F459134

General Info

Members Datasets Scaffolds Average Seq Length
524 223 1048 192

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10270509|Ga0157380_102705092
Length 203
Sequence MPTDQGSQENPMSISLSKGGNVSLSKEDPSLTKILIGLGWDARSTDGADFDLDASAFLLAAGDKVRSDSDFIFYNQLKSTDGSVEHTGDNRTGEGEGDDESLKVLLTAVPPEIQKISVAVTIHDGEAKRQNFGMVQNAFIRIVNDVTGREITRYDLTEDASVETAMIFGEVYRHGAEWKFRAVGQGYKGGLGPLARNYGVNVG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
51 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
62 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
63 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
73 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
182 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
183 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
187 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 2511231023 Pseudomonas sp. GM80 Isolate Nodule
192 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
193 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
194 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
195 2643221556 Massilia sp. Root1485 Isolate Unclassified
196 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
197 2643221684 Massilia sp. Root133 Isolate Unclassified
198 2684622632 Bacillus cereus 905 Isolate Unclassified
199 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
200 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
201 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
202 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
203 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
204 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
205 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
206 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
207 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
208 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
209 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
210 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
211 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
212 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
213 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
214 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
215 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
216 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
217 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
218 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
219 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
220 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
221 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
222 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
223 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 1.15
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 5.15
Nodule 0.19
Rhizoplane 2.67
Rhizosphere 83.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10270509 3300014326 Bacteria 1549
2 JGI25159J45721_1008914 3300002987 Bacteria 2699
3 JGI25151J46595_10017040 3300003187 Bacteria 3163
4 Ga0055526_1000882 3300003771 Bacteria 22303
5 Ga0055536_1007983 3300003781 Bacteria 4632
6 Ga0055530_10001271 3300003791 Bacteria 19049
7 Ga0055540_1000667 3300003792 Bacteria 23816
8 Ga0055531_10001272 3300003794 Bacteria 19049
9 Ga0065165_1003109 3300005262 Bacteria 12326
10 Ga0065165_1010734 3300005262 Bacteria 3914
11 Ga0065714_10064620 3300005288 Bacteria 28012
12 Ga0065714_10064733 3300005288 Bacteria 20785
13 Ga0065714_10202520 3300005288 Bacteria 878
14 Ga0065707_10113583 3300005295 Bacteria 2323
15 Ga0070691_10557588 3300005341 Bacteria 670
16 Ga0070668_100164862 3300005347 Bacteria 1800
17 Ga0070662_100488838 3300005457 Bacteria 1025
18 Ga0068859_100050406 3300005617 Bacteria 4182
19 Ga0068863_100002049 3300005841 Bacteria 19961
20 Ga0068860_100005471 3300005843 Bacteria 12871
21 Ga0068862_100000465 3300005844 Bacteria 43692
22 Ga0075369_10017198 3300006186 Bacteria 2927
23 Ga0075370_10058350 3300006353 Bacteria 2195
24 Ga0075436_100001369 3300006914 Bacteria 16605
25 Ga0097620_100050406 3300006931 Bacteria 4182
26 Ga0105251_10008039 3300009011 Bacteria 6397
27 Ga0105251_10017364 3300009011 Bacteria 3859
28 Ga0105244_10006857 3300009036 Bacteria 7314
29 Ga0105244_10023726 3300009036 Bacteria 3360
30 Ga0105244_10062592 3300009036 Bacteria 1870
31 Ga0105244_10093832 3300009036 Bacteria 1474
32 Ga0105244_10387548 3300009036 Bacteria 643
33 Ga0105244_10388144 3300009036 Bacteria 643
34 Ga0105247_10004202 3300009101 Bacteria 9239
35 Ga0105243_10247353 3300009148 Bacteria 1590
36 Ga0105249_10000015 3300009553 Bacteria 282138
37 Ga0105249_10006421 3300009553 Bacteria 10222
38 Ga0105249_11807473 3300009553 Bacteria 684
39 Ga0105032_100449 3300009979 Bacteria 4111
40 Ga0105246_10002409 3300011119 Bacteria 11283
41 Ga0157373_10274406 3300013100 Bacteria 1194
42 Ga0157371_10000287 3300013102 Bacteria 68420
43 Ga0157371_10004841 3300013102 Bacteria 11580
44 Ga0157372_10335794 3300013307 Bacteria 1760
