F459148

General Info

Members Datasets Scaffolds Average Seq Length
524 437 1048 176

Family's Representative Sequence

Representative Sequence 3300027111|Ga0209281_1001243|Ga0209281_100124313
Length 187
Sequence MTEAEQKMTTRPKIVFVVAVAANGIIGREGDLPWRLSTDLKRFKALTIGKPVVMGRKTWASLGRPLPGRPNIVISRNPDFEAPGAEVAPSLETALTIARERAAAVGADEICIIGGGEIYRQSIGMADVLHVTEVQAEVDGDTRFPSIDPATFEKVMEEDLPRSEKDSHAMHFVTWRRRTPPPEGAGA

Samples

Sample ID Description Type Environment
1 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
55 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
58 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
98 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
172 2509276019 Ensifer aridi TW10 Isolate Nodule
173 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
174 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
175 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
176 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
177 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
178 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
179 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
180 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
181 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
182 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
183 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
184 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
185 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
186 2516143018 Ensifer sp. BR816 Isolate Nodule
187 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
188 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
189 2519899620 Rhizobium sp. Pop5 Isolate Nodule
190 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
191 2534681786 Brucella suis 92/29 Isolate Unclassified
192 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
193 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
194 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
195 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
196 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
197 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
198 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
199 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
200 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
201 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
202 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
203 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
204 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
205 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
206 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
207 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
208 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
209 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
210 2643221557 Ensifer sp. Root558 Isolate Unclassified
211 2643221599 Rhizobium sp. Root708 Isolate Unclassified
212 2643221610 Ensifer sp. Root74 Isolate Unclassified
213 2643221618 Ensifer sp. Root231 Isolate Unclassified
214 2643221626 Ensifer sp. Root31 Isolate Unclassified
215 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
216 2643221655 Ensifer sp. Root1252 Isolate Unclassified
217 2643221659 Ensifer sp. Root127 Isolate Unclassified
218 2643221668 Ensifer sp. Root423 Isolate Unclassified
219 2643221675 Ensifer sp. Root1298 Isolate Unclassified
220 2643221680 Ensifer sp. Root1312 Isolate Unclassified
221 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
222 2643221688 Rhizobium sp. Root482 Isolate Unclassified
223 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
224 2643221698 Ensifer sp. Root142 Isolate Unclassified
225 2643221712 Ensifer sp. Root258 Isolate Unclassified
226 2643221723 Ensifer sp. Root278 Isolate Unclassified
227 2643221726 Ensifer sp. Root954 Isolate Unclassified
228 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
229 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
230 2738541293 Rhizobium sp. GV031 Isolate Unclassified
231 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
232 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
233 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
234 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
235 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
236 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
237 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
238 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
239 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
240 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
241 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
242 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
243 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
244 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
245 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
246 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
247 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
248 2844163670 Ensifer sp. 1H6 Isolate Unclassified
249 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
250 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
251 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
252 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
253 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
254 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
255 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
256 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
257 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
258 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
259 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
260 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
261 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
262 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
263 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
264 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
265 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
266 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
267 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
268 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
269 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
270 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
271 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
