F459167

General Info

Members Datasets Scaffolds Average Seq Length
524 213 1048 157

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0082122|Ga0439462_0082122_156_713
Length 185
Sequence MGVGHGGQVLYLRAWLRIGKPHRLVVGTMINAGFTELLLGLLAILLLVAAVIDVRTFTISNSLNLSIALLAPLYWLSIALPLWPNAAIQLAVGAGVFTLLAGAFYAGMMGGGDVKLAAALALWFSPASTVKFLVLMSLAGGVLTLVVVALHRARGKAGRPEIPYGVAIAFGGLVILTQRFLNQFA

Samples

Sample ID Description Type Environment
1 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439462_0082122 3300042015 Bacteria 881
2 JGI24741J21665_1024051 3300001915 Bacteria 937
3 JGI24740J21852_10001677 3300001979 Bacteria 10166
4 JGI24740J21852_10006406 3300001979 Bacteria 4879
5 JGI24739J22299_10010205 3300001989 Bacteria 3489
6 JGI24739J22299_10018551 3300001989 Bacteria 2499
7 JGI24737J22298_10000221 3300001990 Bacteria 18699
8 JGI24737J22298_10034433 3300001990 Bacteria 1570
9 JGI24737J22298_10048327 3300001990 Bacteria 1295
10 JGI24737J22298_10100641 3300001990 Bacteria 856
11 JGI24743J22301_10006580 3300001991 Bacteria 1987
12 JGI24735J21928_10093067 3300002067 Bacteria 865
13 JGI24750J21931_1007719 3300002070 Bacteria 1357
14 JGI24745J21846_1005138 3300002073 Bacteria 1421
15 JGI24738J21930_10008528 3300002075 Bacteria 2330
16 JGI24744J21845_10029985 3300002077 Bacteria 1044
17 JGI24034J26672_10028609 3300002239 Bacteria 900
18 Ga0065715_10009313 3300005293 Bacteria 2865
19 Ga0065715_10036540 3300005293 Bacteria 1458
20 Ga0070658_10077516 3300005327 Bacteria 2727
21 Ga0070658_10187940 3300005327 Bacteria 1740
22 Ga0070658_11414388 3300005327 Bacteria 603
23 Ga0070676_10002314 3300005328 Bacteria 9742
24 Ga0070676_10004745 3300005328 Bacteria 7190
25 Ga0070676_10012510 3300005328 Bacteria 4636
26 Ga0070676_10038089 3300005328 Bacteria 2776
27 Ga0070676_10424335 3300005328 Bacteria 930
28 Ga0070683_100093326 3300005329 Bacteria 2827
29 Ga0070670_100005417 3300005331 Bacteria 10767
30 Ga0070670_100044489 3300005331 Bacteria 3818
31 Ga0070670_100047275 3300005331 Bacteria 3702
32 Ga0070670_100253196 3300005331 Bacteria 1534
33 Ga0070670_101099541 3300005331 Bacteria 725
34 Ga0070670_101204550 3300005331 Unclassified 692
35 Ga0070677_10017076 3300005333 Bacteria 2592
36 Ga0070677_10047171 3300005333 Bacteria 1726
37 Ga0068869_100000662 3300005334 Bacteria 19510
38 Ga0068869_100013127 3300005334 Bacteria 5500
39 Ga0068869_100187507 3300005334 Bacteria 1625
40 Ga0068869_100524880 3300005334 Bacteria 991
41 Ga0070666_10016286 3300005335 Bacteria 4755
42 Ga0070666_10016307 3300005335 Bacteria 4751
43 Ga0070666_10109944 3300005335 Bacteria 1905
44 Ga0070680_100122607 3300005336 Bacteria 2170
45 Ga0070680_100672210 3300005336 Bacteria 891
46 Ga0070682_100229205 3300005337 Bacteria 1327
47 Ga0070682_100665627 3300005337 Bacteria 831
48 Ga0068868_100001411 3300005338 Bacteria 16565
49 Ga0068868_100117591 3300005338 Bacteria 2166
50 Ga0068868_100346260 3300005338 Bacteria 1272
51 Ga0070660_100010601 3300005339 Bacteria 6515
52 Ga0070660_100064014 3300005339 Bacteria 2860
53 Ga0070660_100091564 3300005339 Bacteria 2399
54 Ga0070660_100128812 3300005339 Bacteria 2024
55 Ga0070660_100492905 3300005339 Bacteria 1019
56 Ga0070660_100545835 3300005339 Bacteria 967
57 Ga0070660_100733816 3300005339 Bacteria 829
58 Ga0070660_100953178 3300005339 Bacteria 724
59 Ga0070660_101087949 3300005339 Bacteria 676
60 Ga0070691_10208438 3300005341 Bacteria 1030
61 Ga0070661_100882323 3300005344 Bacteria 737
62 Ga0070668_100007531 3300005347 Bacteria 8085
63 Ga0070668_100040876 3300005347 Bacteria 3550
64 Ga0070668_100098504 3300005347 Bacteria 2314
65 Ga0070669_100000682 3300005353 Bacteria 24837
66 Ga0070669_100025231 3300005353 Bacteria 4269
67 Ga0070669_100114258 3300005353 Bacteria 2052
68 Ga0070675_100003697 3300005354 Bacteria 11623
69 Ga0070675_100042801 3300005354 Bacteria 3701
70 Ga0070675_100133608 3300005354 Bacteria 2116
71 Ga0070675_100266298 3300005354 Bacteria 1503
72 Ga0070671_100007783 3300005355 Bacteria 8561
73 Ga0070671_100043661 3300005355 Bacteria 3725
74 Ga0070671_100058477 3300005355 Bacteria 3209
75 Ga0070674_100052696 3300005356 Bacteria 2807
76 Ga0070673_100000833 3300005364 Bacteria 17279
77 Ga0070673_100009304 3300005364 Bacteria 6592
78 Ga0070673_100033051 3300005364 Bacteria 3901
79 Ga0070673_100066431 3300005364 Bacteria 2881
80 Ga0070659_100000950 3300005366 Bacteria 21306
81 Ga0070659_100001481 3300005366 Bacteria 16916
82 Ga0070659_100039104 3300005366 Bacteria 3702
83 Ga0070659_100334758 3300005366 Bacteria 1267
84 Ga0070659_100438140 3300005366 Bacteria 1107
85 Ga0070667_100000776 3300005367 Bacteria 30243
86 Ga0070667_100006561 3300005367 Bacteria 9673
87 Ga0070667_100013906 3300005367 Bacteria 6654
88 Ga0070667_100058875 3300005367 Bacteria 3248
89 Ga0070667_100252556 3300005367 Bacteria 1577
90 Ga0070667_100455961 3300005367 Bacteria 1169
91 Ga0070667_101047906 3300005367 Bacteria 762
92 Ga0070694_100003228 3300005444 Bacteria 9732
