F459135

General Info

Members Datasets Scaffolds Average Seq Length
524 297 1049 194

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10025532|Ga0182008_100255323
Length 220
Sequence MKSASTTTLPPAKLTINSKTASSQAASQGVLRPALVLFASLTVLCGVIYPLAVTGIGKAVFPDQASGSLIVQNGKLVGSRLIGQEFSAPNYFWGRLSATSPMPYNAQSSGGSNFGPSNPALIDAVKGRVDALKAADPGNALPIPVDLVTASGSGLDPEISLAAAYYQAGRIARERKLNVDTVHALIDSLQLQRSLGFFGEPRVNVLALNLALDRQHPAAN

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
225 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
236 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
239 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
240 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
241 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
242 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
243 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
244 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
245 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
246 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
247 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
248 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
249 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
250 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
251 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
252 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
253 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
254 2643221638 Duganella sp. Root336D2 Isolate Unclassified
255 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
256 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
257 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
258 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
259 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
260 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
261 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
262 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
263 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
264 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
265 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
266 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
267 2818991436 Collimonas arenae 515 Isolate Unclassified
268 2818991450 Burkholderia sp. 604 Isolate Unclassified
269 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
270 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
271 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
272 2842711865 Duganella sp. R-73148 Isolate Unclassified
273 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
274 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
275 2857553236 Duganella sp. R-74557 Isolate Unclassified
276 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
277 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
278 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
279 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
280 2904424332 Duganella sp. 1411 Isolate Rhizosphere
281 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
282 2904564687 Burkholderia sp. 571 Isolate Unclassified
283 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
284 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
285 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
286 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
287 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
288 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
289 2928536128 Burkholderia sola 565 Isolate Unclassified
290 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
291 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
292 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
293 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
294 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
295 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
296 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
297 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.36
Metatranscriptomes 0
Isolates 11.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 3.05
Rhizoplane 4.01
Rhizosphere 70.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10025532 3300014497 Bacteria 3000
2 JGI24740J21852_10014512 3300001979 Bacteria 2902
3 JGI24739J22299_10012698 3300001989 Bacteria 3089
4 JGI24739J22299_10040143 3300001989 Bacteria 1563
5 JGI24739J22299_10065150 3300001989 Bacteria 1143
6 JGI24737J22298_10021738 3300001990 Bacteria 2042
7 JGI24737J22298_10038089 3300001990 Bacteria 1481
8 JGI24735J21928_10026234 3300002067 Bacteria 1753
9 JGI24735J21928_10032797 3300002067 Bacteria 1536
10 JGI24738J21930_10018827 3300002075 Bacteria 1442
11 JGI25156J39149_1001325 3300002705 Bacteria 10695
12 JGI25156J39149_1001850 3300002705 Bacteria 8274
13 JGI25156J39149_1001909 3300002705 Bacteria 8105
14 JGI25156J39149_1008138 3300002705 Bacteria 2672
15 JGI25162J39368_1000001 3300002737 Bacteria 740113
16 JGI25165J46597_1000001 3300003214 Bacteria 1111887
17 JGI25165J46597_1001862 3300003214 Bacteria 8702
18 rootH1_10099099 3300003316 Bacteria 1034
19 rootH1_10099099 3300003323 Bacteria 11139
20 Ga0055538_1000001 3300003751 Bacteria 1111887
