F459174

General Info

Members Datasets Scaffolds Average Seq Length
524 245 1048 359

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0100630|Ga0495629_0100630_105_1379
Length 424
Sequence MSAAAAVMNALYCLIVDDEPRLRQVLTHVMRRDGFRCIEAADGYEALEQLRRYPVSLVLTDLRMPGMDGMELLRHVRAFHSDIAVVMITAVPDVQAAVNCLSTGAMDYLTKPFHLEEVRARVAQAMDRRRLILENRDYQERLKDRVAAQASRLEQMFFAGVQALAEALELKDPYTRGHSVRVSQYSSILARALHLDDDAVRQIELGGHVHDIGKIGVREAVLNKTEKLTDEEYEHIMIHPLVGWRILAPLLGDAPIALNIVRSHHERIDGQGIPDGLSGQAIPLEARIVAVADAIDAMTSGRPYRGNELSLEDALVELRQNAGSQFDERVVAAVEEAVRCGDLYLMPRNTGQFVMVCRRRFRRRGGDAVASALSVATRHFXXXRRTRLQGDPSDWRLRSSHLPLVVSFRAQRHRSARCADCRGA

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 98.09
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0100630 3300046459 Bacteria 2017
2 Ga0065707_10092301 3300005295 Unclassified 3791
3 Ga0070658_10001483 3300005327 Bacteria 19915
4 Ga0070676_10042873 3300005328 Bacteria 2629
5 Ga0070676_10102670 3300005328 Bacteria 1769
6 Ga0070683_100001197 3300005329 Bacteria 19738
7 Ga0070683_100026676 3300005329 Bacteria 5205
8 Ga0070683_100033866 3300005329 Bacteria 4662
9 Ga0070683_100049685 3300005329 Bacteria 3880
10 Ga0070683_100100284 3300005329 Bacteria 2726
11 Ga0070683_100109671 3300005329 Bacteria 2603
12 Ga0070683_100128253 3300005329 Bacteria 2399
13 Ga0070690_100105005 3300005330 Bacteria 1877
14 Ga0070670_100001690 3300005331 Bacteria 17937
15 Ga0070670_100175930 3300005331 Bacteria 1857
16 Ga0068869_100006554 3300005334 Bacteria 7383
17 Ga0068869_100333923 3300005334 Bacteria 1232
18 Ga0070666_10190707 3300005335 Unclassified 1440
19 Ga0070680_100001664 3300005336 Bacteria 16262
20 Ga0070680_100002636 3300005336 Bacteria 13294
21 Ga0070680_100018440 3300005336 Bacteria 5513
22 Ga0070680_100029579 3300005336 Bacteria 4399
23 Ga0070680_100049831 3300005336 Bacteria 3415
24 Ga0070680_100124753 3300005336 Bacteria 2151
25 Ga0070680_100139430 3300005336 Bacteria 2033
26 Ga0070680_100192134 3300005336 Bacteria 1720
27 Ga0070660_100054163 3300005339 Bacteria 3096
28 Ga0070660_100091095 3300005339 Bacteria 2405
29 Ga0070660_100108771 3300005339 Bacteria 2204
30 Ga0070689_100128978 3300005340 Unclassified 2027
31 Ga0070687_100024037 3300005343 Bacteria 2903
32 Ga0070687_100069337 3300005343 Bacteria 1888
33 Ga0070661_100002651 3300005344 Bacteria 12236
34 Ga0070661_100020906 3300005344 Bacteria 4671
35 Ga0070692_10002754 3300005345 Bacteria 6918
36 Ga0070668_100019433 3300005347 Bacteria 5113
37 Ga0070668_100024411 3300005347 Bacteria 4581
38 Ga0070668_100046693 3300005347 Bacteria 3327
39 Ga0070669_100004597 3300005353 Bacteria 9964
40 Ga0070669_100141216 3300005353 Bacteria 1857
41 Ga0070669_100254161 3300005353 Bacteria 1400
42 Ga0070675_100001303 3300005354 Bacteria 18230
43 Ga0070675_100004851 3300005354 Bacteria 10263
44 Ga0070671_100010754 3300005355 Bacteria 7345