45 Ga0209676_1001454 3300025292 Bacteria 22208
46 Ga0209564_1001572 3300025295 Bacteria 22355
47 Ga0209050_1000001 3300025298 Bacteria 3563507
48 Ga0207426_1009683 3300025302 Bacteria 3791
49 Ga0209051_1000193 3300025303 Bacteria 108391
50 Ga0209257_1001950 3300025304 Bacteria 22274
51 Ga0209257_1008485 3300025304 Bacteria 5823
52 Ga0207696_1004320 3300025711 Bacteria 6149
53 Ga0207655_1000605 3300025728 Bacteria 43451
54 Ga0207655_1007101 3300025728 Bacteria 7316
55 Ga0207655_1021606 3300025728 Bacteria 3260
56 Ga0207655_1044002 3300025728 Bacteria 1880
57 Ga0207655_1061291 3300025728 Bacteria 1453
58 Ga0207655_1072164 3300025728 Bacteria 1278
59 Ga0207710_10011527 3300025900 Bacteria 3720
60 Ga0207705_10610459 3300025909 Bacteria 848
61 Ga0207644_10417529 3300025931 Bacteria 1099
62 Ga0207712_10000023 3300025961 Bacteria 282081
63 Ga0207712_10028558 3300025961 Bacteria 3732
64 Ga0207641_10001955 3300026088 Bacteria 19748
65 Ga0207674_10682782 3300026116 Bacteria 991
66 Ga0209371_1000247 3300027312 Bacteria 67016
67 Ga0268265_10000049 3300028380 Bacteria 177242
68 Ga0268264_10000662 3300028381 Bacteria 40438
69 Ga0237817_10318 3300030083 Bacteria 9674
70 Ga0268256_1000129 3300030500 Bacteria 107626
71 Ga0307511_10003392 3300030521 Bacteria 16378
72 Ga0307513_10017979 3300031456 Bacteria 8464
73 Ga0307508_10001707 3300031616 Bacteria 24387
74 Ga0316579_10059817 3300031691 Bacteria 1791
75 Ga0307412_10969165 3300031911 Bacteria 749
76 Ga0307409_101131313 3300031995 Bacteria 805
77 Ga0316593_10020435 3300032168 Bacteria 2059
78 Ga0316593_10066194 3300032168 Bacteria 1243
79 Ga0395900_0000123 3300037418 Bacteria 133326
80 Ga0395901_0000411 3300038443 Bacteria 50643
81 Ga0451793_0338117 3300041452 Bacteria 1148
82 Ga0451798_0575216 3300041458 Bacteria 945
83 Ga0451804_0767510 3300041463 Bacteria 1324
84 Ga0439449_0048537 3300042007 Bacteria 1571
85 Ga0450904_000390 3300042139 Bacteria 9118
86 Ga0466963_0007585 3300044694 Bacteria 6475
87 Ga0466964_0014244 3300044706 Bacteria 3023
88 Ga0453684_0016839 3300044712 Bacteria 11381
89 Ga0453684_0059385 3300044712 Bacteria 4931
90 Ga0466957_0022129 3300044842 Bacteria 3748
91 Ga0466958_0018667 3300045836 Bacteria 4028
92 Ga0466967_0001634 3300045976 Bacteria 13230
93 Ga0466967_0001886 3300045976 Bacteria 12658
94 Ga0466967_0106360 3300045976 Bacteria 2572
95 Ga0466967_0433797 3300045976 Bacteria 1282
96 Ga0495617_000034 3300046452 Bacteria 147232
97 Ga0495617_008698 3300046452 Bacteria 3494
98 Ga0495627_000140 3300046453 Bacteria 86227
99 Ga0495627_000876 3300046453 Bacteria 21280
100 Ga0495627_001076 3300046453 Bacteria 17964
101 Ga0495627_003674 3300046453 Bacteria 6659
102 Ga0495603_0041697 3300046455 Bacteria 2744
103 Ga0495590_0000027 3300046457 Bacteria 158323
104 Ga0495590_0005477 3300046457 Bacteria 5031
105 Ga0495590_0116076 3300046457 Bacteria 957
106 Ga0495590_0196194 3300046457 Bacteria 741
107 Ga0495591_000026 3300046458 Bacteria 187482
108 Ga0495591_000272 3300046458 Bacteria 48725
109 Ga0495591_000853 3300046458 Bacteria 21445
110 Ga0495591_004768 3300046458 Bacteria 6488
111 Ga0495629_0125826 3300046459 Bacteria 1785
112 Ga0495638_0001259 3300046460 Bacteria 23718
113 Ga0495638_0010378 3300046460 Bacteria 6475
114 Ga0495638_0067404 3300046460 Bacteria 2198
115 Ga0495653_0045713 3300046463 Bacteria 3393
116 Ga0495650_0000833 3300046471 Bacteria 37204
117 Ga0495650_0001990 3300046471 Bacteria 17944
118 Ga0495650_0002128 3300046471 Bacteria 16893
119 Ga0495650_0004597 3300046471 Bacteria 9380
120 Ga0495650_0044678 3300046471 Bacteria 1870
121 Ga0495650_0052365 3300046471 Bacteria 1676
122 Ga0495582_0006811 3300046473 Bacteria 6359
123 Ga0495605_0000029 3300046474 Bacteria 215329
124 Ga0495605_0000036 3300046474 Bacteria 203902
125 Ga0495605_0000151 3300046474 Bacteria 89442
126 Ga0495605_0000230 3300046474 Bacteria 68916
127 Ga0495605_0012412 3300046474 Bacteria 4727
128 Ga0495605_0071546 3300046474 Bacteria 1637
129 Ga0495605_0075363 3300046474 Bacteria 1586
130 Ga0495584_0000122 3300046491 Bacteria 53611
131 Ga0495584_0000508 3300046491 Bacteria 26621
132 Ga0495584_0002431 3300046491 Bacteria 10560
133 Ga0495584_0014466 3300046491 Bacteria 4020
134 Ga0495584_0027229 3300046491 Bacteria 2896
135 Ga0495584_0029100 3300046491 Bacteria 2799
136 Ga0495584_0081470 3300046491 Bacteria 1629
137 Ga0495584_0227266 3300046491 Bacteria 948
138 Ga0495585_0000685 3300046492 Bacteria 30770
139 Ga0495585_0000700 3300046492 Bacteria 30394
140 Ga0495585_0013012 3300046492 Bacteria 4882
141 Ga0495585_0019492 3300046492 Bacteria 3910
142 Ga0495585_0037995 3300046492 Bacteria 2710
143 Ga0495585_0048177 3300046492 Bacteria 2370
144 Ga0495585_0052894 3300046492 Bacteria 2248
145 Ga0495585_0111787 3300046492 Bacteria 1452
146 Ga0495594_0000535 3300046499 Bacteria 19462
147 Ga0495594_0001971 3300046499 Bacteria 10704
148 Ga0495594_0012047 3300046499 Bacteria 4501
149 Ga0495594_0027711 3300046499 Bacteria 3054
150 Ga0495594_0027900 3300046499 Bacteria 3044
151 Ga0495594_0041302 3300046499 Bacteria 2526
