808
312 Ga0316575_10038066 3300031665 Bacteria 1896
313 Ga0307510_10081293 3300033180 Bacteria 3142
314 Ga0307510_10131138 3300033180 Bacteria 2179
315 Ga0395899_0000169 3300037312 Bacteria 100056
316 Ga0395899_0013443 3300037312 Bacteria 6262
317 Ga0395900_0000069 3300037418 Bacteria 190578
318 Ga0395900_0727778 3300037418 Bacteria 924
319 Ga0395900_1903390 3300037418 Bacteria 505
320 Ga0395898_0000097 3300037466 Bacteria 230579
321 Ga0395898_0001110 3300037466 Bacteria 41435
322 Ga0395901_0006786 3300038443 Bacteria 11563
323 Ga0395901_0165305 3300038443 Bacteria 2323
324 Ga0395901_0426482 3300038443 Bacteria 1359
325 Ga0395901_1577098 3300038443 Bacteria 610
326 Ga0451787_564197 3300041441 Bacteria 1050
327 Ga0451789_0550781 3300041443 Bacteria 530
328 Ga0451797_0108775 3300041453 Bacteria 1909
329 Ga0451798_0155906 3300041458 Bacteria 617
330 Ga0451798_0969286 3300041458 Bacteria 511
331 Ga0451800_0435905 3300041459 Bacteria 712
332 Ga0451807_1077082 3300041486 Bacteria 1631
333 Ga0451837_1232363 3300041494 Bacteria 512
334 Ga0451837_1258977 3300041494 Bacteria 1301
335 Ga0451837_1622034 3300041494 Bacteria 1736
336 Ga0451841_1204303 3300041498 Bacteria 761
337 Ga0439448_0048718 3300042005 Bacteria 1384
338 Ga0439448_0180373 3300042005 Bacteria 738
339 Ga0466969_0010009 3300044656 Bacteria 5028
340 Ga0466969_0015993 3300044656 Bacteria 3931
341 Ga0466969_0027761 3300044656 Bacteria 2897
342 Ga0466969_0125910 3300044656 Bacteria 1190
343 Ga0466972_0031219 3300044658 Bacteria 2621
344 Ga0466972_0435337 3300044658 Bacteria 615
345 Ga0466982_0000002 3300044672 Bacteria 454900
346 Ga0466965_0016024 3300044683 Bacteria 3561
347 Ga0466966_0002617 3300044684 Bacteria 11792
348 Ga0466966_0025957 3300044684 Bacteria 3826
349 Ga0466966_0074862 3300044684 Bacteria 2115
350 Ga0466966_0148684 3300044684 Bacteria 1429
351 Ga0466961_0001299 3300044693 Bacteria 15419
352 Ga0466961_0003971 3300044693 Bacteria 9254
353 Ga0466961_0007582 3300044693 Bacteria 6910
354 Ga0466964_0006645 3300044706 Bacteria 4310
355 Ga0466971_0022289 3300044719 Bacteria 2821
356 Ga0466968_0135008 3300044735 Bacteria 1125
357 Ga0466970_0009863 3300044765 Bacteria 4836
358 Ga0466970_0025468 3300044765 Bacteria 3097
359 Ga0466970_0576436 3300044765 Bacteria 651
360 Ga0466957_0005568 3300044842 Bacteria 7077
361 Ga0466960_0002860 3300044901 Bacteria 6541
362 Ga0466959_0000198 3300045049 Bacteria 39567
363 Ga0466959_0062727 3300045049 Bacteria 2700
364 Ga0466959_0196778 3300045049 Bacteria 1404
365 Ga0466959_0220648 3300045049 Bacteria 1315
366 Ga0466959_0330022 3300045049 Bacteria 1042
367 Ga0466958_0004503 3300045836 Bacteria 7363
368 Ga0466958_0006900 3300045836 Bacteria 6210
369 Ga0466958_0044615 3300045836 Bacteria 2672
370 Ga0466967_0178341 3300045976 Bacteria 2002
371 Ga0495650_0000353 3300046471 Bacteria 81130
372 Ga0495650_0029678 3300046471 Bacteria 2489
373 Ga0495650_0110694 3300046471 Bacteria 1020