93 Ga0070663_100005818 3300005455 Bacteria 7365
94 Ga0070663_100022238 3300005455 Bacteria 4236
95 Ga0070663_100521755 3300005455 Bacteria 989
96 Ga0070663_101906632 3300005455 Bacteria 534
97 Ga0070662_100006881 3300005457 Bacteria 7357
98 Ga0070662_100022242 3300005457 Bacteria 4337
99 Ga0070662_100034774 3300005457 Bacteria 3555
100 Ga0070662_100049099 3300005457 Bacteria 3042
101 Ga0070662_100141249 3300005457 Bacteria 1866
102 Ga0070681_10090766 3300005458 Bacteria 3005
103 Ga0070681_10163066 3300005458 Bacteria 2153
104 Ga0070681_10378623 3300005458 Bacteria 1326
105 Ga0068867_100033101 3300005459 Bacteria 3741
106 Ga0068867_100035018 3300005459 Bacteria 3640
107 Ga0068867_101687128 3300005459 Bacteria 594
108 Ga0070679_100033899 3300005530 Bacteria 5057
109 Ga0070679_100753421 3300005530 Bacteria 917
110 Ga0070679_100808397 3300005530 Bacteria 881
111 Ga0070684_100218702 3300005535 Bacteria 1738
112 Ga0068853_100001659 3300005539 Bacteria 16300
113 Ga0068853_100139035 3300005539 Bacteria 2179
114 Ga0068853_100233159 3300005539 Bacteria 1684
115 Ga0068853_100835526 3300005539 Bacteria 883
116 Ga0070672_100000589 3300005543 Bacteria 21279
117 Ga0070672_100097092 3300005543 Bacteria 2385
118 Ga0070672_100307710 3300005543 Bacteria 1344
119 Ga0070672_101346839 3300005543 Bacteria 638
120 Ga0070695_100134661 3300005545 Bacteria 1706
121 Ga0070695_101690110 3300005545 Bacteria 530
122 Ga0070696_100019918 3300005546 Bacteria 4547
123 Ga0070693_100009371 3300005547 Bacteria 4864
124 Ga0070693_100172114 3300005547 Bacteria 1388
125 Ga0070665_100071855 3300005548 Bacteria 3467
126 Ga0070665_100533889 3300005548 Bacteria 1185
127 Ga0070704_100180504 3300005549 Bacteria 1688
128 Ga0068855_100008531 3300005563 Bacteria 12386
129 Ga0068855_100889489 3300005563 Bacteria 941
130 Ga0070664_100008433 3300005564 Bacteria 8333
131 Ga0070664_100009351 3300005564 Bacteria 7946
132 Ga0070664_100095934 3300005564 Bacteria 2573
133 Ga0070664_100320269 3300005564 Bacteria 1405
134 Ga0070664_100939337 3300005564 Bacteria 812
135 Ga0070664_102022803 3300005564 Bacteria 547
136 Ga0068857_100000692 3300005577 Bacteria 25055
137 Ga0068857_100128610 3300005577 Bacteria 2283
138 Ga0068854_100001058 3300005578 Bacteria 16545
139 Ga0068854_100003715 3300005578 Bacteria 9548
140 Ga0068854_100014106 3300005578 Bacteria 5260
141 Ga0068852_100024796 3300005616 Bacteria 4851
142 Ga0068852_100181698 3300005616 Bacteria 1978
143 Ga0068859_100002632 3300005617 Bacteria 18266
144 Ga0068859_100007420 3300005617 Bacteria 11132
145 Ga0068859_100016870 3300005617 Bacteria 7330
146 Ga0068859_100032223 3300005617 Bacteria 5265
147 Ga0068859_100034904 3300005617 Bacteria 5046
148 Ga0068864_100000287 3300005618 Bacteria 44806
149 Ga0068864_100000748 3300005618 Bacteria 27277
150 Ga0068864_100000894 3300005618 Bacteria 25097
151 Ga0068864_100013544 3300005618 Bacteria 6761
152 Ga0068864_101089932 3300005618 Bacteria 794
153 Ga0068866_10770154 3300005718 Bacteria 666
154 Ga0068861_100024292 3300005719 Bacteria 4382
155 Ga0068861_100946812 3300005719 Bacteria 819
156 Ga0068851_10559861 3300005834 Bacteria 692
157 Ga0068870_10247865 3300005840 Bacteria 1103
158 Ga0068863_100002077 3300005841 Bacteria 19858
159 Ga0068863_100050840 3300005841 Bacteria 3928
160 Ga0068863_100062372 3300005841 Bacteria 3525
161 Ga0068863_100120017 3300005841 Bacteria 2506
162 Ga0068863_100585507 3300005841 Bacteria 1103
163 Ga0068858_100000579 3300005842 Bacteria 38345
164 Ga0068858_100012043 3300005842 Bacteria 8153
165 Ga0068858_100032449 3300005842 Bacteria 4849
166 Ga0068858_100033541 3300005842 Bacteria 4762
167 Ga0068858_100459945 3300005842 Bacteria 1227
168 Ga0068860_100004159 3300005843 Bacteria 14831
169 Ga0068860_100006012 3300005843 Bacteria 12215
170 Ga0068860_100019373 3300005843 Bacteria 6599
171 Ga0068860_100025537 3300005843 Bacteria 5700
172 Ga0068862_100018299 3300005844 Bacteria 5835
173 Ga0068862_100096710 3300005844 Bacteria 2578
174 Ga0068862_100941099 3300005844 Bacteria 851
175 Ga0081539_10017580 3300005985 Bacteria 5011
176 Ga0070712_100118137 3300006175 Bacteria 1991
177 Ga0097621_100470385 3300006237 Bacteria 1135
178 Ga0075433_10203594 3300006852 Bacteria 1759
179 Ga0075434_100119783 3300006871 Bacteria 2646
180 Ga0068865_100077559 3300006881 Bacteria 2375
181 Ga0097620_100002632 3300006931 Bacteria 18266
182 Ga0097620_100007420 3300006931 Bacteria 11132
183 Ga0097620_100016869 3300006931 Bacteria 7330
184 Ga0097620_100032223 3300006931 Bacteria 5265
185 Ga0097620_100034904 3300006931 Bacteria 5046
186 Ga0075435_100190747 3300007076 Bacteria 1735
187 Ga0105251_10085545 3300009011 Bacteria 1453
188 Ga0105250_10005450 3300009092 Bacteria 5703
189 Ga0105240_10104592 3300009093 Bacteria 3438
190 Ga0105240_10172394 3300009093 Bacteria 2561
191 Ga0105245_10005839 3300009098 Bacteria 10806
192 Ga0105245_10030174 3300009098 Bacteria 4793
