F459140

General Info

Members Datasets Scaffolds Average Seq Length
524 301 1048 143

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10004595|Ga0213876_100045954
Length 138
Sequence MTGNPIAIRDIDHVVFRVVDLERVAGFWRDVLGAAFEKHQAEIGLYQLRVGASLVDLVPVDGKLGRMGGAAPGREGRNVDHVAFRVPDWDEAAILAHLAAHGIEAEVSRRYGADGEGPSIYLHDPEGNMIELKGPGEG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
196 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
199 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
200 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
203 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
279 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
289 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
291 2643221559 Lysobacter sp. Root559 Isolate Unclassified
292 2643221586 Lysobacter sp. Root667 Isolate Unclassified
293 2643221612 Lysobacter sp. Root76 Isolate Unclassified
294 2643221638 Duganella sp. Root336D2 Isolate Unclassified
295 2643221727 Lysobacter sp. Root96 Isolate Unclassified
296 2738541280 Massilia sp. GV090 Isolate Unclassified
297 2738541300 Massilia sp. GV016 Isolate Unclassified
298 2738543018 Massilia sp. GV045 Isolate Unclassified
299 2738543030 Massilia sp. GV097 Isolate Unclassified
300 2842711865 Duganella sp. R-73148 Isolate Unclassified
301 2857558681 Duganella sp. R-74565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.19
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 6.49
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10004595 3300021384 Bacteria 7698
2 JGI25154J39366_1000618 3300002738 Bacteria 16914
3 JGI25152J39213_1000357 3300002773 Bacteria 28520
4 JGI25150J39212_1005203 3300002774 Bacteria 2803
5 JGI25159J45721_1001435 3300002987 Bacteria 9848
6 rootL2_10007214 3300003322 Bacteria 7727
7 rootH1_10004360 3300003323 Bacteria 8743
8 Ga0055537_1010727 3300003773 Bacteria 1911
9 Ga0055524_1001429 3300003775 Bacteria 13729
10 Ga0055524_1002877 3300003775 Bacteria 8618
11 Ga0055534_1014177 3300003784 Bacteria 1503
12 Ga0055530_10002715 3300003791 Bacteria 10995
13 Ga0055543_1003791 3300004625 Bacteria 4305
14 Ga0065165_1000156 3300005262 Bacteria 119261
15 Ga0065715_10757716 3300005293 Bacteria 625
16 Ga0065707_10353123 3300005295 Bacteria 915
17 Ga0070658_10625256 3300005327 Bacteria 934
18 Ga0070658_11242281 3300005327 Bacteria 647
19 Ga0070676_10008737 3300005328 Bacteria 5466
20 Ga0070683_100639242 3300005329 Bacteria 1019
21 Ga0070683_100868288 3300005329 Bacteria 865
22 Ga0070670_100743924 3300005331 Bacteria 883
23 Ga0070677_10280680 3300005333 Bacteria 839
24 Ga0070677_10612011 3300005333 Bacteria 604
25 Ga0068869_100003076 3300005334 Bacteria 10155
26 Ga0068869_100735268 3300005334 Bacteria 844
27 Ga0070666_10029981 3300005335 Bacteria 3581
28 Ga0070666_10141101 3300005335 Bacteria 1678
29 Ga0070666_10235411 3300005335 Bacteria 1294
30 Ga0068868_100006730 3300005338 Bacteria 8160
31 Ga0068868_100171901 3300005338 Bacteria 1794
32 Ga0070660_100040061 3300005339 Bacteria 3564
33 Ga0070660_100040342 3300005339 Bacteria 3552
34 Ga0070660_100138674 3300005339 Bacteria 1950
35 Ga0070660_100486608 3300005339 Bacteria 1026
36 Ga0070660_100767668 3300005339 Bacteria 810
37 Ga0070689_101695133 3300005340 Bacteria 575
38 Ga0070661_100001500 3300005344 Bacteria 16226
39 Ga0070661_100008214 3300005344 Bacteria 7201
40 Ga0070661_100324834 3300005344 Bacteria 1202
41 Ga0070692_10319816 3300005345 Bacteria 954
42 Ga0070669_100032735 3300005353 Bacteria 3756
43 Ga0070669_100109268 3300005353 Bacteria 2096
44 Ga0070669_100980874 3300005353 Bacteria 724
45 Ga0070675_100001332 3300005354 Bacteria 18063
46 Ga0070675_100089478 3300005354 Bacteria 2578
47 Ga0070671_100002942 3300005355 Bacteria 13239
48 Ga0070671_100004450 3300005355 Bacteria 11088
49 Ga0070671_100191470 3300005355 Bacteria 1733
50 Ga0070674_100001785 3300005356 Bacteria 11665
51 Ga0070673_100001604 3300005364 Bacteria 13366
52 Ga0070673_100067375 3300005364 Bacteria 2863
53 Ga0070673_100514967 3300005364 Bacteria 1083
54 Ga0070659_100002299 3300005366 Bacteria 13615
55 Ga0070659_100006591 3300005366 Bacteria 8385
56 Ga0070659_101290446 3300005366 Bacteria 647
57 Ga0070667_100194547 3300005367 Bacteria 1797
58 Ga0070667_100241516 3300005367 Bacteria 1613
59 Ga0070667_101043747 3300005367 Unclassified 763
60 Ga0070714_100777606 3300005435 Bacteria 926
61 Ga0070678_100066483 3300005456 Bacteria 2680
62 Ga0070678_100194650 3300005456 Bacteria 1669
63 Ga0070678_100366246 3300005456 Bacteria 1243
64 Ga0070662_100000108 3300005457 Bacteria 45797
65 Ga0070662_100001945 3300005457 Bacteria 12698
66 Ga0070662_100118177 3300005457 Bacteria 2029
67 Ga0070662_100293417 3300005457 Bacteria 1319
68 Ga0070681_10319671 3300005458 Bacteria 1462
69 Ga0068867_100247292 3300005459 Bacteria 1449
70 Ga0070699_100978098 3300005518 Unclassified 776
71 Ga0070679_100833292 3300005530 Bacteria 866
72 Ga0070684_100028635 3300005535 Bacteria 4713
73 Ga0070684_100110433 3300005535 Bacteria 2465