21 Ga0055539_1000001 3300003752 Bacteria 1111887
22 Ga0055533_1000003 3300003756 Bacteria 1111887
23 Ga0055533_1000549 3300003756 Bacteria 13357
24 Ga0055532_1000063 3300003758 Bacteria 147140
25 Ga0055525_1000003 3300003759 Bacteria 962094
26 Ga0055527_1000049 3300003760 Bacteria 105168
27 Ga0055535_1000042 3300003761 Bacteria 147140
28 Ga0055542_1000071 3300003762 Bacteria 147140
29 Ga0055529_1000081 3300003763 Bacteria 147140
30 Ga0055526_1000033 3300003771 Bacteria 138249
31 Ga0055526_1002196 3300003771 Bacteria 13373
32 Ga0055537_1000255 3300003773 Bacteria 38866
33 Ga0055524_1000027 3300003775 Bacteria 213655
34 Ga0055524_1036780 3300003775 Bacteria 1309
35 Ga0055534_1000130 3300003784 Bacteria 56637
36 Ga0055528_1000043 3300003790 Bacteria 103664
37 Ga0055530_10026770 3300003791 Bacteria 1586
38 Ga0055541_1000001 3300003841 Bacteria 1111887
39 Ga0065165_1006240 3300005262 Bacteria 6337
40 Ga0065165_1040736 3300005262 Bacteria 1383
41 Ga0065704_10132075 3300005289 Bacteria 1561
42 Ga0065707_10098405 3300005295 Bacteria 3088
43 Ga0070689_100031020 3300005340 Bacteria 4060
44 Ga0070689_100957570 3300005340 Bacteria 760
45 Ga0070687_100592704 3300005343 Bacteria 760
46 Ga0070661_100053185 3300005344 Bacteria 2963
47 Ga0070659_100002059 3300005366 Bacteria 14343
48 Ga0070714_100011313 3300005435 Bacteria 7077
49 Ga0070663_100210284 3300005455 Bacteria 1523
50 Ga0070698_100016930 3300005471 Bacteria 7685
51 Ga0070696_100450868 3300005546 Bacteria 1015
52 Ga0070664_100292259 3300005564 Bacteria 1471
53 Ga0068863_100171842 3300005841 Bacteria 2079
54 Ga0068858_100334520 3300005842 Bacteria 1449
55 Ga0070712_100140036 3300006175 Bacteria 1845
56 Ga0075434_100068860 3300006871 Bacteria 3527
57 Ga0105251_10000613 3300009011 Bacteria 32739
58 Ga0105244_10022540 3300009036 Bacteria 3466
59 Ga0105240_11293857 3300009093 Bacteria 769
60 Ga0105248_10551337 3300009177 Bacteria 1300
61 Ga0105248_11632012 3300009177 Bacteria 731
62 Ga0105238_11136957 3300009551 Bacteria 804
63 Ga0105249_10431409 3300009553 Bacteria 1354
64 Ga0163163_10275171 3300014325 Bacteria 1735
65 Ga0157380_10241908 3300014326 Bacteria 1628
66 Ga0182008_10263010 3300014497 Bacteria 893
67 Ga0157379_10387826 3300014968 Bacteria 1282
68 Ga0182006_1022416 3300015261 Bacteria 2625
69 Ga0182007_10002364 3300015262 Bacteria 9452
70 Ga0182007_10004304 3300015262 Bacteria 6481
71 Ga0182007_10005586 3300015262 Bacteria 5501
72 Ga0182005_1000117 3300015265 Bacteria 57578
73 Ga0213872_10000135 3300021361 Bacteria 67262
74 Ga0213872_10147791 3300021361 Bacteria 1028
75 Ga0209760_101766 3300025207 Bacteria 2167
76 Ga0209784_100004 3300025224 Bacteria 1378156
77 Ga0209566_100004 3300025225 Bacteria 1531866
78 Ga0209674_100006 3300025226 Bacteria 1531866
79 Ga0209674_100013 3300025226 Bacteria 813140
80 Ga0209674_100174 3300025226 Bacteria 80149
81 Ga0209672_100010 3300025228 Bacteria 873151
82 Ga0209147_100006 3300025229 Bacteria 873276
83 Ga0209563_100009 3300025230 Bacteria 1378156
84 Ga0207427_100424 3300025231 Bacteria 23740
85 Ga0209437_100004 3300025233 Bacteria 1378156
86 Ga0209258_100010 3300025242 Bacteria 873276
87 Ga0209677_100005 3300025253 Bacteria 1378156
88 Ga0209677_109287 3300025253 Bacteria 1786
89 Ga0209148_1000018 3300025254 Bacteria 756247
90 Ga0209759_1000250 3300025256 Bacteria 80232
91 Ga0209759_1000690 3300025256 Bacteria 30331
92 Ga0209759_1001680 3300025256 Bacteria 11537
93 Ga0209759_1013536 3300025256 Bacteria 2201
94 Ga0209759_1023621 3300025256 Bacteria 1348
95 Ga0209233_1000005 3300025261 Bacteria 1531866
96 Ga0209233_1000171 3300025261 Bacteria 146605
97 Ga0209565_1000006 3300025263 Bacteria 897294
98 Ga0209565_1002486 3300025263 Bacteria 6593
99 Ga0209565_1006639 3300025263 Bacteria 3220
100 Ga0209455_1000015 3300025272 Bacteria 756128
101 Ga0209673_1000004 3300025273 Bacteria 896155
102 Ga0209673_1001671 3300025273 Bacteria 18985
103 Ga0209675_1000006 3300025291 Bacteria 732267
104 Ga0209564_1000006 3300025295 Bacteria 1100927
105 Ga0209564_1000085 3300025295 Bacteria 251509
106 Ga0209050_1001043 3300025298 Bacteria 34245
107 Ga0209050_1001270 3300025298 Bacteria 29018
108 Ga0209256_1000013 3300025299 Bacteria 689442
109 Ga0209256_1000037 3300025299 Bacteria 377661
110 Ga0207655_1040035 3300025728 Bacteria 2029
111 Ga0207713_1000221 3300025735 Bacteria 76659
112 Ga0207647_10004631 3300025904 Bacteria 10191
113 Ga0207647_10019702 3300025904 Bacteria 4533
114 Ga0207647_10076262 3300025904 Bacteria 2016
115 Ga0207693_10197881 3300025915 Bacteria 1580
116 Ga0207657_10043004 3300025919 Bacteria 3983
117 Ga0207649_10011937 3300025920 Bacteria 4806
118 Ga0207694_10638817 3300025924 Bacteria 896
119 Ga0207664_10006415 3300025929 Bacteria 8094
120 Ga0207690_10005233 3300025932 Bacteria 7652
121 Ga0207670_10253841 3300025936 Bacteria 1360
122 Ga0207670_10505416 3300025936 Bacteria 982
123 Ga0207711_11050238 3300025941 Bacteria 755
124 Ga0207679_10017860 3300025945 Bacteria 4742
125 Ga0207658_10138851 3300025986 Bacteria 1964
126 Ga0207703_10555771 3300026035 Bacteria 1082
127 Ga0207678_10248038 3300026067 Bacteria 1525
128 Ga0207641_10965233 3300026088 Bacteria 848
129 Ga0209371_1005805 3300027312 Bacteria 4772