193 Ga0105247_10148459 3300009101 Bacteria 1543
194 Ga0105247_10179959 3300009101 Bacteria 1411
195 Ga0105243_10023746 3300009148 Bacteria 4673
196 Ga0105241_10098336 3300009174 Bacteria 2321
197 Ga0105242_10048328 3300009176 Bacteria 3458
198 Ga0105248_10000552 3300009177 Bacteria 42448
199 Ga0105248_10006033 3300009177 Bacteria 13304
200 Ga0105248_10010327 3300009177 Bacteria 10277
201 Ga0105248_10082850 3300009177 Bacteria 3608
202 Ga0105248_10260014 3300009177 Bacteria 1954
203 Ga0105238_10064099 3300009551 Bacteria 3675
204 Ga0105249_10020672 3300009553 Bacteria 5886
205 Ga0105249_10047596 3300009553 Bacteria 3908
206 Ga0105249_10329902 3300009553 Bacteria 1539
207 Ga0105239_10145487 3300010375 Bacteria 2643
208 Ga0105239_10284780 3300010375 Bacteria 1861
209 Ga0105246_10202665 3300011119 Bacteria 1543
210 Ga0157373_10005180 3300013100 Bacteria 9797
211 Ga0157373_10030128 3300013100 Bacteria 3905
212 Ga0157373_10126438 3300013100 Bacteria 1798
213 Ga0157373_10209815 3300013100 Bacteria 1373
214 Ga0157373_11055251 3300013100 Bacteria 608
215 Ga0157371_10004027 3300013102 Bacteria 13004
216 Ga0157371_10044632 3300013102 Bacteria 3155
217 Ga0157371_10048674 3300013102 Bacteria 3013
218 Ga0157371_10068264 3300013102 Bacteria 2516
219 Ga0157371_11283196 3300013102 Bacteria 566
220 Ga0157378_10011763 3300013297 Bacteria 7660
221 Ga0157378_11034548 3300013297 Bacteria 856
222 Ga0163162_10050160 3300013306 Bacteria 4185
223 Ga0163162_10052041 3300013306 Bacteria 4111
224 Ga0163162_10328724 3300013306 Bacteria 1661
225 Ga0163162_10429662 3300013306 Bacteria 1453
226 Ga0157372_10053038 3300013307 Bacteria 4518
227 Ga0157375_10409993 3300013308 Bacteria 1521
228 Ga0157375_11031427 3300013308 Bacteria 961
229 Ga0163163_10000390 3300014325 Bacteria 41759
230 Ga0163163_11929995 3300014325 Bacteria 650
231 Ga0157380_10004000 3300014326 Bacteria 10176
232 Ga0157380_10026397 3300014326 Bacteria 4410
233 Ga0157380_10026652 3300014326 Bacteria 4390
234 Ga0157377_10025447 3300014745 Bacteria 3156
235 Ga0157377_10381605 3300014745 Bacteria 954
236 Ga0157379_10180699 3300014968 Bacteria 1906
237 Ga0157379_10465856 3300014968 Bacteria 1168
238 Ga0157379_10848286 3300014968 Bacteria 864
239 Ga0157379_10919406 3300014968 Bacteria 831
240 Ga0213875_10002975 3300021388 Bacteria 9873
241 Ga0207673_1000994 3300025290 Bacteria 3046
242 Ga0207697_10000253 3300025315 Bacteria 29506
243 Ga0207656_10500629 3300025321 Bacteria 617
244 Ga0207696_1004959 3300025711 Bacteria 5615
245 Ga0207682_10001459 3300025893 Bacteria 10925
246 Ga0207682_10037597 3300025893 Bacteria 1961
247 Ga0207682_10185145 3300025893 Bacteria 952
248 Ga0207642_10017810 3300025899 Bacteria 2711
249 Ga0207710_10278561 3300025900 Bacteria 841
250 Ga0207688_10000652 3300025901 Bacteria 17096
251 Ga0207688_10607426 3300025901 Bacteria 689
252 Ga0207647_10000327 3300025904 Bacteria 38973
253 Ga0207647_10000760 3300025904 Bacteria 25232
254 Ga0207645_10007069 3300025907 Bacteria 7983
255 Ga0207645_10017352 3300025907 Bacteria 4752
256 Ga0207645_10061798 3300025907 Bacteria 2393
257 Ga0207643_10180326 3300025908 Bacteria 1278
258 Ga0207705_10408753 3300025909 Bacteria 1050
259 Ga0207707_10155977 3300025912 Bacteria 1997
260 Ga0207707_10282084 3300025912 Bacteria 1439
261 Ga0207707_10608263 3300025912 Bacteria 925
262 Ga0207695_10137659 3300025913 Bacteria 2393
263 Ga0207693_10040495 3300025915 Bacteria 3670
264 Ga0207660_10079087 3300025917 Bacteria 2411
265 Ga0207660_10254269 3300025917 Bacteria 1387
266 Ga0207657_10003476 3300025919 Bacteria 16805
267 Ga0207657_10009310 3300025919 Bacteria 9892
268 Ga0207657_10025878 3300025919 Bacteria 5404
269 Ga0207657_10062356 3300025919 Bacteria 3193
270 Ga0207657_10378404 3300025919 Bacteria 1115
271 Ga0207657_10519777 3300025919 Bacteria 932
272 Ga0207657_10633242 3300025919 Bacteria 833
273 Ga0207657_10853312 3300025919 Bacteria 703
274 Ga0207649_10104439 3300025920 Bacteria 1881
275 Ga0207649_10415378 3300025920 Bacteria 1009
276 Ga0207652_11599847 3300025921 Bacteria 556
277 Ga0207681_10018564 3300025923 Bacteria 4382
278 Ga0207681_10025163 3300025923 Bacteria 3826
279 Ga0207681_10060721 3300025923 Bacteria 2596
280 Ga0207681_10088083 3300025923 Bacteria 2210
281 Ga0207681_10126585 3300025923 Bacteria 1882
282 Ga0207650_10063190 3300025925 Bacteria 2767
283 Ga0207650_10068150 3300025925 Bacteria 2672
284 Ga0207650_10147802 3300025925 Bacteria 1852
285 Ga0207650_11353542 3300025925 Bacteria 606
286 Ga0207659_10004610 3300025926 Bacteria 8342
287 Ga0207659_10012653 3300025926 Bacteria 5380
288 Ga0207659_10117106 3300025926 Bacteria 2035
289 Ga0207659_10142012 3300025926 Bacteria 1865
290 Ga0207687_10003036 3300025927 Bacteria 11376
291 Ga0207687_10141139 3300025927 Bacteria 1828
292 Ga0207664_11310686 3300025929 Bacteria 644
293 Ga0207644_10021887 3300025931 Bacteria 4360
294 Ga0207644_10044552 3300025931 Bacteria 3152
295 Ga0207644_10102178 3300025931 Bacteria 2155