374 Ga0495584_0002455 3300046491 Bacteria 10510
375 Ga0495585_0016140 3300046492 Bacteria 4328
376 Ga0495606_0000937 3300046507 Bacteria 42986
377 Ga0495606_0017318 3300046507 Bacteria 5453
378 Ga0495616_0000085 3300046513 Bacteria 79620
379 Ga0495683_0012969 3300047323 Bacteria 4367
380 Ga0495686_0003987 3300047472 Bacteria 12356
381 Ga0495686_0016589 3300047472 Bacteria 4992
382 Ga0496100_0075174 3300048903 Bacteria 2265
383 Ga0496101_0134473 3300048904 Bacteria 1880
384 Ga0496104_0320610 3300048907 Bacteria 1462
385 Ga0496105_0375403 3300048908 Bacteria 1132
386 Ga0496113_0525903 3300048916 Bacteria 949
387 Ga0496113_0612012 3300048916 Bacteria 872
388 Ga0496115_0000505 3300048918 Bacteria 30593
389 Ga0496115_0040871 3300048918 Bacteria 3688
390 Ga0496117_0007917 3300048920 Bacteria 10212
391 Ga0496117_0043569 3300048920 Bacteria 3261
392 Ga0496117_0056002 3300048920 Bacteria 2750
393 Ga0496117_0122736 3300048920 Bacteria 1592
394 Ga0496118_0000677 3300048921 Bacteria 55423
395 Ga0496118_0001754 3300048921 Bacteria 31454
396 Ga0496118_0009342 3300048921 Bacteria 9935
397 Ga0496118_0016257 3300048921 Bacteria 6834
398 Ga0496118_0630851 3300048921 Bacteria 507
399 Ga0496119_0000184 3300048922 Bacteria 87765
400 Ga0496120_0000719 3300048923 Bacteria 48509
401 Ga0496121_0006838 3300048924 Bacteria 13949
402 Ga0496121_0009095 3300048924 Bacteria 11496
403 Ga0496121_0121849 3300048924 Bacteria 1968
404 Ga0496121_0184807 3300048924 Bacteria 1500
405 Ga0496121_0243495 3300048924 Bacteria 1251
406 Ga0496121_0580195 3300048924 Bacteria 696
407 Ga0496122_0000129 3300048925 Bacteria 173688
408 Ga0496123_0000113 3300048926 Bacteria 163689
409 Ga0496125_0000479 3300048928 Bacteria 70840
410 Ga0496125_0445116 3300048928 Bacteria 744
411 Ga0496126_0005763 3300048929 Bacteria 14010
412 Ga0496126_0084867 3300048929 Bacteria 2793
413 Ga0496126_0141634 3300048929 Bacteria 2069
414 Ga0496126_0436172 3300048929 Bacteria 1057
415 Ga0501031_0017717 3300049568 Bacteria 4631
416 Ga0501031_0038579 3300049568 Bacteria 3117
417 Ga0501031_0888014 3300049568 Bacteria 571
418 Ga0501032_0008569 3300049569 Bacteria 7456
419 Ga0501032_0023594 3300049569 Bacteria 4246
420 Ga0501032_0050822 3300049569 Bacteria 2795
421 Ga0501032_0096231 3300049569 Bacteria 1962
422 Ga0501033_0002102 3300049570 Bacteria 17249
423 Ga0501033_0011309 3300049570 Bacteria 6833
424 Ga0501033_0223467 3300049570 Bacteria 1339
425 Ga0501033_0574945 3300049570 Bacteria 774
426 Ga0501033_0764583 3300049570 Bacteria 655
427 Ga0501034_0000996 3300049571 Bacteria 40586
428 Ga0501034_0007828 3300049571 Bacteria 11365
429 Ga0501034_0049233 3300049571 Bacteria 4252
430 Ga0501034_0129136 3300049571 Bacteria 2511
431 Ga0501036_0019131 3300049572 Bacteria 5745
432 Ga0501036_0163002 3300049572 Bacteria 1879
433 Ga0501036_1359202 3300049572 Bacteria 576
434 Ga0501037_0004446 3300049573 Bacteria 10181
435 Ga0501037_0007587 3300049573 Bacteria 7941