130 Ga0268266_11204563 3300028379 Bacteria 732
131 Ga0265319_1001183 3300028563 Bacteria 16145
132 Ga0265318_10000213 3300028577 Bacteria 50502
133 Ga0307515_10004018 3300028794 Bacteria 30712
134 Ga0307515_10009501 3300028794 Bacteria 18792
135 Ga0268256_1008723 3300030500 Bacteria 3448
136 Ga0316181_1041267 3300030744 Bacteria 2790
137 Ga0265330_10000469 3300031235 Bacteria 27057
138 Ga0265332_10000178 3300031238 Bacteria 52516
139 Ga0265332_10041889 3300031238 Bacteria 1980
140 Ga0265320_10000050 3300031240 Bacteria 116002
141 Ga0265320_10040645 3300031240 Bacteria 2318
142 Ga0265325_10033366 3300031241 Bacteria 2744
143 Ga0265325_10067689 3300031241 Bacteria 1799
144 Ga0265329_10000153 3300031242 Bacteria 33838
145 Ga0265340_10000160 3300031247 Bacteria 33915
146 Ga0265340_10029443 3300031247 Bacteria 2758
147 Ga0265339_10003160 3300031249 Bacteria 11595
148 Ga0265339_10007154 3300031249 Bacteria 7241
149 Ga0265331_10001723 3300031250 Bacteria 15748
150 Ga0265316_10000479 3300031344 Bacteria 45442
151 Ga0265316_10048036 3300031344 Bacteria 3372
152 Ga0307408_100003962 3300031548 Bacteria 10084
153 Ga0265313_10000040 3300031595 Bacteria 120713
154 Ga0265314_10000001 3300031711 Bacteria 3792860
155 Ga0265314_10000600 3300031711 Bacteria 44965
156 Ga0265314_10071820 3300031711 Bacteria 2314
157 Ga0265342_10000037 3300031712 Bacteria 140873
158 Ga0265342_10068396 3300031712 Bacteria 2076
159 Ga0307412_10000005 3300031911 Bacteria 526194
160 Ga0307412_10010091 3300031911 Bacteria 5433
161 Ga0307416_100079777 3300032002 Bacteria 2760
162 Ga0373933_0614567 3300035724 Bacteria 714
163 Ga0373937_0114859 3300036401 Bacteria 2506
164 Ga0436361_0285442 3300039447 Bacteria 14396
165 Ga0436361_0442513 3300039447 Bacteria 5494
166 Ga0436361_0610630 3300039447 Bacteria 6546
167 Ga0436361_1173244 3300039447 Bacteria 1851
168 Ga0450888_037241 3300042126 Bacteria 668
169 Ga0466965_0293833 3300044683 Bacteria 880
170 Ga0466961_0314322 3300044693 Bacteria 956
171 Ga0453684_0000125 3300044712 Bacteria 336972
172 Ga0466957_0045921 3300044842 Bacteria 2650
173 Ga0466967_0443272 3300045976 Bacteria 1268
174 Ga0495617_000958 3300046452 Bacteria 13415
175 Ga0495617_002021 3300046452 Bacteria 8449
176 Ga0495592_0007631 3300046454 Bacteria 8101
177 Ga0495592_0237578 3300046454 Bacteria 1210
178 Ga0495590_0000036 3300046457 Bacteria 129241
179 Ga0495590_0003654 3300046457 Bacteria 6261
180 Ga0495590_0012799 3300046457 Bacteria 3102
181 Ga0495590_0100211 3300046457 Bacteria 1029
182 Ga0495591_018231 3300046458 Bacteria 2384
183 Ga0495629_0000563 3300046459 Bacteria 30235
184 Ga0495629_0073604 3300046459 Bacteria 2385
185 Ga0495629_0223918 3300046459 Bacteria 1297
186 Ga0495638_0000114 3300046460 Bacteria 129141
187 Ga0495638_0172345 3300046460 Bacteria 1240
188 Ga0495641_0005383 3300046461 Bacteria 8664
189 Ga0495651_0001916 3300046462 Bacteria 16111
190 Ga0495651_0002954 3300046462 Bacteria 13138
191 Ga0495651_0067568 3300046462 Bacteria 2726
192 Ga0495651_0118643 3300046462 Bacteria 1946
193 Ga0495653_0027419 3300046463 Bacteria 4558
194 Ga0495653_0043252 3300046463 Bacteria 3503
195 Ga0495653_0149064 3300046463 Bacteria 1636
196 Ga0495653_0154828 3300046463 Bacteria 1597
197 Ga0495650_0000105 3300046471 Bacteria 205855
198 Ga0495650_0000200 3300046471 Bacteria 130223
199 Ga0495650_0004754 3300046471 Bacteria 9130
200 Ga0495650_0005800 3300046471 Bacteria 7881
201 Ga0495650_0050092 3300046471 Bacteria 1729
202 Ga0495650_0090893 3300046471 Bacteria 1161
203 Ga0495580_0004078 3300046472 Bacteria 12315
204 Ga0495580_0004489 3300046472 Bacteria 11727
205 Ga0495580_0008054 3300046472 Bacteria 8410
206 Ga0495580_0009556 3300046472 Bacteria 7618
207 Ga0495580_0143951 3300046472 Bacteria 1652
208 Ga0495580_0471462 3300046472 Bacteria 840
209 Ga0495582_0001146 3300046473 Bacteria 14879
210 Ga0495582_0043986 3300046473 Bacteria 2459
211 Ga0495582_0059268 3300046473 Bacteria 2112
212 Ga0495605_0012017 3300046474 Bacteria 4814
213 Ga0495605_0165956 3300046474 Bacteria 978
214 Ga0495639_0005206 3300046475 Bacteria 5587
215 Ga0495662_0015643 3300046476 Bacteria 3682
216 Ga0495662_0082505 3300046476 Bacteria 1564
217 Ga0495664_0003639 3300046477 Bacteria 8407
218 Ga0495585_0000020 3300046492 Bacteria 156639
219 Ga0495596_0026526 3300046500 Bacteria 2334
220 Ga0495607_0243966 3300046501 Bacteria 868
221 Ga0495583_0000071 3300046506 Bacteria 183691
222 Ga0495583_0000259 3300046506 Bacteria 87422
223 Ga0495583_0001558 3300046506 Bacteria 22670
224 Ga0495606_0002526 3300046507 Bacteria 21043
225 Ga0495606_0003167 3300046507 Bacteria 17804
226 Ga0495606_0003736 3300046507 Bacteria 15860
227 Ga0495606_0004504 3300046507 Bacteria 13881
228 Ga0495606_0007764 3300046507 Bacteria 9493
229 Ga0495606_0014082 3300046507 Bacteria 6263
230 Ga0495606_0019183 3300046507 Bacteria 5099
231 Ga0495606_0094720 3300046507 Bacteria 1829
232 Ga0495606_0206501 3300046507 Bacteria 1116
233 Ga0495608_0003296 3300046511 Bacteria 11540
234 Ga0495608_0012157 3300046511 Bacteria 5982
235 Ga0495608_0145734 3300046511 Bacteria 1510
236 Ga0495610_0001665 3300046512 Bacteria 19541
237 Ga0495610_0018493 3300046512 Bacteria 3932
238 Ga0495610_0022792 3300046512 Bacteria 3416