296 Ga0207644_10512081 3300025931 Bacteria 991
297 Ga0207690_10001585 3300025932 Bacteria 14215
298 Ga0207690_10002341 3300025932 Bacteria 11505
299 Ga0207690_10023323 3300025932 Bacteria 3861
300 Ga0207690_10185459 3300025932 Bacteria 1569
301 Ga0207706_10000143 3300025933 Bacteria 77680
302 Ga0207706_10000904 3300025933 Bacteria 30508
303 Ga0207706_10003074 3300025933 Bacteria 16047
304 Ga0207706_10004098 3300025933 Bacteria 13773
305 Ga0207706_10013609 3300025933 Bacteria 7389
306 Ga0207706_10215155 3300025933 Bacteria 1683
307 Ga0207669_10014002 3300025937 Bacteria 4007
308 Ga0207704_10047537 3300025938 Bacteria 2565
309 Ga0207704_10056039 3300025938 Bacteria 2412
310 Ga0207691_10000743 3300025940 Bacteria 32192
311 Ga0207691_10066655 3300025940 Bacteria 3257
312 Ga0207691_10146453 3300025940 Bacteria 2079
313 Ga0207691_10329549 3300025940 Bacteria 1308
314 Ga0207691_10847910 3300025940 Bacteria 766
315 Ga0207711_10000046 3300025941 Bacteria 153238
316 Ga0207711_10006545 3300025941 Bacteria 9811
317 Ga0207711_10059860 3300025941 Bacteria 3280
318 Ga0207711_10293281 3300025941 Bacteria 1499
319 Ga0207689_10000372 3300025942 Bacteria 42301
320 Ga0207689_10003887 3300025942 Bacteria 13614
321 Ga0207689_10012702 3300025942 Bacteria 7193
322 Ga0207661_10095396 3300025944 Bacteria 2487
323 Ga0207661_11149047 3300025944 Bacteria 715
324 Ga0207679_10039220 3300025945 Bacteria 3380
325 Ga0207679_10040787 3300025945 Bacteria 3326
326 Ga0207679_10189033 3300025945 Bacteria 1710
327 Ga0207679_10544793 3300025945 Bacteria 1040
328 Ga0207667_10069720 3300025949 Bacteria 3659
329 Ga0207667_10130037 3300025949 Bacteria 2593
330 Ga0207651_10000440 3300025960 Bacteria 17582
331 Ga0207651_10001136 3300025960 Bacteria 11874
332 Ga0207651_10199460 3300025960 Bacteria 1602
333 Ga0207651_10544690 3300025960 Bacteria 1008
334 Ga0207712_10000491 3300025961 Bacteria 32766
335 Ga0207712_10288626 3300025961 Bacteria 1342
336 Ga0207668_10050499 3300025972 Bacteria 2867
337 Ga0207668_10094425 3300025972 Bacteria 2205
338 Ga0207668_10098447 3300025972 Bacteria 2167
339 Ga0207668_10132596 3300025972 Bacteria 1904
340 Ga0207640_10009513 3300025981 Bacteria 5444
341 Ga0207640_10021292 3300025981 Bacteria 3863
342 Ga0207640_10106567 3300025981 Bacteria 1977
343 Ga0207658_10007445 3300025986 Bacteria 7463
344 Ga0207658_10017187 3300025986 Bacteria 4984
345 Ga0207658_10018485 3300025986 Bacteria 4813
346 Ga0207658_10066051 3300025986 Bacteria 2719
347 Ga0207658_10373405 3300025986 Bacteria 1247
348 Ga0207677_10023455 3300026023 Bacteria 3813
349 Ga0207677_10061824 3300026023 Bacteria 2595
350 Ga0207677_10113574 3300026023 Bacteria 2022
351 Ga0207677_10391352 3300026023 Bacteria 1176
352 Ga0207703_10002126 3300026035 Bacteria 17427
353 Ga0207703_10002982 3300026035 Bacteria 14350
354 Ga0207703_10003193 3300026035 Bacteria 13798
355 Ga0207703_10132812 3300026035 Bacteria 2152
356 Ga0207703_10642265 3300026035 Bacteria 1006
357 Ga0207639_10005382 3300026041 Bacteria 8654
358 Ga0207639_10037273 3300026041 Bacteria 3610
359 Ga0207639_10640146 3300026041 Bacteria 983
360 Ga0207678_10000308 3300026067 Bacteria 43995
361 Ga0207678_10008496 3300026067 Bacteria 9051
362 Ga0207678_10043334 3300026067 Bacteria 3894
363 Ga0207678_10251570 3300026067 Bacteria 1513
364 Ga0207678_10283700 3300026067 Bacteria 1422
365 Ga0207641_10001374 3300026088 Bacteria 24044
366 Ga0207641_10010491 3300026088 Bacteria 7604
367 Ga0207641_10016527 3300026088 Bacteria 6043
368 Ga0207641_10098576 3300026088 Bacteria 2570
369 Ga0207641_10120193 3300026088 Bacteria 2343
370 Ga0207648_10031677 3300026089 Bacteria 4674
371 Ga0207648_10169583 3300026089 Bacteria 1929
372 Ga0207676_10000345 3300026095 Bacteria 39937
373 Ga0207676_10003004 3300026095 Bacteria 12027
374 Ga0207676_10003557 3300026095 Bacteria 11013
375 Ga0207676_10210521 3300026095 Bacteria 1724
376 Ga0207674_10000345 3300026116 Bacteria 59803
377 Ga0207674_10009232 3300026116 Bacteria 11304
378 Ga0207674_10017364 3300026116 Bacteria 7852
379 Ga0207674_10119519 3300026116 Bacteria 2604
380 Ga0207674_10477782 3300026116 Bacteria 1205
381 Ga0207675_100008821 3300026118 Bacteria 9463
382 Ga0207675_100139258 3300026118 Bacteria 2304
383 Ga0207675_100214827 3300026118 Bacteria 1851
384 Ga0207683_11350793 3300026121 Bacteria 659
385 Ga0207698_10006585 3300026142 Bacteria 7262
386 Ga0207698_10326102 3300026142 Bacteria 1440
387 Ga0268266_10002013 3300028379 Bacteria 22668
388 Ga0268266_10316007 3300028379 Bacteria 1460
389 Ga0268266_10783773 3300028379 Bacteria 920
390 Ga0268266_10915950 3300028379 Bacteria 848
391 Ga0268265_10013286 3300028380 Bacteria 5595
392 Ga0268265_10028689 3300028380 Bacteria 3988
393 Ga0268265_10277797 3300028380 Bacteria 1497
394 Ga0268265_10503658 3300028380 Bacteria 1141
395 Ga0268264_10001319 3300028381 Bacteria 23348
396 Ga0268264_10002725 3300028381 Bacteria 15417
397 Ga0268264_10008787 3300028381 Bacteria 8382