45 Ga0070671_100061277 3300005355 Bacteria 3133
46 Ga0070671_100072157 3300005355 Bacteria 2883
47 Ga0070674_100014636 3300005356 Bacteria 4880
48 Ga0070673_100178888 3300005364 Bacteria 1815
49 Ga0070688_100008049 3300005365 Bacteria 5706
50 Ga0070659_100005266 3300005366 Bacteria 9282
51 Ga0070659_100078772 3300005366 Bacteria 2629
52 Ga0070667_100081347 3300005367 Bacteria 2772
53 Ga0070667_100256759 3300005367 Bacteria 1564
54 Ga0070667_100309469 3300005367 Bacteria 1424
55 Ga0070709_10020880 3300005434 Bacteria 3809
56 Ga0070714_100016126 3300005435 Bacteria 6025
57 Ga0070714_100022232 3300005435 Bacteria 5198
58 Ga0070714_100035830 3300005435 Bacteria 4159
59 Ga0070713_100000274 3300005436 Bacteria 33771
60 Ga0070713_100062954 3300005436 Bacteria 3108
61 Ga0070710_10059049 3300005437 Bacteria 2177
62 Ga0070711_100051785 3300005439 Bacteria 2822
63 Ga0070708_100000045 3300005445 Bacteria 81076
64 Ga0070662_100054079 3300005457 Bacteria 2909
65 Ga0070662_100067162 3300005457 Bacteria 2633
66 Ga0070662_100082564 3300005457 Bacteria 2397
67 Ga0070662_100086544 3300005457 Bacteria 2344
68 Ga0070681_10000537 3300005458 Bacteria 31196
69 Ga0070681_10008034 3300005458 Bacteria 10333
70 Ga0070681_10013030 3300005458 Bacteria 8257
71 Ga0070681_10013515 3300005458 Bacteria 8117
72 Ga0070681_10029456 3300005458 Bacteria 5513
73 Ga0070681_10207396 3300005458 Bacteria 1876
74 Ga0068867_100035337 3300005459 Bacteria 3624
75 Ga0068867_100083776 3300005459 Bacteria 2407
76 Ga0070685_10017695 3300005466 Bacteria 3819
77 Ga0070685_10089744 3300005466 Bacteria 1858
78 Ga0070706_100029357 3300005467 Bacteria 5067
79 Ga0070706_100128581 3300005467 Bacteria 2363
80 Ga0070707_100029417 3300005468 Bacteria 5230
81 Ga0070698_100146751 3300005471 Bacteria 2308
82 Ga0070698_100205329 3300005471 Bacteria 1905
83 Ga0070699_100375959 3300005518 Bacteria 1282
84 Ga0070679_100000940 3300005530 Bacteria 25317
85 Ga0070679_100002624 3300005530 Bacteria 16355
86 Ga0070679_100013713 3300005530 Bacteria 7764
87 Ga0070679_100016000 3300005530 Bacteria 7224
88 Ga0070679_100049944 3300005530 Bacteria 4166
89 Ga0070679_100058934 3300005530 Bacteria 3827
90 Ga0070679_100171118 3300005530 Bacteria 2145
91 Ga0070684_100008121 3300005535 Bacteria 8192
92 Ga0070684_100016538 3300005535 Bacteria 6030
93 Ga0070684_100022918 3300005535 Bacteria 5215
94 Ga0070684_100026145 3300005535 Bacteria 4914
95 Ga0070684_100045645 3300005535 Bacteria 3794
96 Ga0070684_100056307 3300005535 Bacteria 3431
97 Ga0070684_100069933 3300005535 Bacteria 3087
98 Ga0070684_100094815 3300005535 Bacteria 2659
99 Ga0070684_100116562 3300005535 Bacteria 2399
100 Ga0070684_100245940 3300005535 Bacteria 1635
101 Ga0070684_100380168 3300005535 Bacteria 1301
102 Ga0070672_100016872 3300005543 Bacteria 5239
103 Ga0070672_100080441 3300005543 Bacteria 2611