152 Ga0495594_0090068 3300046499 Bacteria 1718
153 Ga0495594_0209272 3300046499 Bacteria 1112
154 Ga0495596_0000788 3300046500 Bacteria 19249
155 Ga0495596_0001426 3300046500 Bacteria 13714
156 Ga0495596_0002526 3300046500 Bacteria 9800
157 Ga0495596_0003602 3300046500 Bacteria 7785
158 Ga0495596_0007862 3300046500 Bacteria 4778
159 Ga0495596_0016443 3300046500 Bacteria 3073
160 Ga0495596_0057831 3300046500 Bacteria 1512
161 Ga0495607_0003061 3300046501 Bacteria 12999
162 Ga0495607_0006968 3300046501 Bacteria 7871
163 Ga0495607_0053496 3300046501 Bacteria 2332
164 Ga0495607_0059698 3300046501 Bacteria 2174
165 Ga0495607_0081202 3300046501 Bacteria 1781
166 Ga0495583_0000028 3300046506 Bacteria 255787
167 Ga0495583_0000102 3300046506 Bacteria 143105
168 Ga0495583_0000440 3300046506 Bacteria 62422
169 Ga0495583_0001752 3300046506 Bacteria 20707
170 Ga0495583_0009074 3300046506 Bacteria 5990
171 Ga0495583_0027956 3300046506 Bacteria 2777
172 Ga0495583_0099276 3300046506 Bacteria 1244
173 Ga0495606_0001625 3300046507 Bacteria 29285
174 Ga0495606_0019101 3300046507 Bacteria 5112
175 Ga0495606_0048036 3300046507 Bacteria 2811
176 Ga0495606_0254820 3300046507 Bacteria 971
177 Ga0495610_0000473 3300046512 Bacteria 41477
178 Ga0495610_0002069 3300046512 Bacteria 17119
179 Ga0495610_0010045 3300046512 Bacteria 5912
180 Ga0495610_0028445 3300046512 Bacteria 2956
181 Ga0495616_0000073 3300046513 Bacteria 85397
182 Ga0495616_0000689 3300046513 Bacteria 24989
183 Ga0495616_0011680 3300046513 Bacteria 5021
184 Ga0495616_0056478 3300046513 Bacteria 1938
185 Ga0495631_0000479 3300046518 Bacteria 26745
186 Ga0495631_0000550 3300046518 Bacteria 25263
187 Ga0495631_0001566 3300046518 Bacteria 13727
188 Ga0495631_0004106 3300046518 Bacteria 7819
189 Ga0495631_0005867 3300046518 Bacteria 6399
190 Ga0495631_0008452 3300046518 Bacteria 5188
191 Ga0495631_0013552 3300046518 Bacteria 3955
192 Ga0495631_0018524 3300046518 Bacteria 3275
193 Ga0495631_0024394 3300046518 Bacteria 2792
194 Ga0495631_0025590 3300046518 Bacteria 2717
195 Ga0495632_0000001 3300046519 Bacteria 873295
196 Ga0495632_0000193 3300046519 Bacteria 61596
197 Ga0495632_0000903 3300046519 Bacteria 26010
198 Ga0495632_0001027 3300046519 Bacteria 24127
199 Ga0495632_0001229 3300046519 Bacteria 21737
200 Ga0495632_0010420 3300046519 Bacteria 5507
201 Ga0495632_0011525 3300046519 Bacteria 5154
202 Ga0495632_0095231 3300046519 Bacteria 1407
203 Ga0495632_0111784 3300046519 Bacteria 1282
204 Ga0495637_0000013 3300046520 Bacteria 244837
205 Ga0495637_0000360 3300046520 Bacteria 34584
206 Ga0495637_0047231 3300046520 Bacteria 1818
207 Ga0495637_0056839 3300046520 Bacteria 1618
208 Ga0495643_0000020 3300046522 Bacteria 294973
209 Ga0495643_0000188 3300046522 Bacteria 98997
210 Ga0495643_0000633 3300046522 Bacteria 41677
211 Ga0495643_0004623 3300046522 Bacteria 9581
212 Ga0495643_0020487 3300046522 Bacteria 3811
213 Ga0495643_0028283 3300046522 Bacteria 3144
214 Ga0495644_0000274 3300046523 Bacteria 23698
215 Ga0495644_0008898 3300046523 Bacteria 3861
216 Ga0495644_0029866 3300046523 Bacteria 2058
217 Ga0495644_0031735 3300046523 Bacteria 1996
218 Ga0495644_0065851 3300046523 Bacteria 1361
219 Ga0495644_0102818 3300046523 Bacteria 1081
220 Ga0495648_0001096 3300046524 Bacteria 27557
221 Ga0495648_0001397 3300046524 Bacteria 23719
222 Ga0495648_0004372 3300046524 Bacteria 12090
223 Ga0495648_0010775 3300046524 Bacteria 6943
224 Ga0495648_0048927 3300046524 Bacteria 2596
225 Ga0495648_0060874 3300046524 Bacteria 2244
226 Ga0495648_0361455 3300046524 Bacteria 660
227 Ga0495663_0000002 3300046525 Bacteria 495384
228 Ga0495666_0002187 3300046526 Bacteria 9739
229 Ga0495666_0009709 3300046526 Bacteria 4809
230 Ga0495642_0000050 3300046528 Bacteria 71246
231 Ga0495642_0007472 3300046528 Bacteria 4185
232 Ga0495642_0012530 3300046528 Bacteria 3268
233 Ga0495642_0101033 3300046528 Bacteria 1227
234 Ga0495642_0104381 3300046528 Bacteria 1208
235 Ga0495642_0107755 3300046528 Bacteria 1189
236 Ga0495654_0000246 3300046530 Bacteria 50620
237 Ga0495654_0000561 3300046530 Bacteria 30020
238 Ga0495654_0001321 3300046530 Bacteria 17308
239 Ga0495654_0003990 3300046530 Bacteria 8883
240 Ga0495654_0005344 3300046530 Bacteria 7483
241 Ga0495654_0010013 3300046530 Bacteria 5178
242 Ga0495654_0015168 3300046530 Bacteria 4095
243 Ga0495654_0015289 3300046530 Bacteria 4077
244 Ga0495654_0046722 3300046530 Bacteria 2131
245 Ga0495665_0045365 3300046531 Bacteria 2335
246 Ga0495640_0012178 3300046533 Bacteria 6584
247 Ga0495586_0000429 3300046535 Bacteria 25339
248 Ga0495586_0315368 3300046535 Bacteria 896
249 Ga0495609_0000115 3300046538 Bacteria 93419
250 Ga0495609_0000874 3300046538 Bacteria 22084
251 Ga0495609_0007992 3300046538 Bacteria 5223
252 Ga0495597_0000064 3300046542 Bacteria 91446
253 Ga0495597_0000282 3300046542 Bacteria 46066
254 Ga0495597_0001407 3300046542 Bacteria 17367
255 Ga0495597_0002125 3300046542 Bacteria 13120
256 Ga0495597_0005631 3300046542 Bacteria 6602