398 Ga0268264_10112053 3300028381 Bacteria 2391
399 Ga0316182_1441053 3300030745 Bacteria 2578
400 Ga0307513_10133096 3300031456 Bacteria 2428
401 Ga0307413_10003489 3300031824 Bacteria 6626
402 Ga0307413_10007812 3300031824 Bacteria 4999
403 Ga0307410_10001011 3300031852 Bacteria 12185
404 Ga0307410_10091226 3300031852 Bacteria 2163
405 Ga0307410_10093383 3300031852 Bacteria 2141
406 Ga0307410_10150995 3300031852 Bacteria 1730
407 Ga0307410_10174796 3300031852 Bacteria 1621
408 Ga0307410_10620926 3300031852 Bacteria 903
409 Ga0307406_10098817 3300031901 Bacteria 1983
410 Ga0307406_10205252 3300031901 Bacteria 1454
411 Ga0307406_10657665 3300031901 Bacteria 870
412 Ga0307406_10742729 3300031901 Bacteria 823
413 Ga0307407_10026709 3300031903 Bacteria 3061
414 Ga0307407_10145405 3300031903 Bacteria 1534
415 Ga0307412_10027266 3300031911 Bacteria 3559
416 Ga0307412_10183549 3300031911 Bacteria 1576
417 Ga0307412_10605268 3300031911 Bacteria 929
418 Ga0307409_100022308 3300031995 Bacteria 4362
419 Ga0307409_100105244 3300031995 Bacteria 2352
420 Ga0307409_100349112 3300031995 Bacteria 1395
421 Ga0307409_100980770 3300031995 Bacteria 862
422 Ga0307416_100009904 3300032002 Bacteria 6269
423 Ga0307416_100135503 3300032002 Bacteria 2226
424 Ga0307416_100345203 3300032002 Bacteria 1504
425 Ga0307416_100480813 3300032002 Bacteria 1302
426 Ga0307414_10027349 3300032004 Bacteria 3684
427 Ga0307414_10054645 3300032004 Bacteria 2792
428 Ga0307414_10064693 3300032004 Bacteria 2605
429 Ga0307414_10073425 3300032004 Bacteria 2475
430 Ga0307414_10134435 3300032004 Bacteria 1925
431 Ga0307414_11440922 3300032004 Bacteria 640
432 Ga0307411_10060043 3300032005 Bacteria 2523
433 Ga0307411_10096919 3300032005 Bacteria 2074
434 Ga0307411_10153806 3300032005 Bacteria 1713
435 Ga0307411_10186773 3300032005 Bacteria 1578
436 Ga0307415_100005560 3300032126 Bacteria 6706
437 Ga0307415_100431191 3300032126 Bacteria 1134
438 Ga0307415_100514489 3300032126 Bacteria 1049
439 Ga0307415_100844273 3300032126 Bacteria 840
440 Ga0373928_0133261 3300035084 Bacteria 675
441 Ga0373941_0045677 3300035115 Bacteria 1372
442 Ga0373941_0270645 3300035115 Bacteria 669
443 Ga0395899_0150035 3300037312 Bacteria 1653
444 Ga0395899_0193494 3300037312 Bacteria 1422
445 Ga0395899_0289336 3300037312 Bacteria 1112
446 Ga0395900_0141297 3300037418 Bacteria 2465
447 Ga0395900_0171575 3300037418 Bacteria 2208
448 Ga0395900_0218774 3300037418 Bacteria 1921
449 Ga0395900_0252395 3300037418 Bacteria 1765
450 Ga0395900_0432079 3300037418 Bacteria 1276
451 Ga0395900_0699822 3300037418 Bacteria 947
452 Ga0395900_1734712 3300037418 Bacteria 535
453 Ga0395898_0188293 3300037466 Bacteria 1972
454 Ga0395898_0833153 3300037466 Bacteria 862
455 Ga0395905_0002924 3300037471 Bacteria 18610
456 Ga0395905_0048360 3300037471 Bacteria 3986
457 Ga0395905_0110907 3300037471 Bacteria 2576
458 Ga0395905_0112853 3300037471 Bacteria 2553
459 Ga0395905_0132064 3300037471 Bacteria 2348
460 Ga0395905_0138687 3300037471 Bacteria 2288
461 Ga0395905_0544999 3300037471 Bacteria 1061
462 Ga0395905_0767373 3300037471 Bacteria 867
463 Ga0395905_0818883 3300037471 Bacteria 834
464 Ga0395905_1059563 3300037471 Bacteria 714
465 Ga0395905_1438422 3300037471 Bacteria 593
466 Ga0436364_1447256 3300037853 Bacteria 12455
467 Ga0395901_0276078 3300038443 Bacteria 1747
468 Ga0395901_0420955 3300038443 Bacteria 1370
469 Ga0439436_0029541 3300041404 Bacteria 1597
470 Ga0439433_0012801 3300041999 Bacteria 1841
471 Ga0439449_0160448 3300042007 Bacteria 839
472 Ga0439457_168524 3300042014 Bacteria 532
473 Ga0439462_0039918 3300042015 Bacteria 1252
474 Ga0450898_049950 3300042134 Bacteria 807
475 Ga0439446_0068062 3300042156 Bacteria 1086
476 Ga0439464_0003467 3300042439 Bacteria 3980
477 Ga0450916_041660 3300042530 Unclassified 700
478 Ga0466961_0127961 3300044693 Bacteria 1593
479 Ga0466963_0098585 3300044694 Bacteria 1998
480 Ga0466963_0139434 3300044694 Bacteria 1679
481 Ga0466971_0195043 3300044719 Bacteria 955
482 Ga0466970_0038874 3300044765 Bacteria 2525
483 Ga0466957_0108511 3300044842 Bacteria 1758
484 Ga0466957_0135248 3300044842 Bacteria 1583
485 Ga0466960_0014000 3300044901 Bacteria 3420
486 Ga0466960_0968839 3300044901 Bacteria 521
487 Ga0466967_0064086 3300045976 Bacteria 3267
488 Ga0466967_0066837 3300045976 Bacteria 3204
489 Ga0466967_0423788 3300045976 Bacteria 1297
490 Ga0495642_0170210 3300046528 Bacteria 946
491 Ga0495668_0004223 3300046616 Bacteria 10344
492 Ga0495668_0222530 3300046616 Bacteria 1033
493 Ga0495669_0081947 3300046684 Bacteria 1482
494 Ga0495669_0096691 3300046684 Bacteria 1368
495 Ga0496100_0093742 3300048903 Bacteria 2055
496 Ga0496101_0021277 3300048904 Bacteria 4456
497 Ga0496102_1361926 3300048905 Bacteria 629
498 Ga0496103_0347571 3300048906 Bacteria 954
499 Ga0496106_0122019 3300048909 Bacteria 2037
500 Ga0496106_0545332 3300048909 Bacteria 931
501 Ga0496107_0050668 3300048910 Bacteria 2993