436 Ga0501037_0029753 3300049573 Bacteria 4034
437 Ga0501038_0001697 3300049574 Bacteria 20435
438 Ga0501038_0050881 3300049574 Bacteria 3578
439 Ga0501038_0150103 3300049574 Bacteria 1900
440 Ga0501038_0277764 3300049574 Bacteria 1319
441 Ga0501039_0010391 3300049575 Bacteria 7095
442 Ga0501039_0012497 3300049575 Bacteria 6484
443 Ga0501039_0056275 3300049575 Bacteria 3046
444 Ga0501040_0037069 3300049576 Bacteria 3311
445 Ga0501043_0001923 3300049579 Bacteria 17777
446 Ga0501043_0036413 3300049579 Bacteria 3871
447 Ga0501043_0225476 3300049579 Bacteria 1448
448 Ga0501046_0000711 3300049580 Bacteria 32113
449 Ga0501046_0008834 3300049580 Bacteria 8752
450 Ga0501046_0021868 3300049580 Bacteria 5272
451 Ga0501046_0024525 3300049580 Bacteria 4945
452 Ga0501046_0191696 3300049580 Bacteria 1524
453 Ga0501047_0044957 3300049581 Bacteria 4268
454 Ga0501047_0094860 3300049581 Bacteria 2862
455 Ga0501047_0204447 3300049581 Bacteria 1834
456 Ga0501047_0272623 3300049581 Bacteria 1538
457 Ga0501047_0710652 3300049581 Bacteria 822
458 Ga0501047_1234180 3300049581 Bacteria 561
459 Ga0501048_0038677 3300049582 Bacteria 3423
460 Ga0501048_0127233 3300049582 Bacteria 1801
461 Ga0501048_0569096 3300049582 Bacteria 813
462 Ga0501067_0010924 3300049583 Bacteria 5026
463 Ga0501068_0028147 3300049584 Bacteria 3321
464 Ga0501069_0108078 3300049585 Bacteria 1582
465 Ga0501069_0225534 3300049585 Bacteria 1090
466 Ga0501070_0039815 3300049586 Bacteria 3919
467 Ga0501070_0122133 3300049586 Bacteria 2152
468 Ga0501070_0456302 3300049586 Bacteria 1030
469 Ga0501070_1220463 3300049586 Unclassified 576
470 Ga0501072_0144392 3300049588 Bacteria 1898
471 Ga0501072_0293085 3300049588 Bacteria 1293
472 Ga0501073_0029339 3300049589 Bacteria 3931
473 Ga0501073_0083776 3300049589 Bacteria 2218
474 Ga0501074_0008690 3300049590 Bacteria 7360
475 Ga0501074_0061280 3300049590 Bacteria 2710
476 Ga0501076_0422386 3300049592 Bacteria 1097
477 Ga0501079_0084719 3300049741 Bacteria 2452
478 Ga0501080_0046617 3300049742 Bacteria 4034
479 Ga0501080_0111924 3300049742 Bacteria 2530
480 Ga0501080_0114548 3300049742 Bacteria 2500
481 Ga0501080_0427326 3300049742 Bacteria 1189
482 Ga0501080_0678103 3300049742 Bacteria 910
483 Ga0501080_1758258 3300049742 Bacteria 522
484 Ga0501081_0035222 3300049743 Bacteria 3407
485 Ga0501083_0208989 3300049744 Bacteria 1273
486 Ga0501083_0607486 3300049744 Bacteria 712
487 Ga0501035_0005012 3300049822 Bacteria 12540
488 Ga0501035_0005378 3300049822 Bacteria 12108
489 Ga0501035_0023870 3300049822 Bacteria 5611
490 Ga0501035_0037869 3300049822 Bacteria 4365
491 Ga0501035_0598420 3300049822 Bacteria 899
492 Ga0501044_0005271 3300049823 Bacteria 14380
493 Ga0501044_0006764 3300049823 Bacteria 12636
494 Ga0501044_0039474 3300049823 Bacteria 4925
495 Ga0501044_0040398 3300049823 Bacteria 4861
496 Ga0501044_0204017 3300049823 Bacteria 1934