257 Ga0495597_0035739 3300046542 Bacteria 2240
258 Ga0495597_0085037 3300046542 Bacteria 1348
259 Ga0495597_0117914 3300046542 Bacteria 1108
260 Ga0495622_0070299 3300046557 Bacteria 1615
261 Ga0495633_0000028 3300046558 Bacteria 203214
262 Ga0495633_0000213 3300046558 Bacteria 72710
263 Ga0495633_0001021 3300046558 Bacteria 22931
264 Ga0495633_0002336 3300046558 Bacteria 13480
265 Ga0495633_0010511 3300046558 Bacteria 5045
266 Ga0495633_0014008 3300046558 Bacteria 4203
267 Ga0495633_0026798 3300046558 Bacteria 2823
268 Ga0495633_0039760 3300046558 Bacteria 2243
269 Ga0495633_0049354 3300046558 Bacteria 1986
270 Ga0495633_0071911 3300046558 Bacteria 1613
271 Ga0495633_0082150 3300046558 Bacteria 1499
272 Ga0495668_0000597 3300046616 Bacteria 43942
273 Ga0495668_0000912 3300046616 Bacteria 33069
274 Ga0495668_0001322 3300046616 Bacteria 24393
275 Ga0495668_0001809 3300046616 Bacteria 19467
276 Ga0495668_0021844 3300046616 Bacteria 3664
277 Ga0495668_0035210 3300046616 Bacteria 2806
278 Ga0495668_0048278 3300046616 Bacteria 2362
279 Ga0495668_0064160 3300046616 Bacteria 2022
280 Ga0495668_0067097 3300046616 Bacteria 1974
281 Ga0495611_0000495 3300046648 Bacteria 23511
282 Ga0495611_0000515 3300046648 Bacteria 22974
283 Ga0495611_0006617 3300046648 Bacteria 4935
284 Ga0495611_0013213 3300046648 Bacteria 3513
285 Ga0495611_0015507 3300046648 Bacteria 3258
286 Ga0495611_0066520 3300046648 Bacteria 1643
287 Ga0495611_0105557 3300046648 Bacteria 1310
288 Ga0495611_0174474 3300046648 Bacteria 1004
289 Ga0495625_0013416 3300046660 Bacteria 6586
290 Ga0495625_0043777 3300046660 Bacteria 3244
291 Ga0495625_0100038 3300046660 Bacteria 1993
292 Ga0495625_0123213 3300046660 Bacteria 1762
293 Ga0495625_0293999 3300046660 Bacteria 1041
294 Ga0495635_0013169 3300046663 Bacteria 5790
295 Ga0495659_0009458 3300046664 Bacteria 3111
296 Ga0495661_0000211 3300046665 Bacteria 67481
297 Ga0495661_0000590 3300046665 Bacteria 37515
298 Ga0495661_0000864 3300046665 Bacteria 28244
299 Ga0495661_0054954 3300046665 Bacteria 2388
300 Ga0495661_0061603 3300046665 Bacteria 2226
301 Ga0495661_0066774 3300046665 Bacteria 2115
302 Ga0495661_0152981 3300046665 Bacteria 1244
303 Ga0495588_0008842 3300046674 Bacteria 4632
304 Ga0495588_0011859 3300046674 Bacteria 4102
305 Ga0495588_0017444 3300046674 Bacteria 3487
306 Ga0495588_0024964 3300046674 Bacteria 2974
307 Ga0495588_0051553 3300046674 Bacteria 2119
308 Ga0495669_0000018 3300046684 Bacteria 127866
309 Ga0495669_0000450 3300046684 Bacteria 19387
310 Ga0495669_0008761 3300046684 Bacteria 4259
311 Ga0495669_0042376 3300046684 Bacteria 2023
312 Ga0495613_0035395 3300046689 Bacteria 3706
313 Ga0495613_0037496 3300046689 Bacteria 3594
314 Ga0495670_0000110 3300046691 Bacteria 36444
315 Ga0495670_0011353 3300046691 Bacteria 4379
316 Ga0495670_0013920 3300046691 Bacteria 3957
317 Ga0495670_0021843 3300046691 Bacteria 3159
318 Ga0495670_0091012 3300046691 Bacteria 1561
319 Ga0495670_0241984 3300046691 Bacteria 961
320 Ga0495671_0000016 3300046692 Bacteria 294821
321 Ga0495671_0000731 3300046692 Bacteria 23680
322 Ga0495671_0001049 3300046692 Bacteria 19213
323 Ga0495671_0009668 3300046692 Bacteria 5378
324 Ga0495671_0121624 3300046692 Bacteria 1273
325 Ga0495649_0000050 3300046694 Bacteria 110154
326 Ga0495649_0000710 3300046694 Bacteria 27160
327 Ga0495649_0000738 3300046694 Bacteria 26452
328 Ga0495649_0016716 3300046694 Bacteria 4155
329 Ga0495649_0042533 3300046694 Bacteria 2482
330 Ga0495649_0044326 3300046694 Bacteria 2428
331 Ga0495589_0000402 3300046794 Bacteria 32574
332 Ga0495589_0000513 3300046794 Bacteria 27274
333 Ga0495589_0001650 3300046794 Bacteria 12778
334 Ga0495589_0002230 3300046794 Bacteria 10899
335 Ga0495589_0007800 3300046794 Bacteria 5603
336 Ga0495589_0022054 3300046794 Bacteria 3252
337 Ga0495589_0037638 3300046794 Bacteria 2423
338 Ga0495600_0025509 3300046809 Bacteria 3810
339 Ga0495660_0000067 3300046810 Bacteria 119390
340 Ga0495660_0000864 3300046810 Bacteria 22369
341 Ga0495660_0001275 3300046810 Bacteria 17529
342 Ga0495660_0053467 3300046810 Bacteria 2192
343 Ga0495660_0100697 3300046810 Bacteria 1488
344 Ga0495660_0137482 3300046810 Bacteria 1219
345 Ga0495581_0022409 3300047315 Bacteria 3660
346 Ga0495604_0004901 3300047317 Bacteria 10611
347 Ga0495604_0007776 3300047317 Bacteria 8488
348 Ga0495636_0018011 3300047318 Bacteria 2832
349 Ga0495636_0129558 3300047318 Bacteria 1121
350 Ga0495636_0133288 3300047318 Bacteria 1106
351 Ga0495672_0000067 3300047320 Bacteria 190335
352 Ga0495672_0000162 3300047320 Bacteria 96750
353 Ga0495672_0001323 3300047320 Bacteria 24615
354 Ga0495672_0001478 3300047320 Bacteria 23059
355 Ga0495672_0002149 3300047320 Bacteria 18430
356 Ga0495672_0007720 3300047320 Bacteria 8053
357 Ga0495672_0056348 3300047320 Bacteria 2287
358 Ga0495676_0000067 3300047321 Bacteria 80084
359 Ga0495676_0061858 3300047321 Bacteria 2926
360 Ga0495676_0158050 3300047321 Bacteria 1606
361 Ga0495676_0430639 3300047321 Bacteria 872
362 Ga0495680_0032258 3300047322 Bacteria 4254