502 Ga0496107_0056415 3300048910 Bacteria 2838
503 Ga0496109_0067684 3300048912 Bacteria 3272
504 Ga0496110_0160557 3300048913 Bacteria 2037
505 Ga0496110_0919709 3300048913 Bacteria 781
506 Ga0496111_0007174 3300048914 Bacteria 7284
507 Ga0496111_0494240 3300048914 Bacteria 901
508 Ga0496112_0072247 3300048915 Bacteria 3410
509 Ga0496113_0075377 3300048916 Bacteria 2575
510 Ga0501074_0392681 3300049590 Bacteria 984
511 Ga0501202_054991 3300049652 Bacteria 889
512 Ga0501209_037464 3300049656 Bacteria 1266
513 Ga0501217_205911 3300049661 Bacteria 615
514 Ga0501235_074513 3300049669 Bacteria 806
515 Ga0501242_032233 3300049674 Bacteria 714
516 Ga0501249_059130 3300049679 Bacteria 886
517 Ga0501221_110631 3300049704 Bacteria 692
518 Ga0501079_0258631 3300049741 Bacteria 1361
519 Ga0501080_0100448 3300049742 Bacteria 2684
520 Ga0501266_010734 3300049763 Bacteria 1169
521 Ga0501268_005161 3300049765 Bacteria 1867
522 Ga0501212_087197 3300049851 Bacteria 572
523 nmdc:mga0a205_3422_c1 3300050515 Bacteria 14147
524 Ga0500658_0000044 3300053134 Bacteria 72423
525 Ga0439462_0082122
526 JGI24741J21665_1024051
527 JGI24740J21852_10001677
528 JGI24740J21852_10006406
529 JGI24739J22299_10010205
530 JGI24739J22299_10018551
531 JGI24737J22298_10000221
532 JGI24737J22298_10034433
533 JGI24737J22298_10048327
534 JGI24737J22298_10100641
535 JGI24743J22301_10006580
536 JGI24735J21928_10093067
537 JGI24750J21931_1007719
538 JGI24745J21846_1005138
539 JGI24738J21930_10008528
540 JGI24744J21845_10029985
541 JGI24034J26672_10028609
542 Ga0065715_10009313
543 Ga0065715_10036540
544 Ga0070658_10077516
545 Ga0070658_10187940
546 Ga0070658_11414388
547 Ga0070676_10002314
548 Ga0070676_10004745
549 Ga0070676_10012510
550 Ga0070676_10038089
551 Ga0070676_10424335
552 Ga0070683_100093326
553 Ga0070670_100005417
554 Ga0070670_100044489
555 Ga0070670_100047275
556 Ga0070670_100253196
557 Ga0070670_101099541
558 Ga0070670_101204550
559 Ga0070677_10017076
560 Ga0070677_10047171
561 Ga0068869_100000662
562 Ga0068869_100013127
563 Ga0068869_100187507
564 Ga0068869_100524880
565 Ga0070666_10016286
566 Ga0070666_10016307
567 Ga0070666_10109944
568 Ga0070680_100122607
569 Ga0070680_100672210
570 Ga0070682_100229205
571 Ga0070682_100665627
572 Ga0068868_100001411
573 Ga0068868_100117591
574 Ga0068868_100346260
575 Ga0070660_100010601
576 Ga0070660_100064014
577 Ga0070660_100091564
578 Ga0070660_100128812
579 Ga0070660_100492905
580 Ga0070660_100545835
581 Ga0070660_100733816
582 Ga0070660_100953178
583 Ga0070660_101087949
584 Ga0070691_10208438
585 Ga0070661_100882323
586 Ga0070668_100007531
587 Ga0070668_100040876
588 Ga0070668_100098504
589 Ga0070669_100000682
590 Ga0070669_100025231
591 Ga0070669_100114258
592 Ga0070675_100003697
593 Ga0070675_100042801
594 Ga0070675_100133608
595 Ga0070675_100266298
596 Ga0070671_100007783
597 Ga0070671_100043661
598 Ga0070671_100058477
599 Ga0070674_100052696
600 Ga0070673_100000833
601 Ga0070673_100009304
602 Ga0070673_100033051
603 Ga0070673_100066431
604 Ga0070659_100000950
605 Ga0070659_100001481
606 Ga0070659_100039104
607 Ga0070659_100334758
608 Ga0070659_100438140
609 Ga0070667_100000776
610 Ga0070667_100006561
611 Ga0070667_100013906
612 Ga0070667_100058875
613 Ga0070667_100252556
614 Ga0070667_100455961
615 Ga0070667_101047906
616 Ga0070694_100003228
617 Ga0070663_100005818
618 Ga0070663_100022238
619 Ga0070663_100521755
620 Ga0070663_101906632
621 Ga0070662_100006881
622 Ga0070662_100022242
623 Ga0070662_100034774
624 Ga0070662_100049099
625 Ga0070662_100141249
626 Ga0070681_10090766
627 Ga0070681_10163066
628 Ga0070681_10378623
629 Ga0068867_100033101
630 Ga0068867_100035018
631 Ga0068867_101687128
632 Ga0070679_100033899
633 Ga0070679_100753421
634 Ga0070679_100808397
635 Ga0070684_100218702
636 Ga0068853_100001659
637 Ga0068853_100139035
638 Ga0068853_100233159
639 Ga0068853_100835526
640 Ga0070672_100000589
641 Ga0070672_100097092
642 Ga0070672_100307710
643 Ga0070672_101346839
644 Ga0070695_100134661
645 Ga0070695_101690110
646 Ga0070696_100019918
647 Ga0070693_100009371
648 Ga0070693_100172114
649 Ga0070665_100071855
650 Ga0070665_100533889
651 Ga0070704_100180504
652 Ga0068855_100008531
653 Ga0068855_100889489
654 Ga0070664_100008433
655 Ga0070664_100009351
656 Ga0070664_100095934
657 Ga0070664_100320269
658 Ga0070664_100939337
659 Ga0070664_102022803
660 Ga0068857_100000692
661 Ga0068857_100128610
662 Ga0068854_100001058
663 Ga0068854_100003715
664 Ga0068854_100014106
665 Ga0068852_100024796
666 Ga0068852_100181698
667 Ga0068859_100002632
668 Ga0068859_100007420
669 Ga0068859_100016870
670 Ga0068859_100032223
671 Ga0068859_100034904
672 Ga0068864_100000287
673 Ga0068864_100000748
674 Ga0068864_100000894
675 Ga0068864_100013544
676 Ga0068864_101089932
677 Ga0068866_10770154
678 Ga0068861_100024292
679 Ga0068861_100946812
680 Ga0068851_10559861
681 Ga0068870_10247865
682 Ga0068863_100002077