74 Ga0068853_100009559 3300005539 Bacteria 7812
75 Ga0068853_100030678 3300005539 Bacteria 4542
76 Ga0068853_100105221 3300005539 Bacteria 2499
77 Ga0068853_101099336 3300005539 Bacteria 766
78 Ga0070672_100238759 3300005543 Bacteria 1528
79 Ga0070672_100424982 3300005543 Bacteria 1142
80 Ga0070686_100308062 3300005544 Bacteria 1177
81 Ga0070695_100365860 3300005545 Bacteria 1084
82 Ga0070693_100038642 3300005547 Bacteria 2669
83 Ga0070693_100465421 3300005547 Bacteria 890
84 Ga0068855_100002623 3300005563 Bacteria 22150
85 Ga0068855_100051023 3300005563 Bacteria 4874
86 Ga0070664_100003246 3300005564 Bacteria 13138
87 Ga0070664_100196661 3300005564 Bacteria 1797
88 Ga0070664_100208779 3300005564 Bacteria 1745
89 Ga0068857_100073156 3300005577 Bacteria 3053
90 Ga0068854_100094087 3300005578 Bacteria 2235
91 Ga0068854_100280710 3300005578 Bacteria 1341
92 Ga0068856_100004796 3300005614 Bacteria 13406
93 Ga0068856_100023592 3300005614 Bacteria 5982
94 Ga0068856_100052398 3300005614 Bacteria 4024
95 Ga0070702_100098323 3300005615 Bacteria 1790
96 Ga0068852_100000615 3300005616 Bacteria 23368
97 Ga0068852_100001686 3300005616 Bacteria 15048
98 Ga0068852_100081926 3300005616 Bacteria 2866
99 Ga0068852_101514671 3300005616 Bacteria 693
100 Ga0068859_100468134 3300005617 Bacteria 1356
101 Ga0068864_100143693 3300005618 Bacteria 2154
102 Ga0068864_100276204 3300005618 Bacteria 1567
103 Ga0068864_100286755 3300005618 Bacteria 1538
104 Ga0068861_100000384 3300005719 Bacteria 25460
105 Ga0068861_100212584 3300005719 Bacteria 1630
106 Ga0068861_100552876 3300005719 Bacteria 1049
107 Ga0068851_10019377 3300005834 Bacteria 3287
108 Ga0068863_100371073 3300005841 Bacteria 1396
109 Ga0068863_100893037 3300005841 Bacteria 889
110 Ga0068858_100001338 3300005842 Bacteria 25419
111 Ga0068858_100027002 3300005842 Bacteria 5333
112 Ga0068858_100098909 3300005842 Bacteria 2720
113 Ga0068860_100021841 3300005843 Bacteria 6192
114 Ga0068862_100031874 3300005844 Bacteria 4452
115 Ga0068862_100163541 3300005844 Bacteria 1988
116 Ga0068862_100958340 3300005844 Bacteria 844
117 Ga0081538_10012035 3300005981 Bacteria 6966
118 Ga0070712_101073444 3300006175 Bacteria 698
119 Ga0075362_10075306 3300006177 Bacteria 1548
120 Ga0097621_100075111 3300006237 Bacteria 2800
121 Ga0075370_10073943 3300006353 Bacteria 1953
122 Ga0068871_100036905 3300006358 Bacteria 3894
123 Ga0068871_100426299 3300006358 Bacteria 1185
124 Ga0075428_100457990 3300006844 Bacteria 1366
125 Ga0075428_102131601 3300006844 Bacteria 579
126 Ga0075431_101207637 3300006847 Bacteria 719
127 Ga0075434_100336422 3300006871 Bacteria 1530
128 Ga0097620_100468038 3300006931 Bacteria 1356
129 Ga0105240_10085638 3300009093 Bacteria 3861
130 Ga0111539_10276424 3300009094 Bacteria 1954
131 Ga0105247_10236356 3300009101 Bacteria 1243
132 Ga0114129_10072315 3300009147 Bacteria 4808
133 Ga0105241_10650537 3300009174 Bacteria 957
134 Ga0105241_10709719 3300009174 Bacteria 919
135 Ga0105241_10722041 3300009174 Bacteria 911
136 Ga0105242_10000772 3300009176 Bacteria 24888
137 Ga0105248_10007485 3300009177 Bacteria 11977
138 Ga0105248_10026485 3300009177 Bacteria 6451
139 Ga0105248_10101524 3300009177 Bacteria 3243
140 Ga0105237_10053360 3300009545 Bacteria 4054
141 Ga0105238_10005726 3300009551 Bacteria 12285
142 Ga0105238_10027853 3300009551 Bacteria 5758
143 Ga0105238_10326872 3300009551 Bacteria 1520
144 Ga0105238_10769262 3300009551 Bacteria 978
145 Ga0105249_10027263 3300009553 Bacteria 5155
146 Ga0105030_121615 3300009987 Bacteria 585
147 Ga0105239_10030967 3300010375 Bacteria 5886
148 Ga0105239_10224097 3300010375 Bacteria 2109
149 Ga0105239_11626310 3300010375 Bacteria 747
150 Ga0105246_10367082 3300011119 Bacteria 1185
151 Ga0157373_10000581 3300013100 Bacteria 28415
152 Ga0157373_10253089 3300013100 Bacteria 1246
153 Ga0157371_10001857 3300013102 Bacteria 21208
154 Ga0157371_10040283 3300013102 Bacteria 3337
155 Ga0157371_10208772 3300013102 Bacteria 1401
156 Ga0157370_11022454 3300013104 Bacteria 748
157 Ga0157369_10060861 3300013105 Bacteria 4071
158 Ga0157369_10112796 3300013105 Bacteria 2888
159 Ga0157369_10139583 3300013105 Bacteria 2565
160 Ga0157374_10009696 3300013296 Bacteria 8267
161 Ga0157374_10096673 3300013296 Bacteria 2825
162 Ga0163162_10000830 3300013306 Bacteria 28736
163 Ga0163162_10074665 3300013306 Bacteria 3450
164 Ga0163162_10087311 3300013306 Bacteria 3198
165 Ga0157372_10002254 3300013307 Bacteria 20902
166 Ga0157372_10015817 3300013307 Bacteria 8093
167 Ga0157372_10122621 3300013307 Bacteria 2987
168 Ga0157372_10193263 3300013307 Bacteria 2357
169 Ga0157372_11720406 3300013307 Bacteria 721
170 Ga0157375_10020475 3300013308 Bacteria 6044
171 Ga0157375_10142600 3300013308 Bacteria 2524
172 Ga0157377_10028137 3300014745 Bacteria 3023
173 Ga0157379_10001870 3300014968 Bacteria 17410
174 Ga0157379_10022279 3300014968 Bacteria 5612
175 Ga0157376_10011825 3300014969 Bacteria 6453
176 Ga0163161_10013308 3300017792 Bacteria 5722