272 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
273 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
274 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
275 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
276 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
277 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
278 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
279 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
280 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
281 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
282 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
283 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
284 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
285 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
286 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
287 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
288 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
289 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
290 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
291 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
292 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
293 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
294 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
295 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
296 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
297 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
298 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
299 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
300 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
301 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
302 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
303 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
304 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
305 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
306 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
307 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
308 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
309 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
310 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
311 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
312 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
313 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
314 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
315 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
316 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
317 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
318 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
319 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
320 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
321 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
322 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
323 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
324 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
325 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
326 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
327 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
328 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
329 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
330 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
331 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
332 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
333 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
334 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
335 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
336 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
337 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
338 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
339 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
340 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
341 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
342 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
343 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
344 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
345 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
346 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
347 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
348 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
349 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
350 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
351 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
352 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
353 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
354 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
355 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
356 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
357 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
358 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
359 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
360 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
361 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
362 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
363 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
364 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
365 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
366 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
367 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
368 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
369 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
370 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
371 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
372 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
373 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
374 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
375 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
376 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
377 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
378 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
379 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
380 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
381 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
382 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
383 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
384 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
385 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
386 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
387 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
388 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
389 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
390 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
391 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
392 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
393 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
394 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
395 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
396 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
397 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
398 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
399 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
400 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
401 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
402 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
403 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
404 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
405 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
406 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
407 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
408 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
409 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
410 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
411 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
412 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
413 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
414 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
415 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
416 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
417 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
418 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
419 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
420 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
421 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
422 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
423 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
424 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
425 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
426 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
427 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
428 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
429 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
430 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
431 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
432 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
433 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
434 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
435 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
436 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
437 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.47
Metatranscriptomes 0.19
Isolates 51.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 43.32
Rhizoplane 4.39
Rhizosphere 24.24
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209281_1001243 3300027111 Bacteria 16710
2 JGI25152J39213_1001554 3300002773 Bacteria 9740
3 JGI25150J39212_1000307 3300002774 Bacteria 24463
4 JGI25159J45721_1000040 3300002987 Bacteria 68143
5 JGI25151J46595_10000329 3300003187 Bacteria 51364
6 JGI25151J46595_10005257 3300003187 Bacteria 6713
7 JGI25406J46586_10083299 3300003203 Bacteria 977
8 JGI25153J46596_10026399 3300003215 Bacteria 2056
9 rootL2_10020315 3300003322 Unclassified 11080
10 JGI25160J50197_1000128 3300003354 Bacteria 68143
11 JGI25160J50197_1004590 3300003354 Bacteria 5944
12 JGI25161J50226_1000504 3300003374 Bacteria 17099
13 Ga0006562J51391_1023002 3300003578 Bacteria 2884
14 Ga0055526_1000675 3300003771 Bacteria 26151
15 Ga0055524_1013330 3300003775 Bacteria 3102
16 Ga0055524_1014716 3300003775 Unclassified 2885
17 Ga0055524_1036732 3300003775 Bacteria 1312
18 Ga0055536_1000853 3300003781 Bacteria 20033
19 Ga0055528_1008457 3300003790 Unclassified 4408
20 Ga0055530_10009853 3300003791 Bacteria 3608
21 Ga0055540_1011119 3300003792 Bacteria 2935
22 Ga0055531_10004447 3300003794 Bacteria 8527
23 Ga0055543_1000130 3300004625 Bacteria 62045
24 Ga0065165_1000013 3300005262 Bacteria 301887
25 Ga0070670_100002228 3300005331 Bacteria 15933
26 Ga0070680_100327069 3300005336 Bacteria 1302
27 Ga0070661_100949338 3300005344 Unclassified 712
28 Ga0070668_100150674 3300005347 Bacteria 1880
29 Ga0070671_100253231 3300005355 Bacteria 1496
30 Ga0070714_100028981 3300005435 Bacteria 4599
31 Ga0070663_100533833 3300005455 Bacteria 978
32 Ga0070663_100728416 3300005455 Bacteria 845
33 Ga0070681_10001659 3300005458 Bacteria 19883
34 Ga0070679_100374404 3300005530 Bacteria 1371
35 Ga0070665_100051595 3300005548 Bacteria 4125
36 Ga0068855_100032602 3300005563 Bacteria 6218
37 Ga0068855_100101357 3300005563 Bacteria 3315
38 Ga0070664_101399458 3300005564 Bacteria 661
39 Ga0068856_100020634 3300005614 Bacteria 6402
40 Ga0068852_101043268 3300005616 Bacteria 837
41 Ga0068863_100854587 3300005841 Bacteria 909
42 Ga0081455_10036332 3300005937 Bacteria 4388
43 Ga0081540_1168017 3300005983 Bacteria 840
44 Ga0081539_10001499 3300005985 Bacteria 39468
45 Ga0075369_10006052 3300006186 Bacteria 4560
46 Ga0075366_10522723 3300006195 Bacteria 734
47 Ga0075370_10116024 3300006353 Bacteria 1557
48 Ga0079104_1022348 3300006946 Bacteria 1703
49 Ga0105251_10013331 3300009011 Bacteria 4603
50 Ga0105243_11105881 3300009148 Bacteria 801
51 Ga0105248_10742386 3300009177 Bacteria 1107
52 Ga0105249_10127950 3300009553 Bacteria 2421
53 Ga0105249_10902529 3300009553 Bacteria 951
54 Ga0157373_10458322 3300013100 Bacteria 918
55 Ga0157370_10005492 3300013104 Bacteria 14218
56 Ga0171463_1003 3300013249 Bacteria 695693
57 Ga0157372_10132103 3300013307 Bacteria 2873
58 Ga0163163_10702449 3300014325 Bacteria 1075
59 Ga0157376_10717261 3300014969 Bacteria 1006
60 Ga0183363_1093 3300015690 Bacteria 25804
61 Ga0214544_1000161 3300021320 Bacteria 101808
62 Ga0214542_1000012 3300021321 Bacteria 235800