239 Ga0495610_0081715 3300046512 Bacteria 1482
240 Ga0495616_0000699 3300046513 Bacteria 24846
241 Ga0495618_0002752 3300046514 Bacteria 11183
242 Ga0495618_0004477 3300046514 Bacteria 8590
243 Ga0495618_0140650 3300046514 Bacteria 1544
244 Ga0495618_0174402 3300046514 Bacteria 1367
245 Ga0495620_0022514 3300046515 Bacteria 3033
246 Ga0495620_0108733 3300046515 Bacteria 1100
247 Ga0495628_0000623 3300046516 Bacteria 32379
248 Ga0495628_0033766 3300046516 Bacteria 4120
249 Ga0495628_0083870 3300046516 Bacteria 2473
250 Ga0495628_0085871 3300046516 Bacteria 2440
251 Ga0495628_0225657 3300046516 Bacteria 1405
252 Ga0495628_0306110 3300046516 Bacteria 1175
253 Ga0495628_0455623 3300046516 Bacteria 928
254 Ga0495630_0015802 3300046517 Bacteria 5515
255 Ga0495630_0044594 3300046517 Bacteria 3314
256 Ga0495630_0172206 3300046517 Bacteria 1649
257 Ga0495630_0296460 3300046517 Bacteria 1235
258 Ga0495632_0110161 3300046519 Bacteria 1293
259 Ga0495632_0176312 3300046519 Bacteria 980
260 Ga0495637_0038975 3300046520 Bacteria 2054
261 Ga0495643_0000646 3300046522 Bacteria 41289
262 Ga0495643_0001182 3300046522 Bacteria 25428
263 Ga0495643_0043231 3300046522 Bacteria 2453
264 Ga0495643_0125134 3300046522 Bacteria 1295
265 Ga0495648_0000031 3300046524 Bacteria 213136
266 Ga0495648_0000035 3300046524 Bacteria 196251
267 Ga0495648_0009475 3300046524 Bacteria 7539
268 Ga0495648_0012312 3300046524 Bacteria 6389
269 Ga0495648_0022446 3300046524 Bacteria 4344
270 Ga0495648_0079772 3300046524 Bacteria 1866
271 Ga0495666_0000559 3300046526 Bacteria 16637
272 Ga0495666_0020566 3300046526 Bacteria 3268
273 Ga0495666_0069221 3300046526 Bacteria 1679
274 Ga0495666_0110900 3300046526 Bacteria 1288
275 Ga0495642_0007660 3300046528 Bacteria 4138
276 Ga0495652_0002243 3300046529 Bacteria 20215
277 Ga0495652_0016325 3300046529 Bacteria 6642
278 Ga0495652_0033199 3300046529 Bacteria 4508
279 Ga0495652_0172522 3300046529 Bacteria 1668
280 Ga0495652_0221006 3300046529 Bacteria 1423
281 Ga0495652_0515010 3300046529 Bacteria 828
282 Ga0495665_0019579 3300046531 Bacteria 3640
283 Ga0495665_0080806 3300046531 Bacteria 1709
284 Ga0495665_0150158 3300046531 Bacteria 1216
285 Ga0495640_0030255 3300046533 Bacteria 3878
286 Ga0495640_0088151 3300046533 Bacteria 2052
287 Ga0495586_0284369 3300046535 Bacteria 947
288 Ga0495586_0573725 3300046535 Bacteria 651
289 Ga0495587_0013594 3300046536 Bacteria 5116
290 Ga0495609_0093000 3300046538 Bacteria 1310
291 Ga0495621_0122436 3300046539 Bacteria 1006
292 Ga0495597_0001219 3300046542 Bacteria 19132
293 Ga0495597_0001367 3300046542 Bacteria 17636
294 Ga0495597_0077178 3300046542 Bacteria 1428
295 Ga0495597_0103298 3300046542 Bacteria 1200
296 Ga0495622_0000032 3300046557 Bacteria 125538
297 Ga0495622_0001975 3300046557 Bacteria 10052
298 Ga0495622_0005232 3300046557 Bacteria 6014
299 Ga0495622_0101306 3300046557 Bacteria 1320
300 Ga0495622_0153062 3300046557 Bacteria 1043
301 Ga0495633_0000452 3300046558 Bacteria 42120
302 Ga0495633_0000601 3300046558 Bacteria 34582
303 Ga0495633_0008930 3300046558 Bacteria 5585
304 Ga0495633_0343449 3300046558 Bacteria 676
305 Ga0495667_0116995 3300046559 Bacteria 1722
306 Ga0495668_0001868 3300046616 Bacteria 18872
307 Ga0495634_0008882 3300046642 Bacteria 7449
308 Ga0495634_0022897 3300046642 Bacteria 4398
309 Ga0495634_0194844 3300046642 Bacteria 1261
310 Ga0495611_0120175 3300046648 Bacteria 1225
311 Ga0495625_0000273 3300046660 Bacteria 80579
312 Ga0495625_0001516 3300046660 Bacteria 27842
313 Ga0495625_0010111 3300046660 Bacteria 7838
314 Ga0495625_0019878 3300046660 Bacteria 5197
315 Ga0495625_0047879 3300046660 Bacteria 3082
316 Ga0495625_0176715 3300046660 Bacteria 1422
317 Ga0495625_0306306 3300046660 Bacteria 1015
318 Ga0495635_0048834 3300046663 Bacteria 2917
319 Ga0495635_0202129 3300046663 Bacteria 1347
320 Ga0495635_0339717 3300046663 Bacteria 1003
321 Ga0495661_0087549 3300046665 Bacteria 1780
322 Ga0495661_0164043 3300046665 Bacteria 1190
323 Ga0495588_0257275 3300046674 Bacteria 920
324 Ga0495588_0331728 3300046674 Bacteria 800
325 Ga0495657_0179441 3300046675 Bacteria 1300
326 Ga0495599_0001266 3300046678 Bacteria 14349
327 Ga0495599_0131683 3300046678 Bacteria 1553
328 Ga0495623_0001206 3300046679 Bacteria 17514
329 Ga0495623_0002534 3300046679 Bacteria 12084
330 Ga0495623_0101830 3300046679 Bacteria 1749
331 Ga0495646_0000348 3300046680 Bacteria 23747
332 Ga0495646_0014401 3300046680 Bacteria 5030
333 Ga0495646_0021243 3300046680 Bacteria 4103
334 Ga0495646_0021878 3300046680 Bacteria 4038
335 Ga0495646_0032086 3300046680 Bacteria 3269
336 Ga0495658_0094527 3300046683 Bacteria 1775
337 Ga0495669_0050000 3300046684 Bacteria 1873
338 Ga0495669_0108077 3300046684 Bacteria 1297
339 Ga0495669_0108959 3300046684 Bacteria 1292
340 Ga0495613_0003606 3300046689 Bacteria 11601
341 Ga0495624_0002531 3300046690 Bacteria 13833
342 Ga0495624_0024177 3300046690 Bacteria 3999
343 Ga0495624_0026937 3300046690 Bacteria 3765
344 Ga0495624_0035992 3300046690 Bacteria 3193
345 Ga0495624_0048305 3300046690 Bacteria 2701
346 Ga0495624_0048583 3300046690 Bacteria 2692
347 Ga0495670_0110807 3300046691 Bacteria 1420
348 Ga0495671_0016583 3300046692 Bacteria 3930