683 Ga0068863_100050840
684 Ga0068863_100062372
685 Ga0068863_100120017
686 Ga0068863_100585507
687 Ga0068858_100000579
688 Ga0068858_100012043
689 Ga0068858_100032449
690 Ga0068858_100033541
691 Ga0068858_100459945
692 Ga0068860_100004159
693 Ga0068860_100006012
694 Ga0068860_100019373
695 Ga0068860_100025537
696 Ga0068862_100018299
697 Ga0068862_100096710
698 Ga0068862_100941099
699 Ga0081539_10017580
700 Ga0070712_100118137
701 Ga0097621_100470385
702 Ga0075433_10203594
703 Ga0075434_100119783
704 Ga0068865_100077559
705 Ga0097620_100002632
706 Ga0097620_100007420
707 Ga0097620_100016869
708 Ga0097620_100032223
709 Ga0097620_100034904
710 Ga0075435_100190747
711 Ga0105251_10085545
712 Ga0105250_10005450
713 Ga0105240_10104592
714 Ga0105240_10172394
715 Ga0105245_10005839
716 Ga0105245_10030174
717 Ga0105247_10148459
718 Ga0105247_10179959
719 Ga0105243_10023746
720 Ga0105241_10098336
721 Ga0105242_10048328
722 Ga0105248_10000552
723 Ga0105248_10006033
724 Ga0105248_10010327
725 Ga0105248_10082850
726 Ga0105248_10260014
727 Ga0105238_10064099
728 Ga0105249_10020672
729 Ga0105249_10047596
730 Ga0105249_10329902
731 Ga0105239_10145487
732 Ga0105239_10284780
733 Ga0105246_10202665
734 Ga0157373_10005180
735 Ga0157373_10030128
736 Ga0157373_10126438
737 Ga0157373_10209815
738 Ga0157373_11055251
739 Ga0157371_10004027
740 Ga0157371_10044632
741 Ga0157371_10048674
742 Ga0157371_10068264
743 Ga0157371_11283196
744 Ga0157378_10011763
745 Ga0157378_11034548
746 Ga0163162_10050160
747 Ga0163162_10052041
748 Ga0163162_10328724
749 Ga0163162_10429662
750 Ga0157372_10053038
751 Ga0157375_10409993
752 Ga0157375_11031427
753 Ga0163163_10000390
754 Ga0163163_11929995
755 Ga0157380_10004000
756 Ga0157380_10026397
757 Ga0157380_10026652
758 Ga0157377_10025447
759 Ga0157377_10381605
760 Ga0157379_10180699
761 Ga0157379_10465856
762 Ga0157379_10848286
763 Ga0157379_10919406
764 Ga0213875_10002975
765 Ga0207673_1000994
766 Ga0207697_10000253
767 Ga0207656_10500629
768 Ga0207696_1004959
769 Ga0207682_10001459
770 Ga0207682_10037597
771 Ga0207682_10185145
772 Ga0207642_10017810
773 Ga0207710_10278561
774 Ga0207688_10000652
775 Ga0207688_10607426
776 Ga0207647_10000327
777 Ga0207647_10000760
778 Ga0207645_10007069
779 Ga0207645_10017352
780 Ga0207645_10061798
781 Ga0207643_10180326
782 Ga0207705_10408753
783 Ga0207707_10155977
784 Ga0207707_10282084
785 Ga0207707_10608263
786 Ga0207695_10137659
787 Ga0207693_10040495
788 Ga0207660_10079087
789 Ga0207660_10254269
790 Ga0207657_10003476
791 Ga0207657_10009310
792 Ga0207657_10025878
793 Ga0207657_10062356
794 Ga0207657_10378404
795 Ga0207657_10519777
796 Ga0207657_10633242
797 Ga0207657_10853312
798 Ga0207649_10104439
799 Ga0207649_10415378
800 Ga0207652_11599847
801 Ga0207681_10018564
802 Ga0207681_10025163
803 Ga0207681_10060721
804 Ga0207681_10088083
805 Ga0207681_10126585
806 Ga0207650_10063190
807 Ga0207650_10068150
808 Ga0207650_10147802
809 Ga0207650_11353542
810 Ga0207659_10004610
811 Ga0207659_10012653
812 Ga0207659_10117106
813 Ga0207659_10142012
814 Ga0207687_10003036
815 Ga0207687_10141139
816 Ga0207664_11310686
817 Ga0207644_10021887
818 Ga0207644_10044552
819 Ga0207644_10102178
820 Ga0207644_10512081
821 Ga0207690_10001585
822 Ga0207690_10002341
823 Ga0207690_10023323
824 Ga0207690_10185459
825 Ga0207706_10000143
826 Ga0207706_10000904
827 Ga0207706_10003074
828 Ga0207706_10004098
829 Ga0207706_10013609
830 Ga0207706_10215155
831 Ga0207669_10014002
832 Ga0207704_10047537
833 Ga0207704_10056039
834 Ga0207691_10000743
835 Ga0207691_10066655
836 Ga0207691_10146453
837 Ga0207691_10329549
838 Ga0207691_10847910
839 Ga0207711_10000046
840 Ga0207711_10006545
841 Ga0207711_10059860
842 Ga0207711_10293281
843 Ga0207689_10000372
844 Ga0207689_10003887
845 Ga0207689_10012702
846 Ga0207661_10095396
847 Ga0207661_11149047
848 Ga0207679_10039220
849 Ga0207679_10040787
850 Ga0207679_10189033
851 Ga0207679_10544793
852 Ga0207667_10069720
853 Ga0207667_10130037
854 Ga0207651_10000440
855 Ga0207651_10001136
856 Ga0207651_10199460
857 Ga0207651_10544690
858 Ga0207712_10000491
859 Ga0207712_10288626
860 Ga0207668_10050499
861 Ga0207668_10094425
862 Ga0207668_10098447
863 Ga0207668_10132596
864 Ga0207640_10009513
865 Ga0207640_10021292
866 Ga0207640_10106567
867 Ga0207658_10007445
868 Ga0207658_10017187
869 Ga0207658_10018485
870 Ga0207658_10066051
871 Ga0207658_10373405
872 Ga0207677_10023455
873 Ga0207677_10061824
874 Ga0207677_10113574
875 Ga0207677_10391352
876 Ga0207703_10002126
877 Ga0207703_10002982
878 Ga0207703_10003193
879 Ga0207703_10132812
880 Ga0207703_10642265
881 Ga0207639_10005382
882 Ga0207639_10037273
883 Ga0207639_10640146
884 Ga0207678_10000308
885 Ga0207678_10008496
886 Ga0207678_10043334
887 Ga0207678_10251570
888 Ga0207678_10283700
889 Ga0207641_10001374
890 Ga0207641_10010491
891 Ga0207641_10016527
892 Ga0207641_10098576
893 Ga0207641_10120193
894 Ga0207648_10031677