497 Ga0501044_0240740 3300049823 Bacteria 1753
498 Ga0501044_0794008 3300049823 Bacteria 826
499 Ga0501044_0899289 3300049823 Bacteria 760
500 Ga0501044_1198637 3300049823 Bacteria 627
501 Ga0501045_0083512 3300049824 Bacteria 2356
502 Ga0500646_0019194 3300053090 Bacteria 1807
503 Ga0500651_0000070 3300053093 Bacteria 67252
504 Ga0500651_0007394 3300053093 Bacteria 6414
505 Ga0500597_000038 3300053120 Bacteria 26399
506 Ga0500568_0001067 3300053139 Bacteria 18606
507 Ga0500638_068598 3300053162 Bacteria 1697
508 Ga0501084_0315907 3300054114 Bacteria 1319
509 Ga0501084_1281996 3300054114 Unclassified 614
510 Ga0500661_000953 3300055283 Bacteria 5412
511 Ga0501082_0081779 3300060353 Bacteria 2787
512 Ga0501082_0300596 3300060353 Bacteria 1397
513 Ga0466962_0002198 3300061719 Bacteria 9225
514 Ga0466962_0053717 3300061719 Bacteria 1925
515 Ga0530510_0451399 3300061734 Bacteria 972
516 2643894387 2643221577 Bacteria 3710843
517 2644476591 2643221685 Bacteria 3673288
518 2687583239 2687453130 Bacteria 4227172
519 2819565145 2818991440 Bacteria 4774720
520 2842784391 2842780639 Bacteria 4337790
521 2895395713 2895395659 Bacteria 3983269
522 2904466813 2904463128 Bacteria 4775606
523 2928967530 2928963466 Bacteria 5165703
524 2939612015 2939611941 Bacteria 3892017
525 Ga0157370_10203167
526 JGI24740J21852_10007799
527 JGI24739J22299_10000033
528 JGI24737J22298_10013123
529 JGI24737J22298_10021419
530 JGI25156J39149_1051552
531 JGI25162J39368_1000807
532 JGI25162J39368_1001350
533 JGI25162J39368_1001755
534 JGI25157J39369_1001042
535 JGI25157J39369_1001056
536 JGI25157J39369_1009836
537 JGI25163J39215_1001074
538 JGI25164J39214_1000049
539 JGI25164J39214_1000313
540 JGI25164J39214_1001055
541 JGI25165J46597_1000009
542 JGI25165J46597_1001249
543 JGI25165J46597_1009148
544 JGI25165J46597_1016339
545 JGI25153J46596_10010577
546 rootH1_10014550
547 rootH2_10125304
548 rootH2_10214389
549 rootH2_10222491
550 rootL2_10244164
551 Ga0055538_1001554
552 Ga0055539_1008633
553 Ga0055533_1001321
554 Ga0055527_1000329
555 Ga0055527_1012851
556 Ga0055535_1000082
557 Ga0055535_1000621
558 Ga0055535_1000709
559 Ga0055542_1000151
560 Ga0055542_1000732
561 Ga0055542_1000882
562 Ga0055529_1000020
563 Ga0055529_1000643
564 Ga0055529_1002129
565 Ga0055530_10081420
566 Ga0055531_10024457
567 Ga0065165_1008327
568 Ga0070658_10002748
569 Ga0070658_10135831
570 Ga0070658_10638668
571 Ga0070683_101492413
572 Ga0070666_10000003
573 Ga0070682_100003242
574 Ga0070682_100319903
575 Ga0070660_100097823
576 Ga0070660_100176126
577 Ga0070660_100468098
578 Ga0070661_100253535
579 Ga0070661_100530397
580 Ga0070661_101080727
581 Ga0070692_10100591
582 Ga0070668_100058952
583 Ga0070668_100084582
584 Ga0070668_100393917
585 Ga0070669_100277379
586 Ga0070671_100128118
587 Ga0070659_100004655
588 Ga0070659_100025540
589 Ga0070659_100218200
590 Ga0070659_100628625
591 Ga0070659_101846942
592 Ga0070667_100000090
593 Ga0070667_100073924