363 Ga0495683_0000091 3300047323 Bacteria 91313
364 Ga0495683_0003460 3300047323 Bacteria 9206
365 Ga0495683_0007524 3300047323 Bacteria 5878
366 Ga0495683_0026541 3300047323 Bacteria 2964
367 Ga0495683_0103134 3300047323 Bacteria 1369
368 Ga0495687_000818 3300047443 Bacteria 33347
369 Ga0495687_000842 3300047443 Bacteria 32674
370 Ga0495675_0005431 3300047444 Bacteria 7771
371 Ga0495677_0001040 3300047445 Bacteria 11140
372 Ga0495677_0006113 3300047445 Bacteria 4553
373 Ga0495677_0007695 3300047445 Bacteria 4020
374 Ga0495677_0008263 3300047445 Bacteria 3870
375 Ga0495677_0012940 3300047445 Bacteria 3038
376 Ga0495677_0031624 3300047445 Bacteria 1926
377 Ga0495677_0084031 3300047445 Bacteria 1195
378 Ga0495677_0130836 3300047445 Bacteria 960
379 Ga0495679_000083 3300047446 Bacteria 87051
380 Ga0495679_000670 3300047446 Bacteria 22425
381 Ga0495679_008700 3300047446 Bacteria 4109
382 Ga0495685_007830 3300047447 Bacteria 3534
383 Ga0495673_0000994 3300047469 Bacteria 25254
384 Ga0495673_0005505 3300047469 Bacteria 7644
385 Ga0495673_0106332 3300047469 Bacteria 1127
386 Ga0495681_0000763 3300047470 Bacteria 24806
387 Ga0495681_0000836 3300047470 Bacteria 23720
388 Ga0495681_0001397 3300047470 Bacteria 18193
389 Ga0495681_0001527 3300047470 Bacteria 17268
390 Ga0495681_0004650 3300047470 Bacteria 9307
391 Ga0495681_0010620 3300047470 Bacteria 5563
392 Ga0495681_0026010 3300047470 Bacteria 3055
393 Ga0495681_0041507 3300047470 Bacteria 2232
394 Ga0495681_0117429 3300047470 Bacteria 1145
395 Ga0495686_0003344 3300047472 Bacteria 13993
396 Ga0495686_0078116 3300047472 Bacteria 2026
397 Ga0495686_0538004 3300047472 Bacteria 611
398 Ga0495593_0000337 3300047673 Bacteria 26031
399 Ga0495614_0001104 3300048089 Bacteria 11564
400 Ga0495614_0002721 3300048089 Bacteria 7862
401 Ga0495626_0000097 3300048091 Bacteria 113925
402 Ga0495626_0001079 3300048091 Bacteria 23225
403 Ga0495626_0001287 3300048091 Bacteria 20482
404 Ga0495626_0008222 3300048091 Bacteria 5745
405 Ga0495626_0011178 3300048091 Bacteria 4757
406 Ga0495626_0034486 3300048091 Bacteria 2420
407 Ga0495626_0048442 3300048091 Bacteria 1971
408 Ga0495626_0079817 3300048091 Bacteria 1455
409 Ga0495626_0086066 3300048091 Bacteria 1389
410 Ga0495626_0229885 3300048091 Bacteria 750
411 Ga0496102_0000341 3300048905 Bacteria 57211
412 Ga0496102_0035426 3300048905 Bacteria 4492
413 Ga0496102_0102984 3300048905 Bacteria 2654
414 Ga0496102_1143435 3300048905 Bacteria 698
415 Ga0496108_0190589 3300048911 Bacteria 1777
416 Ga0496109_0457746 3300048912 Bacteria 1205
417 Ga0496110_0186832 3300048913 Bacteria 1882
418 Ga0496113_0213197 3300048916 Bacteria 1538
419 Ga0496114_0142813 3300048917 Bacteria 2074
420 Ga0496115_0047176 3300048918 Bacteria 3444
421 Ga0496116_0015099 3300048919 Bacteria 6123
422 Ga0496116_0048326 3300048919 Bacteria 2856
423 Ga0496116_0154163 3300048919 Bacteria 1271
424 Ga0496117_0006076 3300048920 Bacteria 12382
425 Ga0496117_0015951 3300048920 Bacteria 6366
426 Ga0496117_0081126 3300048920 Bacteria 2130
427 Ga0496118_0000829 3300048921 Bacteria 49162
428 Ga0496118_0123302 3300048921 Bacteria 1683
429 Ga0496119_0032968 3300048922 Bacteria 3444
430 Ga0496120_0000131 3300048923 Bacteria 126644
431 Ga0496120_0012027 3300048923 Bacteria 5913
432 Ga0496121_0000705 3300048924 Bacteria 62174
433 Ga0496121_0034218 3300048924 Bacteria 4577
434 Ga0496122_0005717 3300048925 Bacteria 14657
435 Ga0496122_0078053 3300048925 Bacteria 2321
436 Ga0496122_0118312 3300048925 Bacteria 1717
437 Ga0496123_0002487 3300048926 Bacteria 22747
438 Ga0496123_0004561 3300048926 Bacteria 14446
439 Ga0496123_0007454 3300048926 Bacteria 10297
440 Ga0496124_0002272 3300048927 Bacteria 25468
441 Ga0496124_0006866 3300048927 Bacteria 12258
442 Ga0496124_0009915 3300048927 Bacteria 9736
443 Ga0496124_0057113 3300048927 Bacteria 3290
444 Ga0496125_0005644 3300048928 Bacteria 13816
445 Ga0496126_0011658 3300048929 Bacteria 9070
446 Ga0501345_02989 3300049134 Bacteria 716
447 Ga0495678_000020 3300049459 Bacteria 253654
448 Ga0495678_000131 3300049459 Bacteria 88620
449 Ga0495678_000355 3300049459 Bacteria 47179
450 Ga0495678_000863 3300049459 Bacteria 26987
451 Ga0495678_001001 3300049459 Bacteria 24213
452 Ga0495678_001525 3300049459 Bacteria 17933
453 Ga0495678_003908 3300049459 Bacteria 8937
454 Ga0495678_014989 3300049459 Bacteria 3584
455 Ga0495682_0000444 3300049460 Bacteria 28746
456 Ga0495682_0000617 3300049460 Bacteria 23939
457 Ga0495682_0001014 3300049460 Bacteria 16657
458 Ga0495682_0002972 3300049460 Bacteria 7740
459 Ga0501034_0329340 3300049571 Bacteria 1459
460 Ga0501037_0004421 3300049573 Bacteria 10211
461 Ga0501047_0170954 3300049581 Bacteria 2042
462 Ga0501047_0331292 3300049581 Bacteria 1361
463 Ga0501069_0015931 3300049585 Bacteria 4031
464 Ga0501070_0029037 3300049586 Bacteria 4638
465 Ga0501070_0404720 3300049586 Bacteria 1103
466 Ga0501071_0128350 3300049587 Bacteria 1883
467 Ga0501073_0070408 3300049589 Bacteria 2437
468 Ga0501073_0449667 3300049589 Bacteria 891