63 Ga0214542_1023729 3300021321 Bacteria 3593
64 Ga0214543_1000024 3300021327 Bacteria 235745
65 Ga0214543_1000038 3300021327 Bacteria 182106
66 Ga0228711_1000008 3300022739 Bacteria 169893
67 Ga0228710_1000009 3300022740 Bacteria 169770
68 Ga0209436_100194 3300025208 Bacteria 28386
69 Ga0207425_1000024 3300025245 Bacteria 328978
70 Ga0207425_1031597 3300025245 Bacteria 1053
71 Ga0209129_1000146 3300025258 Bacteria 115180
72 Ga0209129_1002468 3300025258 Bacteria 9046
73 Ga0209565_1051123 3300025263 Bacteria 741
74 Ga0209673_1011034 3300025273 Bacteria 3757
75 Ga0209673_1016936 3300025273 Bacteria 2704
76 Ga0209673_1047776 3300025273 Bacteria 1158
77 Ga0209130_1000034 3300025284 Bacteria 302439
78 Ga0209130_1026677 3300025284 Bacteria 1236
79 Ga0209130_1033723 3300025284 Bacteria 1035
80 Ga0209676_1001758 3300025292 Bacteria 18389
81 Ga0209025_1000050 3300025294 Bacteria 331531
82 Ga0209025_1000314 3300025294 Bacteria 107720
83 Ga0209025_1011126 3300025294 Bacteria 5987
84 Ga0209025_1049408 3300025294 Bacteria 1693
85 Ga0209564_1000013 3300025295 Bacteria 775755
86 Ga0209564_1006200 3300025295 Bacteria 6537
87 Ga0209564_1034303 3300025295 Bacteria 1490
88 Ga0209758_1000083 3300025297 Bacteria 257283
89 Ga0209050_1003728 3300025298 Bacteria 10962
90 Ga0209256_1001430 3300025299 Bacteria 24732
91 Ga0209256_1001510 3300025299 Bacteria 23567
92 Ga0209256_1002653 3300025299 Bacteria 14067
93 Ga0209256_1007982 3300025299 Bacteria 5037
94 Ga0209256_1043912 3300025299 Bacteria 1119
95 Ga0207426_1000006 3300025302 Bacteria 1025969
96 Ga0207426_1002432 3300025302 Bacteria 11903
97 Ga0209051_1002141 3300025303 Bacteria 14692
98 Ga0209257_1003795 3300025304 Bacteria 12447
99 Ga0207713_1088953 3300025735 Bacteria 1090
100 Ga0207660_10074024 3300025917 Bacteria 2485
101 Ga0207650_10005240 3300025925 Bacteria 8839
102 Ga0207664_10029022 3300025929 Bacteria 4211
103 Ga0207644_10251768 3300025931 Bacteria 1409
104 Ga0207679_10543339 3300025945 Bacteria 1042
105 Ga0207667_10067857 3300025949 Bacteria 3715
106 Ga0207667_10083219 3300025949 Bacteria 3313
107 Ga0207712_10400171 3300025961 Bacteria 1154
108 Ga0207668_10227293 3300025972 Bacteria 1502
109 Ga0207678_10041534 3300026067 Bacteria 3988
110 Ga0207698_10902559 3300026142 Bacteria 891
111 Ga0209281_1000106 3300027111 Bacteria 219666
112 Ga0209371_1058231 3300027312 Bacteria 717
113 Ga0209282_1000024 3300027666 Bacteria 170348
114 Ga0268266_10102385 3300028379 Bacteria 2526
115 Ga0307515_10000788 3300028794 Bacteria 72975
116 Ga0268256_1065375 3300030500 Bacteria 717
117 Ga0307513_10003732 3300031456 Bacteria 20589
118 Ga0307408_100218617 3300031548 Bacteria 1553
119 Ga0307514_10122407 3300031649 Bacteria 1811
120 Ga0307405_10072875 3300031731 Bacteria 2215
121 Ga0307412_10210912 3300031911 Bacteria 1482
122 Ga0315914_1000012 3300031967 Bacteria 169896
123 Ga0307409_100071262 3300031995 Bacteria 2763
124 Ga0307409_101465081 3300031995 Bacteria 710
125 Ga0315913_1000006 3300033430 Bacteria 169893
126 Ga0315915_1000010 3300033464 Bacteria 240214
127 Ga0373927_0003658 3300035695 Bacteria 10956
128 Ga0373925_0004759 3300037068 Bacteria 10224
129 Ga0395900_0230646 3300037418 Bacteria 1862
130 Ga0395898_0140310 3300037466 Bacteria 2313
131 Ga0395901_0199698 3300038443 Bacteria 2096
132 Ga0439436_0030747 3300041404 Bacteria 1560
133 Ga0439436_0071789 3300041404 Bacteria 965
134 Ga0439436_0076414 3300041404 Bacteria 933
135 Ga0439438_045929 3300041405 Bacteria 1123
136 Ga0439439_0136813 3300041406 Bacteria 690
137 Ga0439465_0089228 3300041413 Bacteria 1053
138 Ga0439465_0258021 3300041413 Bacteria 646
139 Ga0451791_1375656 3300041451 Bacteria 822
140 Ga0451798_1063747 3300041458 Bacteria 628
141 Ga0451833_1187501 3300041491 Bacteria 645
142 Ga0439449_0002827 3300042007 Bacteria 6751
143 Ga0466967_0603711 3300045976 Bacteria 1083
144 Ga0495638_0014151 3300046460 Bacteria 5401
145 Ga0495650_0019347 3300046471 Bacteria 3355
146 Ga0495606_0116647 3300046507 Bacteria 1603
147 Ga0495588_0186486 3300046674 Bacteria 1096
148 Ga0496100_0306853 3300048903 Bacteria 1189
149 Ga0496100_0425828 3300048903 Bacteria 1014
150 Ga0496100_0428414 3300048903 Bacteria 1011
151 Ga0496101_0069406 3300048904 Bacteria 2578
152 Ga0496101_0260915 3300048904 Bacteria 1351
153 Ga0496102_0135610 3300048905 Bacteria 2306
154 Ga0496104_0237214 3300048907 Bacteria 1735
155 Ga0496105_0086223 3300048908 Bacteria 2594
156 Ga0496106_0525636 3300048909 Bacteria 950
157 Ga0496107_0192796 3300048910 Bacteria 1514
158 Ga0496108_0313298 3300048911 Bacteria 1367
159 Ga0496109_0557931 3300048912 Bacteria 1080
160 Ga0496110_0559078 3300048913 Bacteria 1039
161 Ga0496111_0234004 3300048914 Bacteria 1364
162 Ga0496112_0105085 3300048915 Bacteria 2794
163 Ga0496113_0237601 3300048916 Bacteria 1453
164 Ga0496114_0013533 3300048917 Bacteria 6544
165 Ga0496114_0068048 3300048917 Bacteria 2989
166 Ga0496116_0001751 3300048919 Bacteria 23646
167 Ga0496116_0085683 3300048919 Bacteria 1935
168 Ga0496116_0110163 3300048919 Bacteria 1620
169 Ga0496116_0152093 3300048919 Bacteria 1283
170 Ga0496117_0002529 3300048920 Bacteria 22887
171 Ga0496117_0016915 3300048920 Bacteria 6116
172 Ga0496117_0376839 3300048920 Bacteria 724
173 Ga0496119_0145468 3300048922 Bacteria 1275
174 Ga0496121_0020270 3300048924 Bacteria 6592
175 Ga0496121_0170367 3300048924 Bacteria 1582
176 Ga0496121_0408189 3300048924 Bacteria 887
177 Ga0496122_0000190 3300048925 Bacteria 140376
178 Ga0496122_0008170 3300048925 Bacteria 11380
179 Ga0496122_0062866 3300048925 Bacteria 2714
180 Ga0496122_0189597 3300048925 Bacteria 1215
181 Ga0496123_0001016 3300048926 Bacteria 42813
182 Ga0496123_0024026 3300048926 Bacteria 4647
183 Ga0496123_0109510 3300048926 Bacteria 1582
184 Ga0496123_0113420 3300048926 Bacteria 1543
185 Ga0496124_0010846 3300048927 Bacteria 9175
186 Ga0496124_0148412 3300048927 Bacteria 1842
187 Ga0496124_0188166 3300048927 Bacteria 1582
188 Ga0496124_0208851 3300048927 Bacteria 1479
189 Ga0496124_0348818 3300048927 Bacteria 1048
190 Ga0496124_0449981 3300048927 Bacteria 878
191 Ga0496125_0000273 3300048928 Bacteria 104663
192 Ga0496125_0048718 3300048928 Bacteria 3530
193 Ga0496125_0128706 3300048928 Bacteria 1787
194 Ga0496126_0000589 3300048929 Bacteria 68753
195 Ga0496126_0009857 3300048929 Bacteria 10109
196 Ga0496126_0160823 3300048929 Bacteria 1919
197 Ga0496126_0324182 3300048929 Bacteria 1265