177 Ga0163161_10076039 3300017792 Bacteria 2464
178 Ga0206353_10635680 3300020082 Bacteria 5334
179 Ga0207425_1000001 3300025245 Bacteria 2525432
180 Ga0209646_1000049 3300025246 Bacteria 301924
181 Ga0209129_1000001 3300025258 Bacteria 1452436
182 Ga0209565_1000057 3300025263 Bacteria 196908
183 Ga0209565_1001684 3300025263 Bacteria 9156
184 Ga0209565_1004424 3300025263 Bacteria 4277
185 Ga0209565_1006004 3300025263 Bacteria 3466
186 Ga0209673_1000051 3300025273 Bacteria 282161
187 Ga0209673_1026558 3300025273 Bacteria 1898
188 Ga0209130_1000268 3300025284 Bacteria 65115
189 Ga0209675_1000027 3300025291 Bacteria 282175
190 Ga0209675_1008779 3300025291 Bacteria 3661
191 Ga0209564_1000094 3300025295 Bacteria 243176
192 Ga0209564_1000456 3300025295 Bacteria 69075
193 Ga0209564_1015365 3300025295 Bacteria 3119
194 Ga0209758_1000073 3300025297 Bacteria 276262
195 Ga0209050_1000655 3300025298 Bacteria 53550
196 Ga0209256_1000139 3300025299 Bacteria 155515
197 Ga0209256_1002336 3300025299 Bacteria 15823
198 Ga0209256_1009090 3300025299 Bacteria 4431
199 Ga0207426_1042256 3300025302 Bacteria 1408
200 Ga0209051_1106182 3300025303 Bacteria 743
201 Ga0207656_10034518 3300025321 Bacteria 2112
202 Ga0207682_10238641 3300025893 Bacteria 844
203 Ga0207642_10543155 3300025899 Bacteria 717
204 Ga0207688_10323603 3300025901 Bacteria 946
205 Ga0207680_10006319 3300025903 Bacteria 5719
206 Ga0207645_10017147 3300025907 Bacteria 4783
207 Ga0207645_10213061 3300025907 Bacteria 1273
208 Ga0207705_10080757 3300025909 Bacteria 2370
209 Ga0207684_10047185 3300025910 Bacteria 3654
210 Ga0207707_10349012 3300025912 Bacteria 1275
211 Ga0207695_10201736 3300025913 Bacteria 1903
212 Ga0207660_10330542 3300025917 Bacteria 1219
213 Ga0207657_10001637 3300025919 Bacteria 24128
214 Ga0207657_10010549 3300025919 Bacteria 9213
215 Ga0207657_10032616 3300025919 Bacteria 4703
216 Ga0207657_10058482 3300025919 Bacteria 3317
217 Ga0207649_10292215 3300025920 Bacteria 1189
218 Ga0207646_10350722 3300025922 Bacteria 1334
219 Ga0207681_10022243 3300025923 Bacteria 4042
220 Ga0207681_10496061 3300025923 Bacteria 999
221 Ga0207694_10032630 3300025924 Bacteria 3987
222 Ga0207694_10076591 3300025924 Bacteria 2620
223 Ga0207694_10377393 3300025924 Bacteria 1176
224 Ga0207694_11121061 3300025924 Bacteria 666
225 Ga0207650_11156124 3300025925 Bacteria 659
226 Ga0207659_10050781 3300025926 Bacteria 2947
227 Ga0207687_10012874 3300025927 Bacteria 5467
228 Ga0207644_10002183 3300025931 Bacteria 12690
229 Ga0207644_10048438 3300025931 Bacteria 3038
230 Ga0207644_10095960 3300025931 Bacteria 2218
231 Ga0207644_10705561 3300025931 Bacteria 841
232 Ga0207690_10002530 3300025932 Bacteria 11046
233 Ga0207690_10076946 3300025932 Bacteria 2318
234 Ga0207690_10183883 3300025932 Bacteria 1576
235 Ga0207706_10000186 3300025933 Bacteria 69567
236 Ga0207706_10006991 3300025933 Bacteria 10429
237 Ga0207706_10355134 3300025933 Bacteria 1274
238 Ga0207691_10065807 3300025940 Bacteria 3279
239 Ga0207691_10403340 3300025940 Bacteria 1166
240 Ga0207711_10001893 3300025941 Bacteria 19060
241 Ga0207711_10013899 3300025941 Bacteria 6686
242 Ga0207711_10466761 3300025941 Bacteria 1176
243 Ga0207689_10000856 3300025942 Bacteria 29352
244 Ga0207689_10474567 3300025942 Bacteria 1047
245 Ga0207661_10665889 3300025944 Bacteria 957
246 Ga0207679_10040785 3300025945 Bacteria 3326
247 Ga0207679_10388407 3300025945 Bacteria 1225
248 Ga0207679_10564731 3300025945 Bacteria 1022
249 Ga0207679_10997229 3300025945 Bacteria 768
250 Ga0207679_11558171 3300025945 Bacteria 606
251 Ga0207667_10005774 3300025949 Bacteria 15097
252 Ga0207667_10039768 3300025949 Bacteria 5009
253 Ga0207651_10172712 3300025960 Bacteria 1706
254 Ga0207651_10625987 3300025960 Bacteria 943
255 Ga0207640_10076760 3300025981 Bacteria 2269
256 Ga0207640_10492322 3300025981 Bacteria 1019
257 Ga0207640_10505289 3300025981 Bacteria 1007
258 Ga0207658_10121692 3300025986 Bacteria 2082
259 Ga0207658_10135530 3300025986 Bacteria 1985
260 Ga0207658_10345104 3300025986 Bacteria 1295
261 Ga0207677_10010028 3300026023 Bacteria 5345
262 Ga0207677_10400150 3300026023 Bacteria 1164
263 Ga0207703_10006482 3300026035 Bacteria 9344
264 Ga0207703_10325507 3300026035 Bacteria 1409
265 Ga0207639_10005702 3300026041 Bacteria 8427
266 Ga0207639_10080600 3300026041 Bacteria 2575
267 Ga0207678_10019938 3300026067 Bacteria 5894
268 Ga0207678_10580320 3300026067 Bacteria 982
269 Ga0207702_10002793 3300026078 Bacteria 16360
270 Ga0207702_10305752 3300026078 Bacteria 1510
271 Ga0207648_10035470 3300026089 Bacteria 4394
272 Ga0207648_10333821 3300026089 Bacteria 1364
273 Ga0207676_10010625 3300026095 Bacteria 6563
274 Ga0207676_10307816 3300026095 Bacteria 1449
275 Ga0207674_10039387 3300026116 Bacteria 4899
276 Ga0207674_10064475 3300026116 Bacteria 3695
277 Ga0207674_10416763 3300026116 Bacteria 1298
278 Ga0207675_100000879 3300026118 Bacteria 29982
279 Ga0207675_100012147 3300026118 Bacteria 8045