594 Ga0070714_100000068
595 Ga0070714_100044958
596 Ga0070710_10204700
597 Ga0070694_100108194
598 Ga0070663_100001470
599 Ga0070663_100658249
600 Ga0070662_100234447
601 Ga0070662_100592297
602 Ga0070681_10253313
603 Ga0068867_100446701
604 Ga0070679_100129545
605 Ga0068853_100000795
606 Ga0068853_100007996
607 Ga0068853_100122239
608 Ga0068853_100310484
609 Ga0068853_100557827
610 Ga0068853_101866436
611 Ga0068853_102115948
612 Ga0070696_101008472
613 Ga0070665_100015364
614 Ga0070665_100063376
615 Ga0070665_100271289
616 Ga0070665_100900187
617 Ga0070665_101956295
618 Ga0068855_100006982
619 Ga0068855_100010376
620 Ga0068855_100035861
621 Ga0068855_100482344
622 Ga0068855_100534727
623 Ga0068855_100904024
624 Ga0068855_101706820
625 Ga0070664_100199995
626 Ga0068857_100000799
627 Ga0068857_100120856
628 Ga0068854_100000905
629 Ga0068854_100007293
630 Ga0068854_100497616
631 Ga0068854_100671601
632 Ga0068856_100001223
633 Ga0068856_100038472
634 Ga0068856_100282002
635 Ga0068852_100068970
636 Ga0068851_10001583
637 Ga0068863_100439726
638 Ga0068858_100104061
639 Ga0068860_100393563
640 Ga0068860_101161603
641 Ga0105240_10004700
642 Ga0105240_10019619
643 Ga0105240_10140729
644 Ga0105240_10149436
645 Ga0105241_10040077
646 Ga0105241_10941961
647 Ga0105248_10074223
648 Ga0105248_10150983
649 Ga0105248_11409479
650 Ga0105237_10000016
651 Ga0105237_10000345
652 Ga0105237_10000371
653 Ga0105237_10169593
654 Ga0105237_10392862
655 Ga0105238_10001660
656 Ga0105238_10009092
657 Ga0105238_10035682
658 Ga0105238_10113504
659 Ga0105238_10309338
660 Ga0105238_10531907
661 Ga0105238_10593886
662 Ga0105238_11968598
663 Ga0105249_10003742
664 Ga0105239_10000063
665 Ga0105239_10121167
666 Ga0105239_10195692
667 Ga0105239_10706102
668 Ga0105239_12197853
669 Ga0157314_1000404
670 Ga0157347_1006181
671 Ga0157339_1056366
672 Ga0157373_10023464
673 Ga0157373_10103511
674 Ga0157373_10471023
675 Ga0157371_10078870
676 Ga0157371_10081064
677 Ga0157370_10007514
678 Ga0157370_10018266
679 Ga0157370_10062160
680 Ga0157370_10200144
681 Ga0157370_10427079
682 Ga0157370_10448563
683 Ga0157369_10014122
684 Ga0157369_10122787
685 Ga0157369_10640360
686 Ga0157369_10678711
687 Ga0157369_10726832
688 Ga0163162_10000532
689 Ga0157372_10538647
690 Ga0157372_11015924
691 Ga0157372_11336230
692 Ga0157372_11705253
693 Ga0157372_12017477
694 Ga0182008_10023932
695 Ga0182008_10088317
696 Ga0182008_10213764
697 Ga0182006_1008631
698 Ga0182007_10008724
699 Ga0182007_10009117
700 Ga0182007_10040931
701 Ga0182007_10114430
702 Ga0182007_10198418
703 Ga0183368_1004
704 Ga0206356_11568625
705 Ga0206353_11584667
706 Ga0209435_101084
707 Ga0209760_100481
708 Ga0209784_100013
709 Ga0209674_100026
710 Ga0209674_100062
711 Ga0209672_100017
712 Ga0209672_101880
713 Ga0207427_100073
714 Ga0207427_100229
715 Ga0207427_100396
716 Ga0209437_100012
717 Ga0209437_100039
718 Ga0209437_100129
719 Ga0209258_100019