198 Ga0501031_0000018 3300049568 Bacteria 106734
199 Ga0501031_0013742 3300049568 Bacteria 5277
200 Ga0501031_0016685 3300049568 Bacteria 4770
201 Ga0501032_0000003 3300049569 Bacteria 317700
202 Ga0501032_0000219 3300049569 Bacteria 47451
203 Ga0501032_0158306 3300049569 Bacteria 1487
204 Ga0501033_0000126 3300049570 Bacteria 74250
205 Ga0501033_0000132 3300049570 Bacteria 72558
206 Ga0501033_0093149 3300049570 Bacteria 2203
207 Ga0501034_0000005 3300049571 Bacteria 367512
208 Ga0501034_0006083 3300049571 Bacteria 13028
209 Ga0501034_0007278 3300049571 Bacteria 11800
210 Ga0501034_0084248 3300049571 Bacteria 3181
211 Ga0501034_0617224 3300049571 Bacteria 988
212 Ga0501036_0000005 3300049572 Bacteria 246420
213 Ga0501036_0022711 3300049572 Bacteria 5280
214 Ga0501036_0472867 3300049572 Bacteria 1044
215 Ga0501037_0000021 3300049573 Bacteria 150037
216 Ga0501037_0000045 3300049573 Bacteria 117148
217 Ga0501037_0010771 3300049573 Bacteria 6719
218 Ga0501038_0000001 3300049574 Bacteria 375481
219 Ga0501038_0000032 3300049574 Bacteria 131432
220 Ga0501038_0096080 3300049574 Bacteria 2474
221 Ga0501039_0000007 3300049575 Bacteria 277831
222 Ga0501039_0000025 3300049575 Bacteria 152236
223 Ga0501040_0078896 3300049576 Bacteria 2278
224 Ga0501042_0109031 3300049578 Bacteria 1993
225 Ga0501043_0000333 3300049579 Bacteria 42740
226 Ga0501043_0000575 3300049579 Bacteria 32805
227 Ga0501043_0048378 3300049579 Bacteria 3343
228 Ga0501046_0295741 3300049580 Bacteria 1183
229 Ga0501047_0000708 3300049581 Bacteria 34744
230 Ga0501047_1108233 3300049581 Bacteria 605
231 Ga0501070_0012303 3300049586 Bacteria 7222
232 Ga0501070_0277680 3300049586 Bacteria 1367
233 Ga0501035_0000008 3300049822 Bacteria 313425
234 Ga0501035_0000085 3300049822 Bacteria 116189
235 Ga0501035_0024843 3300049822 Bacteria 5494
236 Ga0501044_0000001 3300049823 Bacteria 418087
237 Ga0501044_0018565 3300049823 Bacteria 7452
238 Ga0501044_0032398 3300049823 Bacteria 5495
239 Ga0501045_0222550 3300049824 Bacteria 1405
240 nmdc:mga0yw44_145217_c1 3300050492 Bacteria 1544
241 nmdc:mga0yw44_431362_c1 3300050492 Bacteria 893
242 nmdc:mga06r32_1565608_c1 3300050510 Bacteria 598
243 nmdc:mga08y16_455344_c1 3300050511 Bacteria 1304
244 nmdc:mga0sz30_123471_c1 3300050516 Bacteria 1139
245 Ga0500644_0107050 3300053088 Bacteria 1071
246 Ga0500556_0085790 3300053104 Bacteria 1196
247 Ga0500560_158379 3300053107 Bacteria 750
248 Ga0500608_102676 3300053122 Bacteria 1322
249 Ga0500608_147902 3300053122 Bacteria 1033
250 Ga0500559_0347923 3300053136 Bacteria 693
251 Ga0500568_0000017 3300053139 Bacteria 197578
252 Ga0500616_0082511 3300053153 Bacteria 1612
253 Ga0500622_0001250 3300053156 Bacteria 20781
254 Ga0501084_1249495 3300054114 Bacteria 623
255 Ga0501082_0042344 3300060353 Bacteria 3926
256 2509111307 2508501122 Bacteria 6292184
257 2509376413 2509276019 Bacteria 6802256
258 2510304410 2510065057 Bacteria 6649661
259 2511389791 2511231027 Bacteria 5013807
260 2511502184 2511231052 Bacteria 6974333
261 2512533562 2512047086 Bacteria 6850303
262 2512970764 2512875026 Bacteria 6861065
263 2513588092 2513237086 Bacteria 7265287
264 2513604193 2513237089 Bacteria 6553624
265 2513617963 2513237091 Bacteria 6900273
266 2513885525 2513237140 Bacteria 7076289
267 2513903301 2513237143 Bacteria 6664116
268 2513985336 2513237156 Bacteria 6402557
269 2514006458 2513237160 Bacteria 6650282
270 2515608963 2515154107 Bacteria 6795637
271 2516204093 2516143018 Bacteria 6951533
272 2516893563 2516653046 Bacteria 6989037
273 2517570265 2517487022 Bacteria 7227575
274 2520378011 2519899620 Bacteria 6499161
275 2524448613 2524023207 Bacteria 6813453
276 2535485100 2534681786 Bacteria 3308809
277 2551674602 2551306084 Bacteria 8942552
278 2551675816 2551306084 Bacteria 8942552
279 2551684196 2551306085 Bacteria 7347181
280 2551694572 2551306086 Bacteria 6843938
281 2551703349 2551306087 Bacteria 7351905
282 2551708434 2551306089 Bacteria 7162724
283 2551723921 2551306090 Bacteria 7953713
284 2551724816 2551306091 Bacteria 7086830
285 2551737541 2551306092 Bacteria 6992595
286 2551746457 2551306093 Bacteria 7064773
287 2558867761 2558860100 Bacteria 8458965
288 2558868424 2558860100 Bacteria 8458965
289 2561468999 2558860983 Bacteria 4133860
290 2585166291 2582581283 Bacteria 6030556
291 2585200548 2582581294 Bacteria 6626667
292 2585267496 2582581306 Bacteria 6450535
293 2585386561 2582581865 Bacteria 6644329
294 2585843109 2585427594 Bacteria 6180594
295 2599331706 2599185156 Bacteria 5403036
296 2600194327 2599185352 Bacteria 7228948
297 2643803153 2643221557 Bacteria 7184309
298 2644003216 2643221599 Bacteria 6292121
299 2644063514 2643221610 Bacteria 7480339
300 2644107347 2643221618 Bacteria 7717186
301 2644150914 2643221626 Bacteria 8069654
302 2644205051 2643221636 Bacteria 6583769
303 2644308742 2643221655 Bacteria 7722067
304 2644335559 2643221659 Bacteria 7890716
305 2644374798 2643221668 Bacteria 7306521
306 2644414277 2643221675 Bacteria 7473456
307 2644447805 2643221680 Bacteria 7473610
308 2644483495 2643221686 Bacteria 6310811
309 2644491980 2643221688 Bacteria 5260751
310 2644499701 2643221689 Bacteria 6042950
311 2644539965 2643221698 Bacteria 7756764
312 2644614683 2643221712 Bacteria 7729434
313 2644676145 2643221723 Bacteria 7095460
314 2644690278 2643221726 Bacteria 7455827
315 2657681507 2657244999 Bacteria 5946535
316 2692315595 2690316117 Bacteria 6800650
317 2738800022 2738541293 Bacteria 7065685
318 2738948848 2738541317 Bacteria 5340176
319 2753461974 2751185821 Bacteria 6189929
320 2757569682 2757320392 Bacteria 3737298
321 2792585183 2791355082 Bacteria 5973319
322 2792620832 2791355091 Bacteria 6135441
323 2792626192 2791355092 Bacteria 6248105
324 2792639129 2791355094 Bacteria 7011481
325 2802719960 2802428858 Bacteria 6636079
326 2802727107 2802428859 Bacteria 6667919
327 2802731890 2802428860 Bacteria 6525526
328 2802739221 2802428861 Bacteria 6534206
329 2802745798 2802428862 Bacteria 6633353
330 2802752400 2802428863 Bacteria 6410669
331 2804752699 2802429268 Bacteria 6094027
332 2838076920 2838074704 Bacteria 6785777
333 2842871889 2842871566 Bacteria 4827117
334 2842924111 2842922631 Bacteria 5824079
335 2844166626 2844163670 Bacteria 7266046
336 2847419347 2847417321 Bacteria 6913799
337 2848994369 2848992105 Bacteria 6810864
338 2850081384 2850079185 Bacteria 6848280
339 2855826285 2855825444 Bacteria 6785811
340 2855841630 2855839649 Bacteria 7135830