469 Ga0501074_0009291 3300049590 Bacteria 7140
470 Ga0501074_0246007 3300049590 Bacteria 1272
471 Ga0501075_0045871 3300049591 Bacteria 3282
472 Ga0501080_0007061 3300049742 Bacteria 10143
473 Ga0501267_003108 3300049764 Bacteria 1500
474 Ga0501035_0001714 3300049822 Bacteria 22155
475 Ga0501044_0128093 3300049823 Bacteria 2534
476 Ga0501284_02662 3300050005 Bacteria 992
477 nmdc:mga08x19_1130_c1 3300050514 Bacteria 16636
478 nmdc:mga0sz30_46024_c1 3300050516 Bacteria 1841
479 Ga0500646_0004135 3300053090 Bacteria 3684
480 Ga0500583_0029128 3300053092 Bacteria 2403
481 Ga0500650_0093943 3300053098 Bacteria 1404
482 Ga0500618_063948 3300053125 Bacteria 827
483 Ga0500655_047083 3300053133 Bacteria 854
484 Ga0500568_0017579 3300053139 Bacteria 3155
485 Ga0500604_0000094 3300053151 Bacteria 28414
486 Ga0500661_047535 3300055283 Bacteria 764
487 Ga0587070_029668 3300059491 Bacteria 983
488 Ga0587082_003110 3300059504 Bacteria 1959
489 Ga0587088_001822 3300059508 Bacteria 2299
490 Ga0466962_0009906 3300061719 Bacteria 4572
491 2511367024 2511231023 Bacteria 6808468
492 2552747985 2551306352 Bacteria 3873115
493 2563929444 2563366752 Bacteria 4961801
494 2600200777 2599185354 Bacteria 4398675
495 2643800201 2643221556 Bacteria 7251154
496 2644361434 2643221665 Bacteria 4699229
497 2644472017 2643221684 Bacteria 7145183
498 2685148365 2684622632 Bacteria 5380049
499 2729905982 2728369276 Bacteria 5610032
500 2739366193 2738543034 Bacteria 6084756
501 2753037622 2751185725 Bacteria 5740550
502 2753325490 2751185792 Bacteria 5739090
503 2753765176 2751185897 Bacteria 5322941
504 2799184687 2799112218 Bacteria 4315149
505 2799185118 2799112218 Bacteria 4315149
506 2809142475 2808606418 Bacteria 6724496
507 2809218500 2808606445 Bacteria 6057339
508 2904767352 2904765812 Bacteria 5369154
509 2904774635 2904770941 Bacteria 5580202
510 2907206331 2907202186 Bacteria 6632024
511 2908813000 2908811453 Bacteria 5478616
512 2919424026 2919420072 Bacteria 5390363
513 2919436522 2919432681 Bacteria 5390474
514 2929233614 2929233124 Bacteria 5948380
515 2936367089 2936361878 Bacteria 5632809
516 2977256919 2977254563 Bacteria 4828420
517 2984555496 2984555340 Bacteria 4247089
518 2984569724 2984568884 Bacteria 3884413
519 2990277795 2990275345 Bacteria 4887158
520 2993357406 2993356040 Bacteria 4247105
521 3006326483 3006321560 Bacteria 8247479
522 3007876142 3007872151 Bacteria 5268868
523 8022621538 8022621104 Bacteria 5241040
524 8047674777 8047673197 Bacteria 7395230
525 Ga0157380_10270509
526 JGI25159J45721_1008914
527 JGI25151J46595_10017040
528 Ga0055526_1000882
529 Ga0055536_1007983
530 Ga0055530_10001271
531 Ga0055540_1000667
532 Ga0055531_10001272
533 Ga0065165_1003109
534 Ga0065165_1010734
535 Ga0065714_10064620
536 Ga0065714_10064733
537 Ga0065714_10202520
538 Ga0065707_10113583
539 Ga0070691_10557588
540 Ga0070668_100164862
541 Ga0070662_100488838
542 Ga0068859_100050406
543 Ga0068863_100002049
544 Ga0068860_100005471
545 Ga0068862_100000465
546 Ga0075369_10017198
547 Ga0075370_10058350
548 Ga0075436_100001369
549 Ga0097620_100050406
550 Ga0105251_10008039
551 Ga0105251_10017364
552 Ga0105244_10006857
553 Ga0105244_10023726
554 Ga0105244_10062592
555 Ga0105244_10093832
556 Ga0105244_10387548
557 Ga0105244_10388144
558 Ga0105247_10004202
559 Ga0105243_10247353
560 Ga0105249_10000015
561 Ga0105249_10006421
562 Ga0105249_11807473
563 Ga0105032_100449
564 Ga0105246_10002409
565 Ga0157373_10274406
566 Ga0157371_10000287
567 Ga0157371_10004841
568 Ga0157372_10335794
569 Ga0209676_1001454
570 Ga0209564_1001572
571 Ga0209050_1000001
572 Ga0207426_1009683
573 Ga0209051_1000193
574 Ga0209257_1001950
575 Ga0209257_1008485
576 Ga0207696_1004320
577 Ga0207655_1000605
578 Ga0207655_1007101
579 Ga0207655_1021606
580 Ga0207655_1044002
581 Ga0207655_1061291
582 Ga0207655_1072164
583 Ga0207710_10011527
584 Ga0207705_10610459
585 Ga0207644_10417529
586 Ga0207712_10000023
587 Ga0207712_10028558
588 Ga0207641_10001955
589 Ga0207674_10682782
590 Ga0209371_1000247
591 Ga0268265_10000049
592 Ga0268264_10000662
593 Ga0237817_10318
594 Ga0268256_1000129
595 Ga0307511_10003392
596 Ga0307513_10017979
597 Ga0307508_10001707
598 Ga0316579_10059817
599 Ga0307412_10969165
600 Ga0307409_101131313
601 Ga0316593_10020435
602 Ga0316593_10066194
603 Ga0395900_0000123
604 Ga0395901_0000411
605 Ga0451793_0338117
606 Ga0451798_0575216
607 Ga0451804_0767510
608 Ga0439449_0048537
609 Ga0450904_000390
610 Ga0466963_0007585
611 Ga0466964_0014244
612 Ga0453684_0016839
613 Ga0453684_0059385
614 Ga0466957_0022129
615 Ga0466958_0018667
616 Ga0466967_0001634
617 Ga0466967_0001886
618 Ga0466967_0106360
619 Ga0466967_0433797
620 Ga0495617_000034
621 Ga0495617_008698
622 Ga0495627_000140
623 Ga0495627_000876
624 Ga0495627_001076
625 Ga0495627_003674
626 Ga0495603_0041697
627 Ga0495590_0000027
628 Ga0495590_0005477
629 Ga0495590_0116076
630 Ga0495590_0196194
631 Ga0495591_000026
632 Ga0495591_000272
633 Ga0495591_000853
634 Ga0495591_004768