349 Ga0495671_0092833 3300046692 Bacteria 1477
350 Ga0495671_0152961 3300046692 Bacteria 1123
351 Ga0495649_0000144 3300046694 Bacteria 62066
352 Ga0495649_0022021 3300046694 Bacteria 3569
353 Ga0495649_0032549 3300046694 Bacteria 2871
354 Ga0495649_0058686 3300046694 Bacteria 2073
355 Ga0495649_0060489 3300046694 Bacteria 2038
356 Ga0495589_0003851 3300046794 Bacteria 8067
357 Ga0495589_0007160 3300046794 Bacteria 5846
358 Ga0495589_0058562 3300046794 Bacteria 1894
359 Ga0495589_0077777 3300046794 Bacteria 1616
360 Ga0495589_0095645 3300046794 Bacteria 1441
361 Ga0495600_0001057 3300046809 Bacteria 14917
362 Ga0495600_0051393 3300046809 Bacteria 2690
363 Ga0495600_0111088 3300046809 Bacteria 1784
364 Ga0495660_0002666 3300046810 Bacteria 11301
365 Ga0495660_0003341 3300046810 Bacteria 9950
366 Ga0495660_0005853 3300046810 Bacteria 7335
367 Ga0495581_0156459 3300047315 Bacteria 1332
368 Ga0495604_0006383 3300047317 Bacteria 9351
369 Ga0495604_0010378 3300047317 Bacteria 7379
370 Ga0495604_0010921 3300047317 Bacteria 7210
371 Ga0495604_0021877 3300047317 Bacteria 5104
372 Ga0495674_0024814 3300047319 Bacteria 5504
373 Ga0495674_0100002 3300047319 Bacteria 2468
374 Ga0495674_0346096 3300047319 Bacteria 1207
375 Ga0495672_0000427 3300047320 Bacteria 50460
376 Ga0495676_0094875 3300047321 Bacteria 2221
377 Ga0495676_0096946 3300047321 Bacteria 2191
378 Ga0495676_0099089 3300047321 Bacteria 2160
379 Ga0495680_0012750 3300047322 Bacteria 7374
380 Ga0495680_0021370 3300047322 Bacteria 5419
381 Ga0495680_0068688 3300047322 Bacteria 2706
382 Ga0495683_0013268 3300047323 Bacteria 4313
383 Ga0495683_0043576 3300047323 Bacteria 2258
384 Ga0495683_0055213 3300047323 Bacteria 1978
385 Ga0495683_0078621 3300047323 Bacteria 1611
386 Ga0495683_0107678 3300047323 Bacteria 1334
387 Ga0495683_0122010 3300047323 Bacteria 1235
388 Ga0495687_000685 3300047443 Bacteria 38430
389 Ga0495687_000979 3300047443 Bacteria 28873
390 Ga0495687_001575 3300047443 Bacteria 20711
391 Ga0495687_027644 3300047443 Bacteria 2651
392 Ga0495675_0006414 3300047444 Bacteria 7199
393 Ga0495675_0136644 3300047444 Bacteria 1521
394 Ga0495675_0558360 3300047444 Bacteria 652
395 Ga0495677_0006820 3300047445 Bacteria 4297
396 Ga0495679_000058 3300047446 Bacteria 110231
397 Ga0495679_003493 3300047446 Bacteria 7523
398 Ga0495679_036863 3300047446 Bacteria 1542
399 Ga0495673_0000135 3300047469 Bacteria 135338
400 Ga0495681_0013999 3300047470 Bacteria 4625
401 Ga0495681_0104624 3300047470 Bacteria 1233
402 Ga0495686_0001401 3300047472 Bacteria 26636
403 Ga0495686_0104621 3300047472 Bacteria 1704
404 Ga0495686_0171628 3300047472 Bacteria 1261
405 Ga0495593_0055866 3300047673 Bacteria 2076
406 Ga0495593_0119074 3300047673 Bacteria 1344
407 Ga0495602_0018188 3300048088 Bacteria 7029
408 Ga0495602_0057021 3300048088 Bacteria 3430
409 Ga0495602_0090360 3300048088 Bacteria 2544
410 Ga0495602_0257767 3300048088 Bacteria 1295
411 Ga0495602_0278915 3300048088 Bacteria 1232
412 Ga0495614_0051891 3300048089 Bacteria 1758
413 Ga0495614_0057552 3300048089 Bacteria 1669
414 Ga0496102_0079884 3300048905 Bacteria 3012
415 Ga0496102_0200656 3300048905 Bacteria 1880
416 Ga0496102_0201101 3300048905 Bacteria 1878
417 Ga0496102_0863267 3300048905 Bacteria 827
418 Ga0496103_0006634 3300048906 Bacteria 6903
419 Ga0496103_0156198 3300048906 Bacteria 1462
420 Ga0496103_0158181 3300048906 Bacteria 1453
421 Ga0496103_0201975 3300048906 Bacteria 1278
422 Ga0496104_0049538 3300048907 Bacteria 3961
423 Ga0496105_0192459 3300048908 Bacteria 1667
424 Ga0496108_0508054 3300048911 Bacteria 1052
425 Ga0496110_0000368 3300048913 Bacteria 30153
426 Ga0496110_0961359 3300048913 Bacteria 761
427 Ga0496111_0046830 3300048914 Bacteria 3114
428 Ga0496113_0172764 3300048916 Bacteria 1712
429 Ga0496114_0027725 3300048917 Bacteria 4642
430 Ga0496114_0178663 3300048917 Bacteria 1853
431 Ga0496114_0376388 3300048917 Bacteria 1257
432 Ga0496114_0506920 3300048917 Bacteria 1067
433 Ga0496115_0211980 3300048918 Bacteria 1600
434 Ga0496116_0063618 3300048919 Bacteria 2376
435 Ga0496117_0008707 3300048920 Bacteria 9590
436 Ga0496117_0014149 3300048920 Bacteria 6896
437 Ga0496118_0001593 3300048921 Bacteria 33628
438 Ga0496118_0047249 3300048921 Bacteria 3338
439 Ga0496118_0134228 3300048921 Bacteria 1582
440 Ga0496121_0041490 3300048924 Bacteria 4020
441 Ga0496121_0230388 3300048924 Bacteria 1298
442 Ga0496122_0135344 3300048925 Bacteria 1555
443 Ga0496126_0008215 3300048929 Bacteria 11288
444 Ga0495678_000001 3300049459 Bacteria 1060340
445 Ga0495678_000803 3300049459 Bacteria 28133
446 Ga0495678_002759 3300049459 Bacteria 11497
447 Ga0495678_004468 3300049459 Bacteria 8077
448 Ga0495678_019537 3300049459 Bacteria 3019
449 Ga0495678_022927 3300049459 Bacteria 2723
450 Ga0501263_005603 3300049760 Bacteria 1423
451 Ga0501269_000068 3300049766 Bacteria 32230
452 nmdc:mga0k408_228985_c1 3300050493 Bacteria 1110
453 nmdc:mga0n895_72425_c1 3300050512 Bacteria 3418
454 nmdc:mga0n895_742147_c1 3300050512 Bacteria 975
455 Ga0495601_0191679 3300053077 Bacteria 1336
456 Ga0500635_0156205 3300053080 Bacteria 873
457 Ga0495619_0270412 3300053085 Bacteria 1178
458 Ga0500595_002834 3300053119 Bacteria 8334