341 2855876116 2855872281 Bacteria 6964271
342 2858801746 2858800743 Bacteria 6603254
343 2891373279 2891373044 Bacteria 5202277
344 2894656050 2894652903 Bacteria 4587256
345 2896388117 2896384573 Bacteria 7700774
346 2913299373 2913295892 Bacteria 6333755
347 2913313740 2913308742 Bacteria 5350706
348 2915981372 2915980308 Bacteria 6624279
349 2915989436 2915986958 Bacteria 6739310
350 2915998100 2915993759 Bacteria 7016183
351 2916006875 2916000859 Bacteria 6865702
352 2916013833 2916007675 Bacteria 6898660
353 2916017565 2916014648 Bacteria 6946486
354 2916025064 2916021584 Bacteria 6854472
355 2916029200 2916028427 Bacteria 6748433
356 2916041642 2916035215 Bacteria 6755766
357 2916044028 2916041962 Bacteria 6820487
358 2916054209 2916048683 Bacteria 6543552
359 2916061723 2916055098 Bacteria 6758838
360 2916064234 2916061851 Bacteria 6737736
361 2916070348 2916068649 Bacteria 6943657
362 2916077778 2916076590 Bacteria 6596108
363 2920761594 2920760137 Bacteria 7427611
364 2920825152 2920822456 Bacteria 6897201
365 2921205145 2921201388 Bacteria 6926299
366 2921214531 2921208531 Bacteria 6745326
367 2921239578 2921237296 Bacteria 6876710
368 2921245417 2921244191 Bacteria 6568419
369 2921252019 2921250672 Bacteria 6677771
370 2921261242 2921257292 Bacteria 6808382
371 2921264447 2921263974 Bacteria 6864552
372 2921285880 2921282425 Bacteria 6826397
373 2921289433 2921289301 Bacteria 7316391
374 2921302071 2921296804 Bacteria 7176999
375 2924148418 2924144063 Bacteria 6883928
376 2924158046 2924150972 Bacteria 7169444
377 2924159220 2924158325 Bacteria 7188855
378 2924166743 2924165586 Bacteria 7260590
379 2924174335 2924172951 Bacteria 6749356
380 2924183733 2924179722 Bacteria 6843264
381 2924197971 2924193448 Bacteria 6955718
382 2924204733 2924200457 Bacteria 6757188
383 2924211479 2924207177 Bacteria 6917007
384 2924215742 2924214083 Bacteria 7080103
385 2924225761 2924221636 Bacteria 7113495
386 2924233042 2924228884 Bacteria 6633132
387 2928523820 2928521798 Bacteria 4960112
388 2936999667 2936996657 Bacteria 6298727
389 2937007372 2937002841 Bacteria 6934057
390 2937012898 2937009748 Bacteria 6746052
391 2937022570 2937016420 Bacteria 6782579
392 2937026905 2937023124 Bacteria 6815156
393 2937030218 2937029754 Bacteria 6424026
394 2937042598 2937036028 Bacteria 6846469
395 2937045607 2937042894 Bacteria 6741576
396 2937053657 2937049772 Bacteria 6757901
397 2937063380 2937056579 Bacteria 7107896
398 2937070707 2937063883 Bacteria 7199456
399 2937071695 2937071275 Bacteria 6984483
400 2937080344 2937078374 Bacteria 6610289
401 2937086645 2937084907 Bacteria 6618516
402 2937098177 2937091812 Bacteria 6979387
403 2937102546 2937098957 Bacteria 7249374
404 2937109214 2937106411 Bacteria 6947143
405 2937117885 2937113482 Bacteria 6505872
406 2937124064 2937119839 Bacteria 6597547
407 2937130608 2937126314 Bacteria 6771275
408 2941502196 2941499720 Bacteria 7599444
409 2957376453 2957375807 Bacteria 6425588
410 2957383407 2957382221 Bacteria 6737050
411 2957392931 2957388812 Bacteria 6778072
412 2957395953 2957395598 Bacteria 6822399
413 2957406686 2957402308 Bacteria 6741770
414 2957410747 2957408893 Bacteria 6558585
415 2957417576 2957415311 Bacteria 6991633
416 2957423696 2957422303 Bacteria 7172205
417 2957434324 2957430029 Bacteria 7022557
418 2957440198 2957437181 Bacteria 6568994
419 2957446319 2957443900 Bacteria 6869977
420 2957454747 2957450854 Bacteria 6765715
421 2957461959 2957457609 Bacteria 6967680
422 2957468665 2957464669 Bacteria 6568877
423 2957476445 2957471148 Bacteria 6797643
424 2957484700 2957478035 Bacteria 6756658
425 2957488679 2957484790 Bacteria 6703082
426 2957496948 2957491536 Bacteria 6695180
427 2957503253 2957498199 Bacteria 7126688
428 2957510558 2957505466 Bacteria 7253085
429 2960592017 2960591022 Bacteria 6622873
430 2960602471 2960597568 Bacteria 6550735
431 2960606428 2960603979 Bacteria 6898737
432 2960612374 2960610863 Bacteria 6691244
433 2960621465 2960617483 Bacteria 6727748
434 2960630810 2960624210 Bacteria 6875384
435 2960631978 2960631154 Bacteria 6732508
436 2960638619 2960637947 Bacteria 7296468
437 2960649988 2960645483 Bacteria 7211087
438 2960654501 2960652885 Bacteria 7083688
439 2960661437 2960660292 Bacteria 7041660
440 2960671753 2960667422 Bacteria 6763020
441 2960678326 2960674078 Bacteria 6609048
442 2960681553 2960680706 Bacteria 6624464
443 2960692167 2960687367 Bacteria 6535474
444 2960698136 2960693952 Bacteria 6749742
445 2964614483 2964607997 Bacteria 7101408
446 2964621084 2964615318 Bacteria 6809089
447 2964625705 2964621998 Bacteria 6834995
448 2964632966 2964628898 Bacteria 7083044
449 2964640168 2964636051 Bacteria 7091832
450 2964646858 2964643177 Bacteria 6820887
451 2964655362 2964649959 Bacteria 6675118
452 2964663199 2964656573 Bacteria 7100150
453 2964668276 2964663802 Bacteria 7019362
454 2964672365 2964670856 Bacteria 6851364
455 2964681572 2964678106 Bacteria 6792020
456 2964691364 2964685014 Bacteria 6839111
457 2964698298 2964691889 Bacteria 6802758
458 2964705076 2964698721 Bacteria 6765331
459 2964709850 2964705432 Bacteria 7114648
460 2964716504 2964712639 Bacteria 6695970
461 2964721562 2964719344 Bacteria 7286602
462 2967666442 2967664464 Bacteria 6948836
463 2967675888 2967671571 Bacteria 7021409
464 2967684482 2967678726 Bacteria 7264382
465 2967688900 2967686174 Bacteria 6678622
466 2967699798 2967693043 Bacteria 6804451
467 2967704915 2967699805 Bacteria 6854538
468 2967711524 2967706974 Bacteria 7186053
469 2967714817 2967714385 Bacteria 7000047
470 2967725789 2967721400 Bacteria 7073753
471 2967729065 2967728569 Bacteria 6641507
472 2967738837 2967735183 Bacteria 6827012
473 2967745239 2967742019 Bacteria 6794534
474 2967753545 2967748971 Bacteria 6733771
475 2967758977 2967755722 Bacteria 6814706
476 2967768502 2967762386 Bacteria 6923502
477 2967773870 2967769361 Bacteria 6587838
478 2967777942 2967775926 Bacteria 6738189
479 2970023471 2970019648 Bacteria 7072033
480 2970030373 2970026789 Bacteria 6785236
481 2970040233 2970033650 Bacteria 7118744
482 2970042109 2970040964 Bacteria 6731123
483 2970053988 2970047711 Bacteria 7088379
484 2970059307 2970054988 Bacteria 6611507
485 2970065636 2970061556 Bacteria 7099761
486 2970075469 2970068827 Bacteria 7123112
487 2970080215 2970076120 Bacteria 6697332
488 2970087759 2970082768 Bacteria 6183754