635 Ga0495629_0125826
636 Ga0495638_0001259
637 Ga0495638_0010378
638 Ga0495638_0067404
639 Ga0495653_0045713
640 Ga0495650_0000833
641 Ga0495650_0001990
642 Ga0495650_0002128
643 Ga0495650_0004597
644 Ga0495650_0044678
645 Ga0495650_0052365
646 Ga0495582_0006811
647 Ga0495605_0000029
648 Ga0495605_0000036
649 Ga0495605_0000151
650 Ga0495605_0000230
651 Ga0495605_0012412
652 Ga0495605_0071546
653 Ga0495605_0075363
654 Ga0495584_0000122
655 Ga0495584_0000508
656 Ga0495584_0002431
657 Ga0495584_0014466
658 Ga0495584_0027229
659 Ga0495584_0029100
660 Ga0495584_0081470
661 Ga0495584_0227266
662 Ga0495585_0000685
663 Ga0495585_0000700
664 Ga0495585_0013012
665 Ga0495585_0019492
666 Ga0495585_0037995
667 Ga0495585_0048177
668 Ga0495585_0052894
669 Ga0495585_0111787
670 Ga0495594_0000535
671 Ga0495594_0001971
672 Ga0495594_0012047
673 Ga0495594_0027711
674 Ga0495594_0027900
675 Ga0495594_0041302
676 Ga0495594_0090068
677 Ga0495594_0209272
678 Ga0495596_0000788
679 Ga0495596_0001426
680 Ga0495596_0002526
681 Ga0495596_0003602
682 Ga0495596_0007862
683 Ga0495596_0016443
684 Ga0495596_0057831
685 Ga0495607_0003061
686 Ga0495607_0006968
687 Ga0495607_0053496
688 Ga0495607_0059698
689 Ga0495607_0081202
690 Ga0495583_0000028
691 Ga0495583_0000102
692 Ga0495583_0000440
693 Ga0495583_0001752
694 Ga0495583_0009074
695 Ga0495583_0027956
696 Ga0495583_0099276
697 Ga0495606_0001625
698 Ga0495606_0019101
699 Ga0495606_0048036
700 Ga0495606_0254820
701 Ga0495610_0000473
702 Ga0495610_0002069
703 Ga0495610_0010045
704 Ga0495610_0028445
705 Ga0495616_0000073
706 Ga0495616_0000689
707 Ga0495616_0011680
708 Ga0495616_0056478
709 Ga0495631_0000479
710 Ga0495631_0000550
711 Ga0495631_0001566
712 Ga0495631_0004106
713 Ga0495631_0005867
714 Ga0495631_0008452
715 Ga0495631_0013552
716 Ga0495631_0018524
717 Ga0495631_0024394
718 Ga0495631_0025590
719 Ga0495632_0000001
720 Ga0495632_0000193
721 Ga0495632_0000903
722 Ga0495632_0001027
723 Ga0495632_0001229
724 Ga0495632_0010420
725 Ga0495632_0011525
726 Ga0495632_0095231
727 Ga0495632_0111784
728 Ga0495637_0000013
729 Ga0495637_0000360
730 Ga0495637_0047231
731 Ga0495637_0056839
732 Ga0495643_0000020
733 Ga0495643_0000188
734 Ga0495643_0000633
735 Ga0495643_0004623
736 Ga0495643_0020487
737 Ga0495643_0028283
738 Ga0495644_0000274
739 Ga0495644_0008898
740 Ga0495644_0029866
741 Ga0495644_0031735
742 Ga0495644_0065851
743 Ga0495644_0102818
744 Ga0495648_0001096
745 Ga0495648_0001397
746 Ga0495648_0004372
747 Ga0495648_0010775
748 Ga0495648_0048927
749 Ga0495648_0060874
750 Ga0495648_0361455
751 Ga0495663_0000002
752 Ga0495666_0002187
753 Ga0495666_0009709
754 Ga0495642_0000050
755 Ga0495642_0007472
756 Ga0495642_0012530
757 Ga0495642_0101033
758 Ga0495642_0104381
759 Ga0495642_0107755
760 Ga0495654_0000246
761 Ga0495654_0000561
762 Ga0495654_0001321
763 Ga0495654_0003990
764 Ga0495654_0005344
765 Ga0495654_0010013
766 Ga0495654_0015168
767 Ga0495654_0015289
768 Ga0495654_0046722
769 Ga0495665_0045365
770 Ga0495640_0012178
771 Ga0495586_0000429
772 Ga0495586_0315368
773 Ga0495609_0000115
774 Ga0495609_0000874
775 Ga0495609_0007992
776 Ga0495597_0000064
777 Ga0495597_0000282
778 Ga0495597_0001407
779 Ga0495597_0002125
780 Ga0495597_0005631
781 Ga0495597_0035739
782 Ga0495597_0085037
783 Ga0495597_0117914
784 Ga0495622_0070299
785 Ga0495633_0000028
786 Ga0495633_0000213
787 Ga0495633_0001021
788 Ga0495633_0002336
789 Ga0495633_0010511
790 Ga0495633_0014008
791 Ga0495633_0026798
792 Ga0495633_0039760
793 Ga0495633_0049354
794 Ga0495633_0071911
795 Ga0495633_0082150
796 Ga0495668_0000597
797 Ga0495668_0000912
798 Ga0495668_0001322
799 Ga0495668_0001809
800 Ga0495668_0021844
801 Ga0495668_0035210
802 Ga0495668_0048278
803 Ga0495668_0064160
804 Ga0495668_0067097
805 Ga0495611_0000495
806 Ga0495611_0000515
807 Ga0495611_0006617
808 Ga0495611_0013213
809 Ga0495611_0015507
810 Ga0495611_0066520
811 Ga0495611_0105557
812 Ga0495611_0174474
813 Ga0495625_0013416
814 Ga0495625_0043777
815 Ga0495625_0100038
816 Ga0495625_0123213
817 Ga0495625_0293999
818 Ga0495635_0013169
819 Ga0495659_0009458
820 Ga0495661_0000211
821 Ga0495661_0000590
822 Ga0495661_0000864
823 Ga0495661_0054954
824 Ga0495661_0061603
825 Ga0495661_0066774
826 Ga0495661_0152981
827 Ga0495588_0008842
828 Ga0495588_0011859
829 Ga0495588_0017444
830 Ga0495588_0024964
831 Ga0495588_0051553
832 Ga0495669_0000018
833 Ga0495669_0000450
834 Ga0495669_0008761
835 Ga0495669_0042376
836 Ga0495613_0035395
837 Ga0495613_0037496
838 Ga0495670_0000110
839 Ga0495670_0011353
840 Ga0495670_0013920
841 Ga0495670_0021843
842 Ga0495670_0091012
843 Ga0495670_0241984
844 Ga0495671_0000016
845 Ga0495671_0000731
846 Ga0495671_0001049
847 Ga0495671_0009668
848 Ga0495671_0121624
849 Ga0495649_0000050
850 Ga0495649_0000710
851 Ga0495649_0000738
852 Ga0495649_0016716
853 Ga0495649_0042533
854 Ga0495649_0044326
855 Ga0495589_0000402
856 Ga0495589_0000513
857 Ga0495589_0001650
858 Ga0495589_0002230
859 Ga0495589_0007800
860 Ga0495589_0022054
861 Ga0495589_0037638
862 Ga0495600_0025509