895 Ga0207648_10169583
896 Ga0207676_10000345
897 Ga0207676_10003004
898 Ga0207676_10003557
899 Ga0207676_10210521
900 Ga0207674_10000345
901 Ga0207674_10009232
902 Ga0207674_10017364
903 Ga0207674_10119519
904 Ga0207674_10477782
905 Ga0207675_100008821
906 Ga0207675_100139258
907 Ga0207675_100214827
908 Ga0207683_11350793
909 Ga0207698_10006585
910 Ga0207698_10326102
911 Ga0268266_10002013
912 Ga0268266_10316007
913 Ga0268266_10783773
914 Ga0268266_10915950
915 Ga0268265_10013286
916 Ga0268265_10028689
917 Ga0268265_10277797
918 Ga0268265_10503658
919 Ga0268264_10001319
920 Ga0268264_10002725
921 Ga0268264_10008787
922 Ga0268264_10112053
923 Ga0316182_1441053
924 Ga0307513_10133096
925 Ga0307413_10003489
926 Ga0307413_10007812
927 Ga0307410_10001011
928 Ga0307410_10091226
929 Ga0307410_10093383
930 Ga0307410_10150995
931 Ga0307410_10174796
932 Ga0307410_10620926
933 Ga0307406_10098817
934 Ga0307406_10205252
935 Ga0307406_10657665
936 Ga0307406_10742729
937 Ga0307407_10026709
938 Ga0307407_10145405
939 Ga0307412_10027266
940 Ga0307412_10183549
941 Ga0307412_10605268
942 Ga0307409_100022308
943 Ga0307409_100105244
944 Ga0307409_100349112
945 Ga0307409_100980770
946 Ga0307416_100009904
947 Ga0307416_100135503
948 Ga0307416_100345203
949 Ga0307416_100480813
950 Ga0307414_10027349
951 Ga0307414_10054645
952 Ga0307414_10064693
953 Ga0307414_10073425
954 Ga0307414_10134435
955 Ga0307414_11440922
956 Ga0307411_10060043
957 Ga0307411_10096919
958 Ga0307411_10153806
959 Ga0307411_10186773
960 Ga0307415_100005560
961 Ga0307415_100431191
962 Ga0307415_100514489
963 Ga0307415_100844273
964 Ga0373928_0133261
965 Ga0373941_0045677
966 Ga0373941_0270645
967 Ga0395899_0150035
968 Ga0395899_0193494
969 Ga0395899_0289336
970 Ga0395900_0141297
971 Ga0395900_0171575
972 Ga0395900_0218774
973 Ga0395900_0252395
974 Ga0395900_0432079
975 Ga0395900_0699822
976 Ga0395900_1734712
977 Ga0395898_0188293
978 Ga0395898_0833153
979 Ga0395905_0002924
980 Ga0395905_0048360
981 Ga0395905_0110907
982 Ga0395905_0112853
983 Ga0395905_0132064
984 Ga0395905_0138687
985 Ga0395905_0544999
986 Ga0395905_0767373
987 Ga0395905_0818883
988 Ga0395905_1059563
989 Ga0395905_1438422
990 Ga0436364_1447256
991 Ga0395901_0276078
992 Ga0395901_0420955
993 Ga0439436_0029541
994 Ga0439433_0012801
995 Ga0439449_0160448
996 Ga0439457_168524
997 Ga0439462_0039918
998 Ga0450898_049950
999 Ga0439446_0068062
1000 Ga0439464_0003467
1001 Ga0450916_041660
1002 Ga0466961_0127961
1003 Ga0466963_0098585
1004 Ga0466963_0139434
1005 Ga0466971_0195043
1006 Ga0466970_0038874
1007 Ga0466957_0108511
1008 Ga0466957_0135248
1009 Ga0466960_0014000
1010 Ga0466960_0968839
1011 Ga0466967_0064086
1012 Ga0466967_0066837
1013 Ga0466967_0423788
1014 Ga0495642_0170210
1015 Ga0495668_0004223
1016 Ga0495668_0222530
1017 Ga0495669_0081947
1018 Ga0495669_0096691
1019 Ga0496100_0093742
1020 Ga0496101_0021277
1021 Ga0496102_1361926
1022 Ga0496103_0347571
1023 Ga0496106_0122019
1024 Ga0496106_0545332
1025 Ga0496107_0050668
1026 Ga0496107_0056415
1027 Ga0496109_0067684
1028 Ga0496110_0160557
1029 Ga0496110_0919709
1030 Ga0496111_0007174
1031 Ga0496111_0494240
1032 Ga0496112_0072247
1033 Ga0496113_0075377
1034 Ga0501074_0392681
1035 Ga0501202_054991
1036 Ga0501209_037464
1037 Ga0501217_205911
1038 Ga0501235_074513
1039 Ga0501242_032233
1040 Ga0501249_059130
1041 Ga0501221_110631
1042 Ga0501079_0258631
1043 Ga0501080_0100448
1044 Ga0501266_010734
1045 Ga0501268_005161
1046 Ga0501212_087197
1047 nmdc:mga0a205_3422_c1
1048 Ga0500658_0000044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01478

Peptidase_A24

Type IV leader peptidase family

40

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.6654 8 157
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.6372 8 157
7no6-assembly1.cif.gz_B structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 0.5636 85 150
3s0x-assembly1.cif.gz_A the crystal structure of gxgd membrane protease flak 0.5603 9 157
7no6-assembly1.cif.gz_C structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 0.5513 85 153
ID Description Score Start End Superfamily
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7951 7 150 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7758 7 150 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7278 1 148 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7191 1 148 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7096 12 150 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A6J4SYE4-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.9773 2 157 GO:0004190
GO:0016020
AF-A0A838VJT4-F1-model_v4 Prepilin peptidase 0.977 6 152 GO:0004190
GO:0005886
AF-A0A2P7QJ51-F1-model_v4 Peptidase 0.9714 7 157 GO:0004190
GO:0016020
AF-A0A6J4TXI1-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.968 2 157 GO:0004190
GO:0005886
GO:0006465
AF-A0A6J4SYE4-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.9651 2 157 GO:0004190
GO:0016020

Map