489 2970093242 2970088815 Bacteria 6933825
490 2970100093 2970095765 Bacteria 6936963
491 2970108056 2970102677 Bacteria 6812532
492 2970113907 2970109326 Bacteria 6863976
493 2970117298 2970116247 Bacteria 6501857
494 2970127380 2970122695 Bacteria 6625855
495 2970133224 2970129317 Bacteria 6806560
496 2970140481 2970136068 Bacteria 7207982
497 2970146171 2970143518 Bacteria 6446480
498 2970155990 2970149975 Bacteria 6779706
499 2970161070 2970156795 Bacteria 7168044
500 2970168455 2970164137 Bacteria 6861252
501 2970171879 2970170962 Bacteria 6876229
502 2970182873 2970177841 Bacteria 6768001
503 2970188720 2970184632 Bacteria 7054431
504 2970196343 2970191845 Bacteria 7032787
505 2977518452 2977516862 Bacteria 6940108
506 2977526271 2977523885 Bacteria 6960446
507 2977534365 2977530762 Bacteria 6951399
508 2977541998 2977537788 Bacteria 6929320
509 2977547732 2977544691 Bacteria 6875412
510 2977558375 2977551784 Bacteria 7125765
511 2977562702 2977558990 Bacteria 6863948
512 2977570249 2977565890 Bacteria 6901543
513 2977577050 2977572785 Bacteria 6763888
514 2977583599 2977579622 Bacteria 6772100
515 2989349579 2989349275 Bacteria 6349068
516 2996313976 2996310559 Bacteria 6357320
517 3003933960 3003930520 Bacteria 5667563
518 3005454573 3005452660 Bacteria 5889319
519 643826228 643692032 Bacteria 6891900
520 648740514 648276728 Bacteria 6968865
521 8003994106 8003992118 Bacteria 7266902
522 8004001728 8003999396 Bacteria 7063185
523 8046771609 8046767195 Bacteria 7547379
524 8049295265 8049293176 Bacteria 6128433
525 Ga0209281_1001243
526 JGI25152J39213_1001554
527 JGI25150J39212_1000307
528 JGI25159J45721_1000040
529 JGI25151J46595_10000329
530 JGI25151J46595_10005257
531 JGI25406J46586_10083299
532 JGI25153J46596_10026399
533 rootL2_10020315
534 JGI25160J50197_1000128
535 JGI25160J50197_1004590
536 JGI25161J50226_1000504
537 Ga0006562J51391_1023002
538 Ga0055526_1000675
539 Ga0055524_1013330
540 Ga0055524_1014716
541 Ga0055524_1036732
542 Ga0055536_1000853
543 Ga0055528_1008457
544 Ga0055530_10009853
545 Ga0055540_1011119
546 Ga0055531_10004447
547 Ga0055543_1000130
548 Ga0065165_1000013
549 Ga0070670_100002228
550 Ga0070680_100327069
551 Ga0070661_100949338
552 Ga0070668_100150674
553 Ga0070671_100253231
554 Ga0070714_100028981
555 Ga0070663_100533833
556 Ga0070663_100728416
557 Ga0070681_10001659
558 Ga0070679_100374404
559 Ga0070665_100051595
560 Ga0068855_100032602
561 Ga0068855_100101357
562 Ga0070664_101399458
563 Ga0068856_100020634
564 Ga0068852_101043268
565 Ga0068863_100854587
566 Ga0081455_10036332
567 Ga0081540_1168017
568 Ga0081539_10001499
569 Ga0075369_10006052
570 Ga0075366_10522723
571 Ga0075370_10116024
572 Ga0079104_1022348
573 Ga0105251_10013331
574 Ga0105243_11105881
575 Ga0105248_10742386
576 Ga0105249_10127950
577 Ga0105249_10902529
578 Ga0157373_10458322
579 Ga0157370_10005492
580 Ga0171463_1003
581 Ga0157372_10132103
582 Ga0163163_10702449
583 Ga0157376_10717261
584 Ga0183363_1093
585 Ga0214544_1000161
586 Ga0214542_1000012
587 Ga0214542_1023729
588 Ga0214543_1000024
589 Ga0214543_1000038
590 Ga0228711_1000008
591 Ga0228710_1000009
592 Ga0209436_100194
593 Ga0207425_1000024
594 Ga0207425_1031597
595 Ga0209129_1000146
596 Ga0209129_1002468
597 Ga0209565_1051123
598 Ga0209673_1011034
599 Ga0209673_1016936
600 Ga0209673_1047776
601 Ga0209130_1000034
602 Ga0209130_1026677
603 Ga0209130_1033723
604 Ga0209676_1001758
605 Ga0209025_1000050
606 Ga0209025_1000314
607 Ga0209025_1011126
608 Ga0209025_1049408
609 Ga0209564_1000013
610 Ga0209564_1006200
611 Ga0209564_1034303
612 Ga0209758_1000083
613 Ga0209050_1003728
614 Ga0209256_1001430
615 Ga0209256_1001510
616 Ga0209256_1002653
617 Ga0209256_1007982
618 Ga0209256_1043912
619 Ga0207426_1000006
620 Ga0207426_1002432
621 Ga0209051_1002141
622 Ga0209257_1003795
623 Ga0207713_1088953
624 Ga0207660_10074024
625 Ga0207650_10005240
626 Ga0207664_10029022
627 Ga0207644_10251768
628 Ga0207679_10543339
629 Ga0207667_10067857
630 Ga0207667_10083219
631 Ga0207712_10400171
632 Ga0207668_10227293
633 Ga0207678_10041534
634 Ga0207698_10902559
635 Ga0209281_1000106
636 Ga0209371_1058231
637 Ga0209282_1000024
638 Ga0268266_10102385
639 Ga0307515_10000788
640 Ga0268256_1065375
641 Ga0307513_10003732
642 Ga0307408_100218617
643 Ga0307514_10122407
644 Ga0307405_10072875
645 Ga0307412_10210912
646 Ga0315914_1000012
647 Ga0307409_100071262
648 Ga0307409_101465081
649 Ga0315913_1000006
650 Ga0315915_1000010
651 Ga0373927_0003658
652 Ga0373925_0004759
653 Ga0395900_0230646
654 Ga0395898_0140310
655 Ga0395901_0199698
656 Ga0439436_0030747
657 Ga0439436_0071789
658 Ga0439436_0076414
659 Ga0439438_045929
660 Ga0439439_0136813
661 Ga0439465_0089228
662 Ga0439465_0258021
663 Ga0451791_1375656
664 Ga0451798_1063747
665 Ga0451833_1187501
666 Ga0439449_0002827
667 Ga0466967_0603711
668 Ga0495638_0014151
669 Ga0495650_0019347
670 Ga0495606_0116647
671 Ga0495588_0186486
672 Ga0496100_0306853
673 Ga0496100_0425828
674 Ga0496100_0428414
675 Ga0496101_0069406
676 Ga0496101_0260915
677 Ga0496102_0135610
678 Ga0496104_0237214
679 Ga0496105_0086223
680 Ga0496106_0525636
681 Ga0496107_0192796
682 Ga0496108_0313298
683 Ga0496109_0557931
684 Ga0496110_0559078
685 Ga0496111_0234004
686 Ga0496112_0105085
687 Ga0496113_0237601
688 Ga0496114_0013533
689 Ga0496114_0068048
690 Ga0496116_0001751
691 Ga0496116_0085683
692 Ga0496116_0110163
693 Ga0496116_0152093
694 Ga0496117_0002529
695 Ga0496117_0016915
696 Ga0496117_0376839
697 Ga0496119_0145468
698 Ga0496121_0020270
699 Ga0496121_0170367
700 Ga0496121_0408189
701 Ga0496122_0000190
702 Ga0496122_0008170
703 Ga0496122_0062866
704 Ga0496122_0189597
705 Ga0496123_0001016
706 Ga0496123_0024026
707 Ga0496123_0109510
708 Ga0496123_0113420
709 Ga0496124_0010846
710 Ga0496124_0148412
711 Ga0496124_0188166
712 Ga0496124_0208851
713 Ga0496124_0348818
714 Ga0496124_0449981
715 Ga0496125_0000273
716 Ga0496125_0048718
717 Ga0496125_0128706
718 Ga0496126_0000589
719 Ga0496126_0009857
720 Ga0496126_0160823
721 Ga0496126_0324182
722 Ga0501031_0000018
723 Ga0501031_0013742
724 Ga0501031_0016685
725 Ga0501032_0000003
726 Ga0501032_0000219
727 Ga0501032_0158306
728 Ga0501033_0000126
729 Ga0501033_0000132
730 Ga0501033_0093149
731 Ga0501034_0000005
732 Ga0501034_0006083
733 Ga0501034_0007278
734 Ga0501034_0084248
735 Ga0501034_0617224
736 Ga0501036_0000005
737 Ga0501036_0022711
738 Ga0501036_0472867
739 Ga0501037_0000021
740 Ga0501037_0000045