459 Ga0500608_138669 3300053122 Bacteria 1081
460 Ga0500658_0156627 3300053134 Bacteria 1029
461 Ga0500559_0060188 3300053136 Bacteria 1691
462 Ga0500574_026709 3300053141 Bacteria 1517
463 Ga0500586_002231 3300053145 Bacteria 4309
464 Ga0500636_0010675 3300053177 Bacteria 5362
465 2501075809 2501025501 Bacteria 7768574
466 2501081523 2501025502 Bacteria 9641094
467 2501411288 2501025504 Bacteria 8008976
468 2509130396 2508501125 Bacteria 7208311
469 2510250461 2510065045 Bacteria 7761063
470 2511089084 2510917013 Bacteria 9951648
471 2511100069 2510917014 Bacteria 8296963
472 2511104048 2510917015 Bacteria 7950052
473 2512347988 2512047030 Bacteria 9031815
474 2512353238 2512047030 Bacteria 9031815
475 2513552679 2513237082 Bacteria 8640282
476 2513565604 2513237083 Bacteria 8410967
477 2513963197 2513237151 Bacteria 6309801
478 2516021260 2515154189 Bacteria 9629850
479 2527077119 2526164713 Bacteria 6780608
480 2587728929 2585428057 Bacteria 6737412
481 2600813021 2600255067 Bacteria 6795583
482 2644211408 2643221638 Bacteria 6579467
483 2719639608 2718217991 Bacteria 7829542
484 2738823300 2738541296 Bacteria 7285013
485 2738835598 2738541298 Bacteria 7286732
486 2738877221 2738541306 Bacteria 7284992
487 2739188927 2738543002 Bacteria 7284546
488 2739223814 2738543008 Bacteria 7282815
489 2746091824 2744054900 Bacteria 8399525
490 2746095973 2744054901 Bacteria 8397047
491 2753568018 2751185846 Bacteria 7242164
492 2808971936 2808606384 Bacteria 8474373
493 2809006765 2808606390 Bacteria 8476311
494 2809013903 2808606391 Bacteria 8308166
495 2819542841 2818991436 Bacteria 5376622
496 2819622209 2818991450 Bacteria 6962147
497 2842330025 2842324504 Bacteria 9364110
498 2842356263 2842348783 Bacteria 9002918
499 2842457590 2842454564 Bacteria 8730687
500 2842712000 2842711865 Bacteria 7155354
501 2856293994 2856287931 Bacteria 7223934
502 2857362569 2857357740 Bacteria 9937880
503 2857554768 2857553236 Bacteria 6166726
504 2858689874 2858688981 Bacteria 8184122
505 2883094069 2883087390 Bacteria 9532701
506 2885273151 2885270888 Bacteria 9831543
507 2900635667 2900634093 Bacteria 10263517
508 2904429010 2904424332 Bacteria 7633521
509 2904487206 2904483920 Bacteria 7545285
510 2904569851 2904564687 Bacteria 7609577
511 2904577129 2904571731 Bacteria 7608790
512 2904619715 2904615490 Bacteria 10047340
513 2919528512 2919527303 Bacteria 7718827
514 2928113130 2928108538 Bacteria 7360024
515 2928140289 2928135762 Bacteria 7259641
516 2928507848 2928503688 Bacteria 7268108
517 2928542421 2928536128 Bacteria 7657547
518 2945936096 2945934425 Bacteria 7444609
519 2990710000 2990703756 Bacteria 7715990
520 642422537 641736151 Bacteria 7477263
521 642620869 642555113 Bacteria 8214658
522 644747292 644736347 Bacteria 6476522
523 8003958690 8003955200 Bacteria 8601927
524 8055271405 8055266321 Bacteria 7999742
525 8055306113 8055301274 Bacteria 8587385
526 Ga0182008_10025532
527 JGI24740J21852_10014512
528 JGI24739J22299_10012698
529 JGI24739J22299_10040143
530 JGI24739J22299_10065150
531 JGI24737J22298_10021738
532 JGI24737J22298_10038089
533 JGI24735J21928_10026234
534 JGI24735J21928_10032797
535 JGI24738J21930_10018827
536 JGI25156J39149_1001325
537 JGI25156J39149_1001850
538 JGI25156J39149_1001909
539 JGI25156J39149_1008138
540 JGI25162J39368_1000001
541 JGI25165J46597_1000001
542 JGI25165J46597_1001862
543 rootH1_10099099
544 Ga0055538_1000001
545 Ga0055539_1000001
546 Ga0055533_1000003
547 Ga0055533_1000549
548 Ga0055532_1000063
549 Ga0055525_1000003
550 Ga0055527_1000049
551 Ga0055535_1000042
552 Ga0055542_1000071
553 Ga0055529_1000081
554 Ga0055526_1000033
555 Ga0055526_1002196
556 Ga0055537_1000255
557 Ga0055524_1000027
558 Ga0055524_1036780
559 Ga0055534_1000130
560 Ga0055528_1000043
561 Ga0055530_10026770
562 Ga0055541_1000001
563 Ga0065165_1006240
564 Ga0065165_1040736
565 Ga0065704_10132075
566 Ga0065707_10098405
567 Ga0070689_100031020
568 Ga0070689_100957570
569 Ga0070687_100592704
570 Ga0070661_100053185
571 Ga0070659_100002059
572 Ga0070714_100011313
573 Ga0070663_100210284
574 Ga0070698_100016930
575 Ga0070696_100450868
576 Ga0070664_100292259
577 Ga0068863_100171842
578 Ga0068858_100334520
579 Ga0070712_100140036
580 Ga0075434_100068860
581 Ga0105251_10000613
582 Ga0105244_10022540
583 Ga0105240_11293857
584 Ga0105248_10551337
585 Ga0105248_11632012
586 Ga0105238_11136957
587 Ga0105249_10431409
588 Ga0163163_10275171
589 Ga0157380_10241908
590 Ga0182008_10263010
591 Ga0157379_10387826
592 Ga0182006_1022416
593 Ga0182007_10002364
594 Ga0182007_10004304
595 Ga0182007_10005586
596 Ga0182005_1000117
597 Ga0213872_10000135
598 Ga0213872_10147791
599 Ga0209760_101766
600 Ga0209784_100004
601 Ga0209566_100004
602 Ga0209674_100006
603 Ga0209674_100013
604 Ga0209674_100174
605 Ga0209672_100010
606 Ga0209147_100006
607 Ga0209563_100009
608 Ga0207427_100424
609 Ga0209437_100004
610 Ga0209258_100010
611 Ga0209677_100005
612 Ga0209677_109287
613 Ga0209148_1000018
614 Ga0209759_1000250
615 Ga0209759_1000690
616 Ga0209759_1001680
617 Ga0209759_1013536
618 Ga0209759_1023621
619 Ga0209233_1000005
620 Ga0209233_1000171
621 Ga0209565_1000006
622 Ga0209565_1002486
623 Ga0209565_1006639