104 Ga0070696_100005390 3300005546 Bacteria 8531
105 Ga0070696_100015929 3300005546 Bacteria 5055
106 Ga0070665_100204588 3300005548 Bacteria 1975
107 Ga0070665_100264590 3300005548 Unclassified 1721
108 Ga0068855_100013870 3300005563 Bacteria 9718
109 Ga0068855_100207602 3300005563 Bacteria 2203
110 Ga0068855_100441238 3300005563 Bacteria 1422
111 Ga0070664_100013127 3300005564 Bacteria 6743
112 Ga0070664_100092758 3300005564 Bacteria 2615
113 Ga0070664_100135355 3300005564 Bacteria 2166
114 Ga0070664_100163564 3300005564 Bacteria 1970
115 Ga0070664_100175397 3300005564 Bacteria 1903
116 Ga0068857_100008501 3300005577 Bacteria 8875
117 Ga0068857_100013444 3300005577 Bacteria 7131
118 Ga0068857_100040907 3300005577 Bacteria 4109
119 Ga0068857_100121082 3300005577 Bacteria 2356
120 Ga0068854_100031306 3300005578 Bacteria 3696
121 Ga0068854_100291151 3300005578 Bacteria 1318
122 Ga0068856_100008186 3300005614 Bacteria 10194
123 Ga0068856_100034774 3300005614 Bacteria 4937
124 Ga0068856_100176153 3300005614 Bacteria 2151
125 Ga0068856_100200303 3300005614 Bacteria 2011
126 Ga0068852_100041149 3300005616 Bacteria 3903
127 Ga0068852_100056074 3300005616 Bacteria 3403
128 Ga0068852_100063876 3300005616 Bacteria 3207
129 Ga0068859_100020877 3300005617 Bacteria 6573
130 Ga0068859_100056249 3300005617 Bacteria 3958
131 Ga0068864_100008979 3300005618 Bacteria 8243
132 Ga0068864_100090837 3300005618 Bacteria 2693
133 Ga0068866_10013526 3300005718 Bacteria 3584
134 Ga0068861_100012315 3300005719 Bacteria 5965
135 Ga0068851_10019465 3300005834 Bacteria 3280
136 Ga0068870_10010164 3300005840 Bacteria 4309
137 Ga0068870_10012345 3300005840 Bacteria 3990
138 Ga0068870_10012484 3300005840 Bacteria 3972
139 Ga0068870_10063097 3300005840 Bacteria 1997
140 Ga0068870_10163537 3300005840 Bacteria 1322
141 Ga0068863_100040124 3300005841 Bacteria 4451
142 Ga0068863_100305094 3300005841 Bacteria 1545
143 Ga0068858_100107302 3300005842 Bacteria 2606
144 Ga0068858_100451767 3300005842 Bacteria 1238
145 Ga0068860_100069019 3300005843 Bacteria 3359
146 Ga0068862_100000513 3300005844 Bacteria 41174
147 Ga0068862_100105087 3300005844 Unclassified 2475
148 Ga0081539_10000174 3300005985 Bacteria 151265
149 Ga0070717_10003227 3300006028 Bacteria 11644
150 Ga0070717_10165301 3300006028 Bacteria 1922
151 Ga0070712_100000729 3300006175 Bacteria 19393
152 Ga0068871_100043477 3300006358 Bacteria 3608
153 Ga0075430_100004889 3300006846 Bacteria 11276
154 Ga0075430_100015467 3300006846 Bacteria 6495
155 Ga0075430_100021793 3300006846 Bacteria 5446
156 Ga0075430_100053013 3300006846 Bacteria 3415
157 Ga0075430_100244046 3300006846 Bacteria 1488
158 Ga0075431_100001756 3300006847 Bacteria 20399
159 Ga0075431_100013780 3300006847 Bacteria 8165
160 Ga0075431_100073766 3300006847 Bacteria 3521