280 Ga0207683_10052440 3300026121 Bacteria 3574
281 Ga0207683_10055732 3300026121 Bacteria 3467
282 Ga0207683_10685691 3300026121 Bacteria 950
283 Ga0207698_10003937 3300026142 Bacteria 8993
284 Ga0207698_10018671 3300026142 Bacteria 4732
285 Ga0207698_10191569 3300026142 Bacteria 1822
286 Ga0207698_11673663 3300026142 Bacteria 652
287 Ga0209968_1025622 3300027526 Bacteria 972
288 Ga0209970_1001705 3300027614 Bacteria 3813
289 Ga0209974_10013696 3300027876 Bacteria 2701
290 Ga0209974_10032157 3300027876 Bacteria 1738
291 Ga0207428_10242393 3300027907 Bacteria 1346
292 Ga0268266_11058633 3300028379 Bacteria 785
293 Ga0268265_11053679 3300028380 Bacteria 805
294 Ga0268264_10927008 3300028381 Bacteria 875
295 Ga0265331_10108037 3300031250 Bacteria 1277
296 Ga0307408_100000199 3300031548 Bacteria 65275
297 Ga0307408_100020791 3300031548 Bacteria 4434
298 Ga0307408_100152378 3300031548 Bacteria 1826
299 Ga0307408_100184300 3300031548 Bacteria 1677
300 Ga0265314_10011762 3300031711 Bacteria 7199
301 Ga0307516_10002488 3300031730 Bacteria 24567
302 Ga0307516_10008487 3300031730 Bacteria 11612
303 Ga0307405_10023265 3300031731 Bacteria 3519
304 Ga0307413_10008648 3300031824 Bacteria 4822
305 Ga0307413_10237456 3300031824 Bacteria 1343
306 Ga0307518_10226867 3300031838 Bacteria 1213
307 Ga0307410_10002499 3300031852 Bacteria 8884
308 Ga0307406_10077578 3300031901 Bacteria 2198
309 Ga0307406_10140576 3300031901 Bacteria 1708
310 Ga0307406_11428765 3300031901 Bacteria 607
311 Ga0307412_10025841 3300031911 Bacteria 3642
312 Ga0307412_10067585 3300031911 Bacteria 2427
313 Ga0307412_10882954 3300031911 Bacteria 782
314 Ga0307409_100004076 3300031995 Bacteria 8123
315 Ga0307409_100021405 3300031995 Bacteria 4432
316 Ga0307409_100866879 3300031995 Bacteria 915
317 Ga0307416_100022644 3300032002 Bacteria 4539
318 Ga0307416_100043286 3300032002 Bacteria 3524
319 Ga0307416_100047668 3300032002 Bacteria 3393
320 Ga0307416_101240249 3300032002 Bacteria 851
321 Ga0307414_10000329 3300032004 Bacteria 27035
322 Ga0307414_10006758 3300032004 Bacteria 6415
323 Ga0307414_10157345 3300032004 Bacteria 1801
324 Ga0307411_10012046 3300032005 Bacteria 4698
325 Ga0307411_10124323 3300032005 Bacteria 1873
326 Ga0307415_100161468 3300032126 Bacteria 1737
327 Ga0307415_100799961 3300032126 Bacteria 860
328 Ga0373930_0024804 3300034816 Bacteria 1201
329 Ga0373929_0004337 3300035085 Bacteria 2547
330 Ga0373952_0127072 3300035092 Bacteria 697
331 Ga0373932_0081347 3300035112 Bacteria 1024
332 Ga0373932_0397743 3300035112 Bacteria 532
333 Ga0373939_0103151 3300035114 Bacteria 982
334 Ga0373962_0007567 3300035242 Bacteria 2663
335 Ga0373931_0029926 3300035691 Bacteria 2800
336 Ga0373931_0842051 3300035691 Bacteria 613
337 Ga0373925_0725973 3300037068 Unclassified 819
338 Ga0395899_0048889 3300037312 Bacteria 3145
339 Ga0395899_0110250 3300037312 Bacteria 1979
340 Ga0395900_0022279 3300037418 Bacteria 6482
341 Ga0395900_0269075 3300037418 Bacteria 1699
342 Ga0395898_0083058 3300037466 Bacteria 3087
343 Ga0395898_0828112 3300037466 Bacteria 865
344 Ga0395898_1443749 3300037466 Bacteria 615
345 Ga0395905_0001619 3300037471 Bacteria 26741
346 Ga0395905_0275688 3300037471 Unclassified 1568
347 Ga0395901_0254130 3300038443 Bacteria 1830
348 Ga0436365_0429708 3300039437 Bacteria 77395
349 Ga0451789_0680388 3300041443 Bacteria 650
350 Ga0451791_1509841 3300041451 Bacteria 959
351 Ga0451795_1646915 3300041456 Bacteria 1329
352 Ga0451802_1242199 3300041460 Bacteria 737
353 Ga0451807_0476024 3300041486 Bacteria 691
354 Ga0451837_0295242 3300041494 Bacteria 1003
355 Ga0451843_1511641 3300041509 Bacteria 1131
356 Ga0439462_0020851 3300042015 Bacteria 1711
357 Ga0450897_002063 3300042128 Bacteria 1462
358 Ga0450892_016509 3300042130 Bacteria 696
359 Ga0450904_000561 3300042139 Bacteria 7005
360 Ga0451577_0100284 3300042876 Bacteria 2587
361 Ga0466981_0206982 3300044669 Bacteria 1302
362 Ga0466982_0469381 3300044672 Bacteria 660
363 Ga0453684_0042996 3300044712 Bacteria 6080
364 Ga0466970_0227162 3300044765 Bacteria 1042
365 Ga0466957_0272296 3300044842 Bacteria 1131
366 Ga0451576_0047875 3300045051 Bacteria 4494
367 Ga0451576_0122046 3300045051 Bacteria 2713
368 Ga0451576_1067148 3300045051 Bacteria 846
369 Ga0451576_2716865 3300045051 Bacteria 504
370 Ga0466967_0768300 3300045976 Bacteria 956
371 Ga0495603_0124109 3300046455 Bacteria 1505
372 Ga0495638_0000057 3300046460 Bacteria 193690
373 Ga0495638_0052868 3300046460 Bacteria 2529
374 Ga0495650_0000109 3300046471 Bacteria 199925
375 Ga0495650_0003061 3300046471 Bacteria 12588
376 Ga0495639_0019845 3300046475 Bacteria 2934
377 Ga0495639_0397871 3300046475 Bacteria 696
378 Ga0495584_0029266 3300046491 Bacteria 2791
379 Ga0495585_0000972 3300046492 Bacteria 24063
380 Ga0495585_0012089 3300046492 Bacteria 5093
381 Ga0495585_0016077 3300046492 Bacteria 4338
382 Ga0495585_0044199 3300046492 Bacteria 2489
383 Ga0495585_0050837 3300046492 Bacteria 2298