624 Ga0209455_1000015
625 Ga0209673_1000004
626 Ga0209673_1001671
627 Ga0209675_1000006
628 Ga0209564_1000006
629 Ga0209564_1000085
630 Ga0209050_1001043
631 Ga0209050_1001270
632 Ga0209256_1000013
633 Ga0209256_1000037
634 Ga0207655_1040035
635 Ga0207713_1000221
636 Ga0207647_10004631
637 Ga0207647_10019702
638 Ga0207647_10076262
639 Ga0207693_10197881
640 Ga0207657_10043004
641 Ga0207649_10011937
642 Ga0207694_10638817
643 Ga0207664_10006415
644 Ga0207690_10005233
645 Ga0207670_10253841
646 Ga0207670_10505416
647 Ga0207711_11050238
648 Ga0207679_10017860
649 Ga0207658_10138851
650 Ga0207703_10555771
651 Ga0207678_10248038
652 Ga0207641_10965233
653 Ga0209371_1005805
654 Ga0268266_11204563
655 Ga0265319_1001183
656 Ga0265318_10000213
657 Ga0307515_10004018
658 Ga0307515_10009501
659 Ga0268256_1008723
660 Ga0316181_1041267
661 Ga0265330_10000469
662 Ga0265332_10000178
663 Ga0265332_10041889
664 Ga0265320_10000050
665 Ga0265320_10040645
666 Ga0265325_10033366
667 Ga0265325_10067689
668 Ga0265329_10000153
669 Ga0265340_10000160
670 Ga0265340_10029443
671 Ga0265339_10003160
672 Ga0265339_10007154
673 Ga0265331_10001723
674 Ga0265316_10000479
675 Ga0265316_10048036
676 Ga0307408_100003962
677 Ga0265313_10000040
678 Ga0265314_10000001
679 Ga0265314_10000600
680 Ga0265314_10071820
681 Ga0265342_10000037
682 Ga0265342_10068396
683 Ga0307412_10000005
684 Ga0307412_10010091
685 Ga0307416_100079777
686 Ga0373933_0614567
687 Ga0373937_0114859
688 Ga0436361_0285442
689 Ga0436361_0442513
690 Ga0436361_0610630
691 Ga0436361_1173244
692 Ga0450888_037241
693 Ga0466965_0293833
694 Ga0466961_0314322
695 Ga0453684_0000125
696 Ga0466957_0045921
697 Ga0466967_0443272
698 Ga0495617_000958
699 Ga0495617_002021
700 Ga0495592_0007631
701 Ga0495592_0237578
702 Ga0495590_0000036
703 Ga0495590_0003654
704 Ga0495590_0012799
705 Ga0495590_0100211
706 Ga0495591_018231
707 Ga0495629_0000563
708 Ga0495629_0073604
709 Ga0495629_0223918
710 Ga0495638_0000114
711 Ga0495638_0172345
712 Ga0495641_0005383
713 Ga0495651_0001916
714 Ga0495651_0002954
715 Ga0495651_0067568
716 Ga0495651_0118643
717 Ga0495653_0027419
718 Ga0495653_0043252
719 Ga0495653_0149064
720 Ga0495653_0154828
721 Ga0495650_0000105
722 Ga0495650_0000200
723 Ga0495650_0004754
724 Ga0495650_0005800
725 Ga0495650_0050092
726 Ga0495650_0090893
727 Ga0495580_0004078
728 Ga0495580_0004489
729 Ga0495580_0008054
730 Ga0495580_0009556
731 Ga0495580_0143951
732 Ga0495580_0471462
733 Ga0495582_0001146
734 Ga0495582_0043986
735 Ga0495582_0059268
736 Ga0495605_0012017
737 Ga0495605_0165956
738 Ga0495639_0005206
739 Ga0495662_0015643
740 Ga0495662_0082505
741 Ga0495664_0003639
742 Ga0495585_0000020
743 Ga0495596_0026526
744 Ga0495607_0243966
745 Ga0495583_0000071
746 Ga0495583_0000259
747 Ga0495583_0001558
748 Ga0495606_0002526
749 Ga0495606_0003167
750 Ga0495606_0003736
751 Ga0495606_0004504
752 Ga0495606_0007764
753 Ga0495606_0014082
754 Ga0495606_0019183
755 Ga0495606_0094720
756 Ga0495606_0206501
757 Ga0495608_0003296
758 Ga0495608_0012157
759 Ga0495608_0145734
760 Ga0495610_0001665
761 Ga0495610_0018493
762 Ga0495610_0022792
763 Ga0495610_0081715
764 Ga0495616_0000699
765 Ga0495618_0002752
766 Ga0495618_0004477
767 Ga0495618_0140650
768 Ga0495618_0174402
769 Ga0495620_0022514
770 Ga0495620_0108733
771 Ga0495628_0000623
772 Ga0495628_0033766
773 Ga0495628_0083870
774 Ga0495628_0085871
775 Ga0495628_0225657
776 Ga0495628_0306110
777 Ga0495628_0455623
778 Ga0495630_0015802
779 Ga0495630_0044594
780 Ga0495630_0172206
781 Ga0495630_0296460
782 Ga0495632_0110161
783 Ga0495632_0176312
784 Ga0495637_0038975
785 Ga0495643_0000646
786 Ga0495643_0001182
787 Ga0495643_0043231
788 Ga0495643_0125134
789 Ga0495648_0000031
790 Ga0495648_0000035
791 Ga0495648_0009475
792 Ga0495648_0012312
793 Ga0495648_0022446
794 Ga0495648_0079772
795 Ga0495666_0000559
796 Ga0495666_0020566
797 Ga0495666_0069221
798 Ga0495666_0110900
799 Ga0495642_0007660
800 Ga0495652_0002243
801 Ga0495652_0016325
802 Ga0495652_0033199
803 Ga0495652_0172522
804 Ga0495652_0221006
805 Ga0495652_0515010
806 Ga0495665_0019579
807 Ga0495665_0080806
808 Ga0495665_0150158
809 Ga0495640_0030255
810 Ga0495640_0088151
811 Ga0495586_0284369
812 Ga0495586_0573725
813 Ga0495587_0013594
814 Ga0495609_0093000
815 Ga0495621_0122436
816 Ga0495597_0001219
817 Ga0495597_0001367
818 Ga0495597_0077178
819 Ga0495597_0103298
820 Ga0495622_0000032
821 Ga0495622_0001975
822 Ga0495622_0005232
823 Ga0495622_0101306
824 Ga0495622_0153062
825 Ga0495633_0000452
826 Ga0495633_0000601
827 Ga0495633_0008930
828 Ga0495633_0343449
829 Ga0495667_0116995
830 Ga0495668_0001868
831 Ga0495634_0008882
832 Ga0495634_0022897
833 Ga0495634_0194844
834 Ga0495611_0120175
835 Ga0495625_0000273
836 Ga0495625_0001516
837 Ga0495625_0010111
838 Ga0495625_0019878
839 Ga0495625_0047879
840 Ga0495625_0176715
841 Ga0495625_0306306
842 Ga0495635_0048834
843 Ga0495635_0202129
844 Ga0495635_0339717
845 Ga0495661_0087549
846 Ga0495661_0164043
847 Ga0495588_0257275
848 Ga0495588_0331728
849 Ga0495657_0179441
850 Ga0495599_0001266
851 Ga0495599_0131683
852 Ga0495623_0001206
853 Ga0495623_0002534
854 Ga0495623_0101830
855 Ga0495646_0000348
856 Ga0495646_0014401
857 Ga0495646_0021243