720 Ga0209258_100213
721 Ga0209258_100272
722 Ga0209258_101145
723 Ga0209646_1000735
724 Ga0209646_1002693
725 Ga0209026_1000125
726 Ga0209026_1000207
727 Ga0209677_101574
728 Ga0209148_1000001
729 Ga0209148_1000009
730 Ga0209148_1000185
731 Ga0209759_1000595
732 Ga0209759_1003876
733 Ga0209129_1002584
734 Ga0209233_1000002
735 Ga0209233_1000020
736 Ga0209233_1000090
737 Ga0209233_1022045
738 Ga0209455_1000027
739 Ga0209455_1000032
740 Ga0209455_1000535
741 Ga0209455_1003416
742 Ga0209758_1001236
743 Ga0209758_1015642
744 Ga0209050_1038478
745 Ga0209051_1023642
746 Ga0209257_1000179
747 Ga0207656_10001923
748 Ga0207692_10726804
749 Ga0207680_10000006
750 Ga0207680_10933683
751 Ga0207647_10002923
752 Ga0207647_10025409
753 Ga0207647_10052653
754 Ga0207647_10054149
755 Ga0207705_10004426
756 Ga0207705_10170764
757 Ga0207705_10299090
758 Ga0207654_10049669
759 Ga0207654_10383024
760 Ga0207707_10233465
761 Ga0207695_10000405
762 Ga0207695_10000493
763 Ga0207695_10002440
764 Ga0207695_10005605
765 Ga0207695_10114722
766 Ga0207671_10000137
767 Ga0207671_10000490
768 Ga0207671_10001184
769 Ga0207671_10047325
770 Ga0207671_10589551
771 Ga0207657_10070116
772 Ga0207657_10714954
773 Ga0207649_10132794
774 Ga0207649_10385391
775 Ga0207652_10825962
776 Ga0207694_10000438
777 Ga0207694_10050013
778 Ga0207694_10131526
779 Ga0207694_10201754
780 Ga0207664_10000056
781 Ga0207664_10004243
782 Ga0207644_10743333
783 Ga0207690_10001320
784 Ga0207690_10072858
785 Ga0207690_10136541
786 Ga0207690_10530352
787 Ga0207690_10805869
788 Ga0207706_10066673
789 Ga0207706_10128099
790 Ga0207711_10001221
791 Ga0207711_10087318
792 Ga0207661_11249758
793 Ga0207679_10249687
794 Ga0207667_10001885
795 Ga0207667_10002174
796 Ga0207667_10033011
797 Ga0207667_10046572
798 Ga0207667_10053720
799 Ga0207667_10143554
800 Ga0207667_10619864
801 Ga0207667_10836558
802 Ga0207712_10004404
803 Ga0207668_10001027
804 Ga0207668_10233282
805 Ga0207640_10000408
806 Ga0207640_10017160
807 Ga0207640_10095783
808 Ga0207640_10154610
809 Ga0207640_10643045
810 Ga0207658_10000111
811 Ga0207658_10338296
812 Ga0207658_11636910
813 Ga0207703_10190969
814 Ga0207703_10927014
815 Ga0207639_10070671
816 Ga0207639_10081698
817 Ga0207639_10445954
818 Ga0207639_10801587
819 Ga0207639_10901975
820 Ga0207678_10004034
821 Ga0207678_10006781
822 Ga0207678_10036117
823 Ga0207702_10000104
824 Ga0207702_10001817
825 Ga0207702_10270493
826 Ga0207702_11643926
827 Ga0207641_10723968
828 Ga0207674_10000818
829 Ga0207674_10021120
830 Ga0207674_11228141
831 Ga0207698_10300123
832 Ga0268266_10000043
833 Ga0268266_10499300
834 Ga0268265_10057018
835 Ga0268264_11087416
836 Ga0316575_10038066
837 Ga0307510_10081293
838 Ga0307510_10131138
839 Ga0395899_0000169
840 Ga0395899_0013443
841 Ga0395900_0000069
842 Ga0395900_0727778
843 Ga0395900_1903390
844 Ga0395898_0000097
845 Ga0395898_0001110
846 Ga0395901_0006786
847 Ga0395901_0165305