384 Ga0495594_0037148 3300046499 Bacteria 2657
385 Ga0495596_0056063 3300046500 Bacteria 1539
386 Ga0495607_0036846 3300046501 Bacteria 2943
387 Ga0495607_0073937 3300046501 Bacteria 1893
388 Ga0495607_0182367 3300046501 Bacteria 1051
389 Ga0495607_0183927 3300046501 Bacteria 1046
390 Ga0495583_0000178 3300046506 Bacteria 108556
391 Ga0495583_0055879 3300046506 Bacteria 1782
392 Ga0495606_0014567 3300046507 Bacteria 6121
393 Ga0495606_0030087 3300046507 Bacteria 3799
394 Ga0495610_0001499 3300046512 Bacteria 20533
395 Ga0495616_0000175 3300046513 Bacteria 54795
396 Ga0495616_0010921 3300046513 Bacteria 5229
397 Ga0495616_0198984 3300046513 Bacteria 881
398 Ga0495631_0006443 3300046518 Bacteria 6057
399 Ga0495632_0000684 3300046519 Bacteria 30931
400 Ga0495632_0003433 3300046519 Bacteria 11251
401 Ga0495643_0000491 3300046522 Bacteria 49785
402 Ga0495643_0119697 3300046522 Bacteria 1331
403 Ga0495644_0003069 3300046523 Bacteria 6611
404 Ga0495644_0007012 3300046523 Bacteria 4361
405 Ga0495648_0000002 3300046524 Bacteria 593972
406 Ga0495648_0182371 3300046524 Bacteria 1066
407 Ga0495666_0196977 3300046526 Bacteria 927
408 Ga0495642_0000768 3300046528 Bacteria 15719
409 Ga0495642_0001662 3300046528 Bacteria 9630
410 Ga0495654_0014508 3300046530 Bacteria 4192
411 Ga0495665_0167440 3300046531 Bacteria 1144
412 Ga0495598_0039926 3300046537 Bacteria 1367
413 Ga0495609_0024661 3300046538 Bacteria 2758
414 Ga0495621_0025407 3300046539 Bacteria 1990
415 Ga0495621_0090519 3300046539 Bacteria 1152
416 Ga0495597_0000294 3300046542 Bacteria 44923
417 Ga0495597_0050415 3300046542 Bacteria 1837
418 Ga0495622_0000061 3300046557 Bacteria 96048
419 Ga0495622_0000340 3300046557 Bacteria 33517
420 Ga0495622_0137521 3300046557 Bacteria 1110
421 Ga0495622_0217647 3300046557 Bacteria 847
422 Ga0495633_0000783 3300046558 Bacteria 28459
423 Ga0495633_0005179 3300046558 Bacteria 8060
424 Ga0495633_0009650 3300046558 Bacteria 5312
425 Ga0495633_0017082 3300046558 Bacteria 3720
426 Ga0495656_0030921 3300046615 Bacteria 2167
427 Ga0495656_0151692 3300046615 Bacteria 1120
428 Ga0495668_0000001 3300046616 Bacteria 1013420
429 Ga0495668_0000048 3300046616 Bacteria 217867
430 Ga0495668_0000495 3300046616 Bacteria 49167
431 Ga0495668_0398126 3300046616 Bacteria 756
432 Ga0495611_0011537 3300046648 Bacteria 3747
433 Ga0495611_0195298 3300046648 Bacteria 944
434 Ga0495625_0000622 3300046660 Bacteria 51463
435 Ga0495625_0040818 3300046660 Bacteria 3381
436 Ga0495625_0145430 3300046660 Bacteria 1596
437 Ga0495625_0272713 3300046660 Bacteria 1091
438 Ga0495625_0282928 3300046660 Bacteria 1066
439 Ga0495661_0010678 3300046665 Bacteria 6256
440 Ga0495661_0046705 3300046665 Bacteria 2642
441 Ga0495661_0394190 3300046665 Bacteria 674
442 Ga0495661_0551181 3300046665 Bacteria 545
443 Ga0495588_0075401 3300046674 Bacteria 1757
444 Ga0495588_0098731 3300046674 Bacteria 1533
445 Ga0495669_0002653 3300046684 Bacteria 7324
446 Ga0495670_0000138 3300046691 Bacteria 31679
447 Ga0495670_0133845 3300046691 Bacteria 1293
448 Ga0495600_0049226 3300046809 Bacteria 2750
449 Ga0495660_0001182 3300046810 Bacteria 18406
450 Ga0495660_0014230 3300046810 Bacteria 4608
451 Ga0495660_0256995 3300046810 Bacteria 808
452 Ga0495581_0165420 3300047315 Bacteria 1293
453 Ga0495636_0103228 3300047318 Bacteria 1248
454 Ga0495672_0020980 3300047320 Bacteria 4268
455 Ga0495680_0122475 3300047322 Bacteria 1918
456 Ga0495687_005168 3300047443 Bacteria 8445
457 Ga0495687_005436 3300047443 Bacteria 8123
458 Ga0495675_0315079 3300047444 Bacteria 926
459 Ga0495686_0003983 3300047472 Bacteria 12365
460 Ga0495593_0028400 3300047673 Bacteria 3072
461 Ga0495614_0108560 3300048089 Bacteria 1217
462 Ga0495615_0030556 3300048090 Bacteria 1287
463 Ga0495626_0006273 3300048091 Bacteria 6787
464 Ga0496100_0059445 3300048903 Bacteria 2512
465 Ga0496100_0204811 3300048903 Bacteria 1440
466 Ga0496101_0053277 3300048904 Bacteria 2918
467 Ga0496101_0104030 3300048904 Bacteria 2129
468 Ga0496101_0465005 3300048904 Bacteria 998
469 Ga0496101_0739637 3300048904 Bacteria 776
470 Ga0496102_0005136 3300048905 Bacteria 11100
471 Ga0496102_0071445 3300048905 Bacteria 3187
472 Ga0496102_0357915 3300048905 Bacteria 1374
473 Ga0496103_0033805 3300048906 Bacteria 3125
474 Ga0496103_0684438 3300048906 Bacteria 650
475 Ga0496104_0080340 3300048907 Bacteria 3109
476 Ga0496104_0422969 3300048907 Bacteria 1244
477 Ga0496105_0568807 3300048908 Bacteria 883
478 Ga0496106_0015833 3300048909 Bacteria 5577
479 Ga0496106_0017189 3300048909 Bacteria 5355
480 Ga0496106_0217991 3300048909 Bacteria 1521
481 Ga0496107_0004328 3300048910 Bacteria 9610
482 Ga0496107_0006108 3300048910 Bacteria 8276
483 Ga0496108_0715771 3300048911 Bacteria 867
484 Ga0496109_0095016 3300048912 Bacteria 2759
485 Ga0496109_0197347 3300048912 Bacteria 1892
486 Ga0496110_0427031 3300048913 Bacteria 1208
487 Ga0496111_0064322 3300048914 Bacteria 2661
488 Ga0496112_0273788 3300048915 Bacteria 1636
489 Ga0496113_0042119 3300048916 Bacteria 3372