741 Ga0501037_0010771
742 Ga0501038_0000001
743 Ga0501038_0000032
744 Ga0501038_0096080
745 Ga0501039_0000007
746 Ga0501039_0000025
747 Ga0501040_0078896
748 Ga0501042_0109031
749 Ga0501043_0000333
750 Ga0501043_0000575
751 Ga0501043_0048378
752 Ga0501046_0295741
753 Ga0501047_0000708
754 Ga0501047_1108233
755 Ga0501070_0012303
756 Ga0501070_0277680
757 Ga0501035_0000008
758 Ga0501035_0000085
759 Ga0501035_0024843
760 Ga0501044_0000001
761 Ga0501044_0018565
762 Ga0501044_0032398
763 Ga0501045_0222550
764 nmdc:mga0yw44_145217_c1
765 nmdc:mga0yw44_431362_c1
766 nmdc:mga06r32_1565608_c1
767 nmdc:mga08y16_455344_c1
768 nmdc:mga0sz30_123471_c1
769 Ga0500644_0107050
770 Ga0500556_0085790
771 Ga0500560_158379
772 Ga0500608_102676
773 Ga0500608_147902
774 Ga0500559_0347923
775 Ga0500568_0000017
776 Ga0500616_0082511
777 Ga0500622_0001250
778 Ga0501084_1249495
779 Ga0501082_0042344
780 2509111307
781 2509376413
782 2510304410
783 2511389791
784 2511502184
785 2512533562
786 2512970764
787 2513588092
788 2513604193
789 2513617963
790 2513885525
791 2513903301
792 2513985336
793 2514006458
794 2515608963
795 2516204093
796 2516893563
797 2517570265
798 2520378011
799 2524448613
800 2535485100
801 2551674602
802 2551675816
803 2551684196
804 2551694572
805 2551703349
806 2551708434
807 2551723921
808 2551724816
809 2551737541
810 2551746457
811 2558867761
812 2558868424
813 2561468999
814 2585166291
815 2585200548
816 2585267496
817 2585386561
818 2585843109
819 2599331706
820 2600194327
821 2643803153
822 2644003216
823 2644063514
824 2644107347
825 2644150914
826 2644205051
827 2644308742
828 2644335559
829 2644374798
830 2644414277
831 2644447805
832 2644483495
833 2644491980
834 2644499701
835 2644539965
836 2644614683
837 2644676145
838 2644690278
839 2657681507
840 2692315595
841 2738800022
842 2738948848
843 2753461974
844 2757569682
845 2792585183
846 2792620832
847 2792626192
848 2792639129
849 2802719960
850 2802727107
851 2802731890
852 2802739221
853 2802745798
854 2802752400
855 2804752699
856 2838076920
857 2842871889
858 2842924111
859 2844166626
860 2847419347
861 2848994369
862 2850081384
863 2855826285
864 2855841630
865 2855876116
866 2858801746
867 2891373279
868 2894656050
869 2896388117
870 2913299373
871 2913313740
872 2915981372
873 2915989436
874 2915998100
875 2916006875
876 2916013833
877 2916017565
878 2916025064
879 2916029200
880 2916041642
881 2916044028
882 2916054209
883 2916061723
884 2916064234
885 2916070348
886 2916077778
887 2920761594
888 2920825152
889 2921205145
890 2921214531
891 2921239578
892 2921245417
893 2921252019
894 2921261242
895 2921264447
896 2921285880
897 2921289433
898 2921302071
899 2924148418
900 2924158046
901 2924159220
902 2924166743
903 2924174335
904 2924183733
905 2924197971
906 2924204733
907 2924211479
908 2924215742
909 2924225761
910 2924233042
911 2928523820
912 2936999667
913 2937007372
914 2937012898
915 2937022570
916 2937026905
917 2937030218
918 2937042598
919 2937045607
920 2937053657
921 2937063380
922 2937070707
923 2937071695
924 2937080344
925 2937086645
926 2937098177
927 2937102546
928 2937109214
929 2937117885
930 2937124064
931 2937130608
932 2941502196
933 2957376453
934 2957383407
935 2957392931
936 2957395953
937 2957406686
938 2957410747
939 2957417576
940 2957423696
941 2957434324
942 2957440198
943 2957446319
944 2957454747
945 2957461959
946 2957468665
947 2957476445
948 2957484700
949 2957488679
950 2957496948
951 2957503253
952 2957510558
953 2960592017
954 2960602471
955 2960606428
956 2960612374
957 2960621465
958 2960630810
959 2960631978
960 2960638619
961 2960649988
962 2960654501
963 2960661437
964 2960671753
965 2960678326
966 2960681553
967 2960692167
968 2960698136
969 2964614483
970 2964621084
971 2964625705
972 2964632966
973 2964640168
974 2964646858
975 2964655362
976 2964663199
977 2964668276
978 2964672365
979 2964681572
980 2964691364
981 2964698298
982 2964705076
983 2964709850
984 2964716504
985 2964721562
986 2967666442
987 2967675888
988 2967684482
989 2967688900
990 2967699798
991 2967704915
992 2967711524
993 2967714817
994 2967725789
995 2967729065
996 2967738837
997 2967745239
998 2967753545
999 2967758977
1000 2967768502
1001 2967773870
1002 2967777942
1003 2970023471
1004 2970030373
1005 2970040233
1006 2970042109
1007 2970053988
1008 2970059307
1009 2970065636
1010 2970075469
1011 2970080215
1012 2970087759
1013 2970093242
1014 2970100093
1015 2970108056
1016 2970113907
1017 2970117298
1018 2970127380
1019 2970133224
1020 2970140481
1021 2970146171
1022 2970155990
1023 2970161070
1024 2970168455
1025 2970171879
1026 2970182873
1027 2970188720
1028 2970196343
1029 2977518452
1030 2977526271
1031 2977534365
1032 2977541998
1033 2977547732
1034 2977558375
1035 2977562702
1036 2977570249
1037 2977577050
1038 2977583599
1039 2989349579
1040 2996313976
1041 3003933960
1042 3005454573
1043 643826228
1044 648740514
1045 8003994106
1046 8004001728
1047 8046771609
1048 8049295265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

13

177

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.9557 6 170
7mym-assembly1.cif.gz_A crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph 0.9553 6 169
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.9543 6 170
4p68-assembly1.cif.gz_A electrostatics of active site microenvironments for e. coli dhfr 0.954 6 170
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9528 6 170
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9565 6 170 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9369 5 170 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9369 5 170 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9255 5 170 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.922 5 170 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1H8RC03-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9915 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7X8Y905-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9877 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1H8RC03-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9857 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7X8Y905-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9819 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4R5PHC5-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9752 2 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map