848 Ga0395901_0426482
849 Ga0395901_1577098
850 Ga0451787_564197
851 Ga0451789_0550781
852 Ga0451797_0108775
853 Ga0451798_0155906
854 Ga0451798_0969286
855 Ga0451800_0435905
856 Ga0451807_1077082
857 Ga0451837_1232363
858 Ga0451837_1258977
859 Ga0451837_1622034
860 Ga0451841_1204303
861 Ga0439448_0048718
862 Ga0439448_0180373
863 Ga0466969_0010009
864 Ga0466969_0015993
865 Ga0466969_0027761
866 Ga0466969_0125910
867 Ga0466972_0031219
868 Ga0466972_0435337
869 Ga0466982_0000002
870 Ga0466965_0016024
871 Ga0466966_0002617
872 Ga0466966_0025957
873 Ga0466966_0074862
874 Ga0466966_0148684
875 Ga0466961_0001299
876 Ga0466961_0003971
877 Ga0466961_0007582
878 Ga0466964_0006645
879 Ga0466971_0022289
880 Ga0466968_0135008
881 Ga0466970_0009863
882 Ga0466970_0025468
883 Ga0466970_0576436
884 Ga0466957_0005568
885 Ga0466960_0002860
886 Ga0466959_0000198
887 Ga0466959_0062727
888 Ga0466959_0196778
889 Ga0466959_0220648
890 Ga0466959_0330022
891 Ga0466958_0004503
892 Ga0466958_0006900
893 Ga0466958_0044615
894 Ga0466967_0178341
895 Ga0495650_0000353
896 Ga0495650_0029678
897 Ga0495650_0110694
898 Ga0495584_0002455
899 Ga0495585_0016140
900 Ga0495606_0000937
901 Ga0495606_0017318
902 Ga0495616_0000085
903 Ga0495683_0012969
904 Ga0495686_0003987
905 Ga0495686_0016589
906 Ga0496100_0075174
907 Ga0496101_0134473
908 Ga0496104_0320610
909 Ga0496105_0375403
910 Ga0496113_0525903
911 Ga0496113_0612012
912 Ga0496115_0000505
913 Ga0496115_0040871
914 Ga0496117_0007917
915 Ga0496117_0043569
916 Ga0496117_0056002
917 Ga0496117_0122736
918 Ga0496118_0000677
919 Ga0496118_0001754
920 Ga0496118_0009342
921 Ga0496118_0016257
922 Ga0496118_0630851
923 Ga0496119_0000184
924 Ga0496120_0000719
925 Ga0496121_0006838
926 Ga0496121_0009095
927 Ga0496121_0121849
928 Ga0496121_0184807
929 Ga0496121_0243495
930 Ga0496121_0580195
931 Ga0496122_0000129
932 Ga0496123_0000113
933 Ga0496125_0000479
934 Ga0496125_0445116
935 Ga0496126_0005763
936 Ga0496126_0084867
937 Ga0496126_0141634
938 Ga0496126_0436172
939 Ga0501031_0017717
940 Ga0501031_0038579
941 Ga0501031_0888014
942 Ga0501032_0008569
943 Ga0501032_0023594
944 Ga0501032_0050822
945 Ga0501032_0096231
946 Ga0501033_0002102
947 Ga0501033_0011309
948 Ga0501033_0223467
949 Ga0501033_0574945
950 Ga0501033_0764583
951 Ga0501034_0000996
952 Ga0501034_0007828
953 Ga0501034_0049233
954 Ga0501034_0129136
955 Ga0501036_0019131
956 Ga0501036_0163002
957 Ga0501036_1359202
958 Ga0501037_0004446
959 Ga0501037_0007587
960 Ga0501037_0029753
961 Ga0501038_0001697
962 Ga0501038_0050881
963 Ga0501038_0150103
964 Ga0501038_0277764
965 Ga0501039_0010391
966 Ga0501039_0012497
967 Ga0501039_0056275
968 Ga0501040_0037069
969 Ga0501043_0001923
970 Ga0501043_0036413
971 Ga0501043_0225476
972 Ga0501046_0000711
973 Ga0501046_0008834
974 Ga0501046_0021868
975 Ga0501046_0024525
976 Ga0501046_0191696
977 Ga0501047_0044957
978 Ga0501047_0094860
979 Ga0501047_0204447
980 Ga0501047_0272623