490 Ga0496114_0576239 3300048917 Bacteria 993
491 Ga0496115_0168361 3300048918 Bacteria 1812
492 Ga0496115_0279479 3300048918 Bacteria 1371
493 Ga0495678_006875 3300049459 Bacteria 5976
494 Ga0495678_044874 3300049459 Bacteria 1746
495 Ga0501046_0880330 3300049580 Bacteria 625
496 Ga0501075_0125986 3300049591 Bacteria 1950
497 Ga0501076_0597766 3300049592 Bacteria 910
498 Ga0501076_1621482 3300049592 Bacteria 531
499 Ga0501227_005504 3300049665 Bacteria 2709
500 Ga0501225_0171794 3300049705 Bacteria 672
501 Ga0501079_0430454 3300049741 Bacteria 1036
502 Ga0501266_005177 3300049763 Bacteria 1624
503 nmdc:mga03n38_522595_c1 3300050490 Bacteria 668
504 nmdc:mga05p37_15985_c1 3300050507 Bacteria 9029
505 nmdc:mga05p37_334624_c1 3300050507 Bacteria 1787
506 nmdc:mga08y16_276675_c1 3300050511 Bacteria 1732
507 nmdc:mga0n895_165173_c1 3300050512 Bacteria 2245
508 nmdc:mga0rr50_1199739_c1 3300050513 Bacteria 645
509 nmdc:mga0rr50_628550_c1 3300050513 Bacteria 916
510 nmdc:mga0a205_1451985_c1 3300050515 Bacteria 534
511 Ga0500608_265297 3300053122 Bacteria 660
512 Ga0500586_000305 3300053145 Bacteria 9781
513 Ga0500645_041877 3300053730 Bacteria 1352
514 2643815685 2643221559 Bacteria 4424915
515 2643940811 2643221586 Bacteria 4446529
516 2644080143 2643221612 Bacteria 4361984
517 2644215775 2643221638 Bacteria 6579467
518 2644695739 2643221727 Bacteria 4415595
519 2738741070 2738541280 Bacteria 6630198
520 2738845528 2738541300 Bacteria 6675882
521 2739276583 2738543018 Bacteria 6718814
522 2739345627 2738543030 Bacteria 6719714
523 2842713590 2842711865 Bacteria 7155354
524 2857563941 2857558681 Bacteria 6617694
525 Ga0213876_10004595
526 JGI25154J39366_1000618
527 JGI25152J39213_1000357
528 JGI25150J39212_1005203
529 JGI25159J45721_1001435
530 rootL2_10007214
531 rootH1_10004360
532 Ga0055537_1010727
533 Ga0055524_1001429
534 Ga0055524_1002877
535 Ga0055534_1014177
536 Ga0055530_10002715
537 Ga0055543_1003791
538 Ga0065165_1000156
539 Ga0065715_10757716
540 Ga0065707_10353123
541 Ga0070658_10625256
542 Ga0070658_11242281
543 Ga0070676_10008737
544 Ga0070683_100639242
545 Ga0070683_100868288
546 Ga0070670_100743924
547 Ga0070677_10280680
548 Ga0070677_10612011
549 Ga0068869_100003076
550 Ga0068869_100735268
551 Ga0070666_10029981
552 Ga0070666_10141101
553 Ga0070666_10235411
554 Ga0068868_100006730
555 Ga0068868_100171901
556 Ga0070660_100040061
557 Ga0070660_100040342
558 Ga0070660_100138674
559 Ga0070660_100486608
560 Ga0070660_100767668
561 Ga0070689_101695133
562 Ga0070661_100001500
563 Ga0070661_100008214
564 Ga0070661_100324834
565 Ga0070692_10319816
566 Ga0070669_100032735
567 Ga0070669_100109268
568 Ga0070669_100980874
569 Ga0070675_100001332
570 Ga0070675_100089478
571 Ga0070671_100002942
572 Ga0070671_100004450
573 Ga0070671_100191470
574 Ga0070674_100001785
575 Ga0070673_100001604
576 Ga0070673_100067375
577 Ga0070673_100514967
578 Ga0070659_100002299
579 Ga0070659_100006591
580 Ga0070659_101290446
581 Ga0070667_100194547
582 Ga0070667_100241516
583 Ga0070667_101043747
584 Ga0070714_100777606
585 Ga0070678_100066483
586 Ga0070678_100194650
587 Ga0070678_100366246
588 Ga0070662_100000108
589 Ga0070662_100001945
590 Ga0070662_100118177
591 Ga0070662_100293417
592 Ga0070681_10319671
593 Ga0068867_100247292
594 Ga0070699_100978098
595 Ga0070679_100833292
596 Ga0070684_100028635
597 Ga0070684_100110433
598 Ga0068853_100009559
599 Ga0068853_100030678
600 Ga0068853_100105221
601 Ga0068853_101099336
602 Ga0070672_100238759
603 Ga0070672_100424982
604 Ga0070686_100308062
605 Ga0070695_100365860
606 Ga0070693_100038642
607 Ga0070693_100465421
608 Ga0068855_100002623
609 Ga0068855_100051023
610 Ga0070664_100003246
611 Ga0070664_100196661
612 Ga0070664_100208779
613 Ga0068857_100073156
614 Ga0068854_100094087
615 Ga0068854_100280710
616 Ga0068856_100004796
617 Ga0068856_100023592
618 Ga0068856_100052398
619 Ga0070702_100098323
620 Ga0068852_100000615
621 Ga0068852_100001686
622 Ga0068852_100081926
623 Ga0068852_101514671
624 Ga0068859_100468134
625 Ga0068864_100143693
626 Ga0068864_100276204
627 Ga0068864_100286755
628 Ga0068861_100000384
629 Ga0068861_100212584
630 Ga0068861_100552876
631 Ga0068851_10019377
632 Ga0068863_100371073
633 Ga0068863_100893037
634 Ga0068858_100001338
635 Ga0068858_100027002
636 Ga0068858_100098909
637 Ga0068860_100021841
638 Ga0068862_100031874
639 Ga0068862_100163541
640 Ga0068862_100958340
641 Ga0081538_10012035
642 Ga0070712_101073444
643 Ga0075362_10075306
644 Ga0097621_100075111
645 Ga0075370_10073943
646 Ga0068871_100036905
647 Ga0068871_100426299
648 Ga0075428_100457990
649 Ga0075428_102131601
650 Ga0075431_101207637
651 Ga0075434_100336422
652 Ga0097620_100468038
653 Ga0105240_10085638
654 Ga0111539_10276424
655 Ga0105247_10236356
656 Ga0114129_10072315
657 Ga0105241_10650537
658 Ga0105241_10709719
659 Ga0105241_10722041
660 Ga0105242_10000772
661 Ga0105248_10007485
662 Ga0105248_10026485
663 Ga0105248_10101524
664 Ga0105237_10053360