863 Ga0495660_0000067
864 Ga0495660_0000864
865 Ga0495660_0001275
866 Ga0495660_0053467
867 Ga0495660_0100697
868 Ga0495660_0137482
869 Ga0495581_0022409
870 Ga0495604_0004901
871 Ga0495604_0007776
872 Ga0495636_0018011
873 Ga0495636_0129558
874 Ga0495636_0133288
875 Ga0495672_0000067
876 Ga0495672_0000162
877 Ga0495672_0001323
878 Ga0495672_0001478
879 Ga0495672_0002149
880 Ga0495672_0007720
881 Ga0495672_0056348
882 Ga0495676_0000067
883 Ga0495676_0061858
884 Ga0495676_0158050
885 Ga0495676_0430639
886 Ga0495680_0032258
887 Ga0495683_0000091
888 Ga0495683_0003460
889 Ga0495683_0007524
890 Ga0495683_0026541
891 Ga0495683_0103134
892 Ga0495687_000818
893 Ga0495687_000842
894 Ga0495675_0005431
895 Ga0495677_0001040
896 Ga0495677_0006113
897 Ga0495677_0007695
898 Ga0495677_0008263
899 Ga0495677_0012940
900 Ga0495677_0031624
901 Ga0495677_0084031
902 Ga0495677_0130836
903 Ga0495679_000083
904 Ga0495679_000670
905 Ga0495679_008700
906 Ga0495685_007830
907 Ga0495673_0000994
908 Ga0495673_0005505
909 Ga0495673_0106332
910 Ga0495681_0000763
911 Ga0495681_0000836
912 Ga0495681_0001397
913 Ga0495681_0001527
914 Ga0495681_0004650
915 Ga0495681_0010620
916 Ga0495681_0026010
917 Ga0495681_0041507
918 Ga0495681_0117429
919 Ga0495686_0003344
920 Ga0495686_0078116
921 Ga0495686_0538004
922 Ga0495593_0000337
923 Ga0495614_0001104
924 Ga0495614_0002721
925 Ga0495626_0000097
926 Ga0495626_0001079
927 Ga0495626_0001287
928 Ga0495626_0008222
929 Ga0495626_0011178
930 Ga0495626_0034486
931 Ga0495626_0048442
932 Ga0495626_0079817
933 Ga0495626_0086066
934 Ga0495626_0229885
935 Ga0496102_0000341
936 Ga0496102_0035426
937 Ga0496102_0102984
938 Ga0496102_1143435
939 Ga0496108_0190589
940 Ga0496109_0457746
941 Ga0496110_0186832
942 Ga0496113_0213197
943 Ga0496114_0142813
944 Ga0496115_0047176
945 Ga0496116_0015099
946 Ga0496116_0048326
947 Ga0496116_0154163
948 Ga0496117_0006076
949 Ga0496117_0015951
950 Ga0496117_0081126
951 Ga0496118_0000829
952 Ga0496118_0123302
953 Ga0496119_0032968
954 Ga0496120_0000131
955 Ga0496120_0012027
956 Ga0496121_0000705
957 Ga0496121_0034218
958 Ga0496122_0005717
959 Ga0496122_0078053
960 Ga0496122_0118312
961 Ga0496123_0002487
962 Ga0496123_0004561
963 Ga0496123_0007454
964 Ga0496124_0002272
965 Ga0496124_0006866
966 Ga0496124_0009915
967 Ga0496124_0057113
968 Ga0496125_0005644
969 Ga0496126_0011658
970 Ga0501345_02989
971 Ga0495678_000020
972 Ga0495678_000131
973 Ga0495678_000355
974 Ga0495678_000863
975 Ga0495678_001001
976 Ga0495678_001525
977 Ga0495678_003908
978 Ga0495678_014989
979 Ga0495682_0000444
980 Ga0495682_0000617
981 Ga0495682_0001014
982 Ga0495682_0002972
983 Ga0501034_0329340
984 Ga0501037_0004421
985 Ga0501047_0170954
986 Ga0501047_0331292
987 Ga0501069_0015931
988 Ga0501070_0029037
989 Ga0501070_0404720
990 Ga0501071_0128350
991 Ga0501073_0070408
992 Ga0501073_0449667
993 Ga0501074_0009291
994 Ga0501074_0246007
995 Ga0501075_0045871
996 Ga0501080_0007061
997 Ga0501267_003108
998 Ga0501035_0001714
999 Ga0501044_0128093
1000 Ga0501284_02662
1001 nmdc:mga08x19_1130_c1
1002 nmdc:mga0sz30_46024_c1
1003 Ga0500646_0004135
1004 Ga0500583_0029128
1005 Ga0500650_0093943
1006 Ga0500618_063948
1007 Ga0500655_047083
1008 Ga0500568_0017579
1009 Ga0500604_0000094
1010 Ga0500661_047535
1011 Ga0587070_029668
1012 Ga0587082_003110
1013 Ga0587088_001822
1014 Ga0466962_0009906
1015 2511367024
1016 2552747985
1017 2563929444
1018 2600200777
1019 2643800201
1020 2644361434
1021 2644472017
1022 2685148365
1023 2729905982
1024 2739366193
1025 2753037622
1026 2753325490
1027 2753765176
1028 2799184687
1029 2799185118
1030 2809142475
1031 2809218500
1032 2904767352
1033 2904774635
1034 2907206331
1035 2908813000
1036 2919424026
1037 2919436522
1038 2929233614
1039 2936367089
1040 2977256919
1041 2984555496
1042 2984569724
1043 2990277795
1044 2993357406
1045 3006326483
1046 3007876142
1047 8022621538
1048 8047674777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

12

198

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8888 17 192
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8748 17 192
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8467 19 192
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8379 19 192
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.8259 19 185
ID Description Score Start End Superfamily
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9299 20 185 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9035 20 185 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8898 19 186 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.88 19 186 2.60.60.30
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8206 19 185 2.60.60.30
ID Description Score Start End GO Terms
AF-A0A2P0H9F8-F1-model_v4 deleted 0.9933 1 192
AF-A0A2P0H9F8-F1-model_v4 deleted 0.9881 1 192
AF-M4KN35-F1-model_v4 deleted 0.9869 1 192
AF-A0A1R4IM00-F1-model_v4 Tellurium resistance protein TerD 0.9869 1 192 GO:0016020
GO:0046690
AF-A0A496N6Q9-F1-model_v4 deleted 0.9866 1 192

Map