981 Ga0501047_0710652
982 Ga0501047_1234180
983 Ga0501048_0038677
984 Ga0501048_0127233
985 Ga0501048_0569096
986 Ga0501067_0010924
987 Ga0501068_0028147
988 Ga0501069_0108078
989 Ga0501069_0225534
990 Ga0501070_0039815
991 Ga0501070_0122133
992 Ga0501070_0456302
993 Ga0501070_1220463
994 Ga0501072_0144392
995 Ga0501072_0293085
996 Ga0501073_0029339
997 Ga0501073_0083776
998 Ga0501074_0008690
999 Ga0501074_0061280
1000 Ga0501076_0422386
1001 Ga0501079_0084719
1002 Ga0501080_0046617
1003 Ga0501080_0111924
1004 Ga0501080_0114548
1005 Ga0501080_0427326
1006 Ga0501080_0678103
1007 Ga0501080_1758258
1008 Ga0501081_0035222
1009 Ga0501083_0208989
1010 Ga0501083_0607486
1011 Ga0501035_0005012
1012 Ga0501035_0005378
1013 Ga0501035_0023870
1014 Ga0501035_0037869
1015 Ga0501035_0598420
1016 Ga0501044_0005271
1017 Ga0501044_0006764
1018 Ga0501044_0039474
1019 Ga0501044_0040398
1020 Ga0501044_0204017
1021 Ga0501044_0240740
1022 Ga0501044_0794008
1023 Ga0501044_0899289
1024 Ga0501044_1198637
1025 Ga0501045_0083512
1026 Ga0500646_0019194
1027 Ga0500651_0000070
1028 Ga0500651_0007394
1029 Ga0500597_000038
1030 Ga0500568_0001067
1031 Ga0500638_068598
1032 Ga0501084_0315907
1033 Ga0501084_1281996
1034 Ga0500661_000953
1035 Ga0501082_0081779
1036 Ga0501082_0300596
1037 Ga0466962_0002198
1038 Ga0466962_0053717
1039 Ga0530510_0451399
1040 2643894387
1041 2644476591
1042 2687583239
1043 2819565145
1044 2842784391
1045 2895395713
1046 2904466813
1047 2928967530
1048 2939612015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

27

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ntg-assembly4.cif.gz_D crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase 0.8951 19 93
1fl0-assembly1.cif.gz_A crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex 0.8733 19 92
3g48-assembly2.cif.gz_A crystal structure of chaperone csaa form bacillus anthracis str. ames 0.8299 12 118
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.8284 12 118
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.8281 12 118
ID Description Score Start End Superfamily
af_Q54X95_575_736_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8471 20 99 2.40.50.140
af_K7UH50_99_267_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8301 19 100 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8267 12 118 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8113 8 118 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8061 12 118 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0Q9F203-F1-model_v4 tRNA-binding protein 0.9167 21 118 GO:0000049
AF-A0A0Q9F203-F1-model_v4 tRNA-binding protein 0.9078 21 118 GO:0000049
AF-A0A2W5KV52-F1-model_v4 deleted 0.907 20 118
AF-A0A537M1T7-F1-model_v4 tRNA-binding protein 0.8894 12 92 GO:0000049
AF-A0A497H2Q0-F1-model_v4 methionine--tRNA ligase (EC 6.1.1.10) (Methionyl-tRNA synthetase) 0.8878 16 104 GO:0000049
GO:0004825
GO:0005524
GO:0005829
GO:0006431

Map