665 Ga0105238_10005726
666 Ga0105238_10027853
667 Ga0105238_10326872
668 Ga0105238_10769262
669 Ga0105249_10027263
670 Ga0105030_121615
671 Ga0105239_10030967
672 Ga0105239_10224097
673 Ga0105239_11626310
674 Ga0105246_10367082
675 Ga0157373_10000581
676 Ga0157373_10253089
677 Ga0157371_10001857
678 Ga0157371_10040283
679 Ga0157371_10208772
680 Ga0157370_11022454
681 Ga0157369_10060861
682 Ga0157369_10112796
683 Ga0157369_10139583
684 Ga0157374_10009696
685 Ga0157374_10096673
686 Ga0163162_10000830
687 Ga0163162_10074665
688 Ga0163162_10087311
689 Ga0157372_10002254
690 Ga0157372_10015817
691 Ga0157372_10122621
692 Ga0157372_10193263
693 Ga0157372_11720406
694 Ga0157375_10020475
695 Ga0157375_10142600
696 Ga0157377_10028137
697 Ga0157379_10001870
698 Ga0157379_10022279
699 Ga0157376_10011825
700 Ga0163161_10013308
701 Ga0163161_10076039
702 Ga0206353_10635680
703 Ga0207425_1000001
704 Ga0209646_1000049
705 Ga0209129_1000001
706 Ga0209565_1000057
707 Ga0209565_1001684
708 Ga0209565_1004424
709 Ga0209565_1006004
710 Ga0209673_1000051
711 Ga0209673_1026558
712 Ga0209130_1000268
713 Ga0209675_1000027
714 Ga0209675_1008779
715 Ga0209564_1000094
716 Ga0209564_1000456
717 Ga0209564_1015365
718 Ga0209758_1000073
719 Ga0209050_1000655
720 Ga0209256_1000139
721 Ga0209256_1002336
722 Ga0209256_1009090
723 Ga0207426_1042256
724 Ga0209051_1106182
725 Ga0207656_10034518
726 Ga0207682_10238641
727 Ga0207642_10543155
728 Ga0207688_10323603
729 Ga0207680_10006319
730 Ga0207645_10017147
731 Ga0207645_10213061
732 Ga0207705_10080757
733 Ga0207684_10047185
734 Ga0207707_10349012
735 Ga0207695_10201736
736 Ga0207660_10330542
737 Ga0207657_10001637
738 Ga0207657_10010549
739 Ga0207657_10032616
740 Ga0207657_10058482
741 Ga0207649_10292215
742 Ga0207646_10350722
743 Ga0207681_10022243
744 Ga0207681_10496061
745 Ga0207694_10032630
746 Ga0207694_10076591
747 Ga0207694_10377393
748 Ga0207694_11121061
749 Ga0207650_11156124
750 Ga0207659_10050781
751 Ga0207687_10012874
752 Ga0207644_10002183
753 Ga0207644_10048438
754 Ga0207644_10095960
755 Ga0207644_10705561
756 Ga0207690_10002530
757 Ga0207690_10076946
758 Ga0207690_10183883
759 Ga0207706_10000186
760 Ga0207706_10006991
761 Ga0207706_10355134
762 Ga0207691_10065807
763 Ga0207691_10403340
764 Ga0207711_10001893
765 Ga0207711_10013899
766 Ga0207711_10466761
767 Ga0207689_10000856
768 Ga0207689_10474567
769 Ga0207661_10665889
770 Ga0207679_10040785
771 Ga0207679_10388407
772 Ga0207679_10564731
773 Ga0207679_10997229
774 Ga0207679_11558171
775 Ga0207667_10005774
776 Ga0207667_10039768
777 Ga0207651_10172712
778 Ga0207651_10625987
779 Ga0207640_10076760
780 Ga0207640_10492322
781 Ga0207640_10505289
782 Ga0207658_10121692
783 Ga0207658_10135530
784 Ga0207658_10345104
785 Ga0207677_10010028
786 Ga0207677_10400150
787 Ga0207703_10006482
788 Ga0207703_10325507
789 Ga0207639_10005702
790 Ga0207639_10080600
791 Ga0207678_10019938
792 Ga0207678_10580320
793 Ga0207702_10002793
794 Ga0207702_10305752
795 Ga0207648_10035470
796 Ga0207648_10333821
797 Ga0207676_10010625
798 Ga0207676_10307816
799 Ga0207674_10039387
800 Ga0207674_10064475
801 Ga0207674_10416763
802 Ga0207675_100000879
803 Ga0207675_100012147
804 Ga0207683_10052440
805 Ga0207683_10055732
806 Ga0207683_10685691
807 Ga0207698_10003937
808 Ga0207698_10018671
809 Ga0207698_10191569
810 Ga0207698_11673663
811 Ga0209968_1025622
812 Ga0209970_1001705
813 Ga0209974_10013696
814 Ga0209974_10032157
815 Ga0207428_10242393
816 Ga0268266_11058633
817 Ga0268265_11053679
818 Ga0268264_10927008
819 Ga0265331_10108037
820 Ga0307408_100000199
821 Ga0307408_100020791
822 Ga0307408_100152378
823 Ga0307408_100184300
824 Ga0265314_10011762
825 Ga0307516_10002488
826 Ga0307516_10008487
827 Ga0307405_10023265
828 Ga0307413_10008648
829 Ga0307413_10237456
830 Ga0307518_10226867
831 Ga0307410_10002499
832 Ga0307406_10077578
833 Ga0307406_10140576
834 Ga0307406_11428765
835 Ga0307412_10025841
836 Ga0307412_10067585
837 Ga0307412_10882954
838 Ga0307409_100004076
839 Ga0307409_100021405
840 Ga0307409_100866879
841 Ga0307416_100022644
842 Ga0307416_100043286
843 Ga0307416_100047668
844 Ga0307416_101240249
845 Ga0307414_10000329
846 Ga0307414_10006758
847 Ga0307414_10157345
848 Ga0307411_10012046
849 Ga0307411_10124323
850 Ga0307415_100161468
851 Ga0307415_100799961
852 Ga0373930_0024804
853 Ga0373929_0004337
854 Ga0373952_0127072
855 Ga0373932_0081347
856 Ga0373932_0397743
857 Ga0373939_0103151
858 Ga0373962_0007567
859 Ga0373931_0029926
860 Ga0373931_0842051
861 Ga0373925_0725973
862 Ga0395899_0048889
863 Ga0395899_0110250
864 Ga0395900_0022279
865 Ga0395900_0269075
866 Ga0395898_0083058
867 Ga0395898_0828112
868 Ga0395898_1443749
869 Ga0395905_0001619
870 Ga0395905_0275688
871 Ga0395901_0254130
872 Ga0436365_0429708
873 Ga0451789_0680388
874 Ga0451791_1509841
875 Ga0451795_1646915
876 Ga0451802_1242199
877 Ga0451807_0476024
878 Ga0451837_0295242
879 Ga0451843_1511641
880 Ga0439462_0020851
881 Ga0450897_002063