858 Ga0495646_0021878
859 Ga0495646_0032086
860 Ga0495658_0094527
861 Ga0495669_0050000
862 Ga0495669_0108077
863 Ga0495669_0108959
864 Ga0495613_0003606
865 Ga0495624_0002531
866 Ga0495624_0024177
867 Ga0495624_0026937
868 Ga0495624_0035992
869 Ga0495624_0048305
870 Ga0495624_0048583
871 Ga0495670_0110807
872 Ga0495671_0016583
873 Ga0495671_0092833
874 Ga0495671_0152961
875 Ga0495649_0000144
876 Ga0495649_0022021
877 Ga0495649_0032549
878 Ga0495649_0058686
879 Ga0495649_0060489
880 Ga0495589_0003851
881 Ga0495589_0007160
882 Ga0495589_0058562
883 Ga0495589_0077777
884 Ga0495589_0095645
885 Ga0495600_0001057
886 Ga0495600_0051393
887 Ga0495600_0111088
888 Ga0495660_0002666
889 Ga0495660_0003341
890 Ga0495660_0005853
891 Ga0495581_0156459
892 Ga0495604_0006383
893 Ga0495604_0010378
894 Ga0495604_0010921
895 Ga0495604_0021877
896 Ga0495674_0024814
897 Ga0495674_0100002
898 Ga0495674_0346096
899 Ga0495672_0000427
900 Ga0495676_0094875
901 Ga0495676_0096946
902 Ga0495676_0099089
903 Ga0495680_0012750
904 Ga0495680_0021370
905 Ga0495680_0068688
906 Ga0495683_0013268
907 Ga0495683_0043576
908 Ga0495683_0055213
909 Ga0495683_0078621
910 Ga0495683_0107678
911 Ga0495683_0122010
912 Ga0495687_000685
913 Ga0495687_000979
914 Ga0495687_001575
915 Ga0495687_027644
916 Ga0495675_0006414
917 Ga0495675_0136644
918 Ga0495675_0558360
919 Ga0495677_0006820
920 Ga0495679_000058
921 Ga0495679_003493
922 Ga0495679_036863
923 Ga0495673_0000135
924 Ga0495681_0013999
925 Ga0495681_0104624
926 Ga0495686_0001401
927 Ga0495686_0104621
928 Ga0495686_0171628
929 Ga0495593_0055866
930 Ga0495593_0119074
931 Ga0495602_0018188
932 Ga0495602_0057021
933 Ga0495602_0090360
934 Ga0495602_0257767
935 Ga0495602_0278915
936 Ga0495614_0051891
937 Ga0495614_0057552
938 Ga0496102_0079884
939 Ga0496102_0200656
940 Ga0496102_0201101
941 Ga0496102_0863267
942 Ga0496103_0006634
943 Ga0496103_0156198
944 Ga0496103_0158181
945 Ga0496103_0201975
946 Ga0496104_0049538
947 Ga0496105_0192459
948 Ga0496108_0508054
949 Ga0496110_0000368
950 Ga0496110_0961359
951 Ga0496111_0046830
952 Ga0496113_0172764
953 Ga0496114_0027725
954 Ga0496114_0178663
955 Ga0496114_0376388
956 Ga0496114_0506920
957 Ga0496115_0211980
958 Ga0496116_0063618
959 Ga0496117_0008707
960 Ga0496117_0014149
961 Ga0496118_0001593
962 Ga0496118_0047249
963 Ga0496118_0134228
964 Ga0496121_0041490
965 Ga0496121_0230388
966 Ga0496122_0135344
967 Ga0496126_0008215
968 Ga0495678_000001
969 Ga0495678_000803
970 Ga0495678_002759
971 Ga0495678_004468
972 Ga0495678_019537
973 Ga0495678_022927
974 Ga0501263_005603
975 Ga0501269_000068
976 nmdc:mga0k408_228985_c1
977 nmdc:mga0n895_72425_c1
978 nmdc:mga0n895_742147_c1
979 Ga0495601_0191679
980 Ga0500635_0156205
981 Ga0495619_0270412
982 Ga0500595_002834
983 Ga0500608_138669
984 Ga0500658_0156627
985 Ga0500559_0060188
986 Ga0500574_026709
987 Ga0500586_002231
988 Ga0500636_0010675
989 2501075809
990 2501081523
991 2501411288
992 2509130396
993 2510250461
994 2511089084
995 2511100069
996 2511104048
997 2512347988
998 2512353238
999 2513552679
1000 2513565604
1001 2513963197
1002 2516021260
1003 2527077119
1004 2587728929
1005 2600813021
1006 2644211408
1007 2719639608
1008 2738823300
1009 2738835598
1010 2738877221
1011 2739188927
1012 2739223814
1013 2746091824
1014 2746095973
1015 2753568018
1016 2808971936
1017 2809006765
1018 2809013903
1019 2819542841
1020 2819622209
1021 2842330025
1022 2842356263
1023 2842457590
1024 2842712000
1025 2856293994
1026 2857362569
1027 2857554768
1028 2858689874
1029 2883094069
1030 2885273151
1031 2900635667
1032 2904429010
1033 2904487206
1034 2904569851
1035 2904577129
1036 2904619715
1037 2919528512
1038 2928113130
1039 2928140289
1040 2928507848
1041 2928542421
1042 2945936096
1043 2990710000
1044 642422537
1045 642620869
1046 644747292
1047 8003958690
1048 8055271405
1049 8055306113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

31

214

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8421 5 190
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.839 6 189
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8231 6 189
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8221 5 190
5v89-assembly1.cif.gz_A structure of dcn4 pony domain bound to cul1 whb 0.6323 130 190
ID Description Score Start End Superfamily
af_P18961_112_329_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5618 153 179 3.40.30.10
4heaS00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5366 135 162 1.10.287.3510
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5238 97 190 1.10.238.10
5i44J00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5236 142 192 1.10.1660.10
af_M0RC90_138_201_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.523 130 162 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A3D1FH92-F1-model_v4 deleted 0.9648 112 188
AF-A0A368YNJ5-F1-model_v4 K+-transporting ATPase C subunit 0.9543 113 189 GO:0005524
GO:0005886
GO:0008556
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.953 123 189 GO:0005524
GO:0005886
GO:0008556
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9518 117 189 GO:0005524
GO:0005886
GO:0008556
AF-A0A3D2NZ12-F1-model_v4 deleted 0.9487 112 188

Map