882 Ga0450892_016509
883 Ga0450904_000561
884 Ga0451577_0100284
885 Ga0466981_0206982
886 Ga0466982_0469381
887 Ga0453684_0042996
888 Ga0466970_0227162
889 Ga0466957_0272296
890 Ga0451576_0047875
891 Ga0451576_0122046
892 Ga0451576_1067148
893 Ga0451576_2716865
894 Ga0466967_0768300
895 Ga0495603_0124109
896 Ga0495638_0000057
897 Ga0495638_0052868
898 Ga0495650_0000109
899 Ga0495650_0003061
900 Ga0495639_0019845
901 Ga0495639_0397871
902 Ga0495584_0029266
903 Ga0495585_0000972
904 Ga0495585_0012089
905 Ga0495585_0016077
906 Ga0495585_0044199
907 Ga0495585_0050837
908 Ga0495594_0037148
909 Ga0495596_0056063
910 Ga0495607_0036846
911 Ga0495607_0073937
912 Ga0495607_0182367
913 Ga0495607_0183927
914 Ga0495583_0000178
915 Ga0495583_0055879
916 Ga0495606_0014567
917 Ga0495606_0030087
918 Ga0495610_0001499
919 Ga0495616_0000175
920 Ga0495616_0010921
921 Ga0495616_0198984
922 Ga0495631_0006443
923 Ga0495632_0000684
924 Ga0495632_0003433
925 Ga0495643_0000491
926 Ga0495643_0119697
927 Ga0495644_0003069
928 Ga0495644_0007012
929 Ga0495648_0000002
930 Ga0495648_0182371
931 Ga0495666_0196977
932 Ga0495642_0000768
933 Ga0495642_0001662
934 Ga0495654_0014508
935 Ga0495665_0167440
936 Ga0495598_0039926
937 Ga0495609_0024661
938 Ga0495621_0025407
939 Ga0495621_0090519
940 Ga0495597_0000294
941 Ga0495597_0050415
942 Ga0495622_0000061
943 Ga0495622_0000340
944 Ga0495622_0137521
945 Ga0495622_0217647
946 Ga0495633_0000783
947 Ga0495633_0005179
948 Ga0495633_0009650
949 Ga0495633_0017082
950 Ga0495656_0030921
951 Ga0495656_0151692
952 Ga0495668_0000001
953 Ga0495668_0000048
954 Ga0495668_0000495
955 Ga0495668_0398126
956 Ga0495611_0011537
957 Ga0495611_0195298
958 Ga0495625_0000622
959 Ga0495625_0040818
960 Ga0495625_0145430
961 Ga0495625_0272713
962 Ga0495625_0282928
963 Ga0495661_0010678
964 Ga0495661_0046705
965 Ga0495661_0394190
966 Ga0495661_0551181
967 Ga0495588_0075401
968 Ga0495588_0098731
969 Ga0495669_0002653
970 Ga0495670_0000138
971 Ga0495670_0133845
972 Ga0495600_0049226
973 Ga0495660_0001182
974 Ga0495660_0014230
975 Ga0495660_0256995
976 Ga0495581_0165420
977 Ga0495636_0103228
978 Ga0495672_0020980
979 Ga0495680_0122475
980 Ga0495687_005168
981 Ga0495687_005436
982 Ga0495675_0315079
983 Ga0495686_0003983
984 Ga0495593_0028400
985 Ga0495614_0108560
986 Ga0495615_0030556
987 Ga0495626_0006273
988 Ga0496100_0059445
989 Ga0496100_0204811
990 Ga0496101_0053277
991 Ga0496101_0104030
992 Ga0496101_0465005
993 Ga0496101_0739637
994 Ga0496102_0005136
995 Ga0496102_0071445
996 Ga0496102_0357915
997 Ga0496103_0033805
998 Ga0496103_0684438
999 Ga0496104_0080340
1000 Ga0496104_0422969
1001 Ga0496105_0568807
1002 Ga0496106_0015833
1003 Ga0496106_0017189
1004 Ga0496106_0217991
1005 Ga0496107_0004328
1006 Ga0496107_0006108
1007 Ga0496108_0715771
1008 Ga0496109_0095016
1009 Ga0496109_0197347
1010 Ga0496110_0427031
1011 Ga0496111_0064322
1012 Ga0496112_0273788
1013 Ga0496113_0042119
1014 Ga0496114_0576239
1015 Ga0496115_0168361
1016 Ga0496115_0279479
1017 Ga0495678_006875
1018 Ga0495678_044874
1019 Ga0501046_0880330
1020 Ga0501075_0125986
1021 Ga0501076_0597766
1022 Ga0501076_1621482
1023 Ga0501227_005504
1024 Ga0501225_0171794
1025 Ga0501079_0430454
1026 Ga0501266_005177
1027 nmdc:mga03n38_522595_c1
1028 nmdc:mga05p37_15985_c1
1029 nmdc:mga05p37_334624_c1
1030 nmdc:mga08y16_276675_c1
1031 nmdc:mga0n895_165173_c1
1032 nmdc:mga0rr50_1199739_c1
1033 nmdc:mga0rr50_628550_c1
1034 nmdc:mga0a205_1451985_c1
1035 Ga0500608_265297
1036 Ga0500586_000305
1037 Ga0500645_041877
1038 2643815685
1039 2643940811
1040 2644080143
1041 2644215775
1042 2644695739
1043 2738741070
1044 2738845528
1045 2739276583
1046 2739345627
1047 2842713590
1048 2857563941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

132

0.88

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

121

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

13

132

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.8542 3 131
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8538 3 131
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8512 4 131
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8453 3 129
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8408 3 131
ID Description Score Start End Superfamily
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8617 76 131 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8553 8 131 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8422 8 131 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8011 4 131 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7985 3 134 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7U5XVR3-F1-model_v4 VOC family protein 0.9825 1 133
AF-A0A562PEL1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9808 1 132 GO:0051213
AF-A0A318JBT1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9786 1 134 GO:0051213
AF-A0A6A5LIS9-F1-model_v4 deleted 0.9779 2 134
AF-A0A0Q7FAU6-F1-model_v4 Lactoylglutathione lyase 0.9758 1 132 GO:0016829

Map