161 Ga0075434_100048454 3300006871 Bacteria 4216
162 Ga0075429_100012636 3300006880 Bacteria 7322
163 Ga0068865_100072567 3300006881 Bacteria 2445
164 Ga0075436_100002168 3300006914 Bacteria 13526
165 Ga0097620_100020878 3300006931 Bacteria 6573
166 Ga0097620_100056249 3300006931 Bacteria 3958
167 Ga0105240_10001786 3300009093 Bacteria 36277
168 Ga0105240_10018268 3300009093 Bacteria 9426
169 Ga0105240_10527918 3300009093 Bacteria 1309
170 Ga0111539_10037513 3300009094 Bacteria 5850
171 Ga0111539_10048767 3300009094 Bacteria 5054
172 Ga0105245_10095260 3300009098 Bacteria 2746
173 Ga0105245_10478892 3300009098 Bacteria 1258
174 Ga0114129_10177230 3300009147 Bacteria 2903
175 Ga0114129_10738944 3300009147 Bacteria 1261
176 Ga0105243_10179084 3300009148 Bacteria 1842
177 Ga0105241_10003130 3300009174 Bacteria 12313
178 Ga0105242_10007016 3300009176 Bacteria 8697
179 Ga0105242_10035562 3300009176 Bacteria 3993
180 Ga0105248_10010770 3300009177 Bacteria 10095
181 Ga0105248_10068953 3300009177 Bacteria 3970
182 Ga0105248_10071471 3300009177 Bacteria 3898
183 Ga0105248_10135631 3300009177 Bacteria 2776
184 Ga0105248_10151299 3300009177 Bacteria 2618
185 Ga0105237_10004438 3300009545 Bacteria 16252
186 Ga0105237_10115057 3300009545 Bacteria 2683
187 Ga0105238_10042389 3300009551 Bacteria 4609
188 Ga0105249_10000251 3300009553 Bacteria 59080
189 Ga0105249_10044399 3300009553 Bacteria 4041
190 Ga0105246_10002700 3300011119 Bacteria 10741
191 Ga0157373_10016174 3300013100 Bacteria 5445
192 Ga0157373_10070660 3300013100 Bacteria 2467
193 Ga0157371_10007718 3300013102 Bacteria 8651
194 Ga0157371_10011433 3300013102 Bacteria 6839
195 Ga0157371_10189813 3300013102 Bacteria 1471
196 Ga0157370_10007065 3300013104 Bacteria 12262
197 Ga0157370_10014177 3300013104 Bacteria 8171
198 Ga0157370_10025875 3300013104 Bacteria 5803
199 Ga0157370_10161439 3300013104 Bacteria 2085
200 Ga0157369_10004783 3300013105 Bacteria 15917
201 Ga0157369_10015607 3300013105 Bacteria 8560
202 Ga0157369_10028114 3300013105 Bacteria 6225
203 Ga0157369_10073946 3300013105 Bacteria 3655
204 Ga0157369_10109713 3300013105 Bacteria 2933
205 Ga0157369_10110302 3300013105 Bacteria 2925
206 Ga0157369_10154196 3300013105 Bacteria 2427
207 Ga0157374_10024820 3300013296 Bacteria 5376
208 Ga0157374_10239765 3300013296 Bacteria 1783
209 Ga0157378_10075869 3300013297 Bacteria 3028
210 Ga0157378_10107328 3300013297 Bacteria 2555
211 Ga0163162_10187794 3300013306 Bacteria 2194
212 Ga0157372_10003638 3300013307 Bacteria 16590
213 Ga0157372_10005371 3300013307 Bacteria 13618
214 Ga0157372_10011940 3300013307 Bacteria 9255
215 Ga0157372_10014215 3300013307 Bacteria 8507
216 Ga0157372_10025243 3300013307 Bacteria 6460
217 Ga0157372_10028700 3300013307 Bacteria 6074
218 Ga0157372_10094480 3300013307 Bacteria 3405
219 Ga0157372_10109733 3300013307 Bacteria 3160
220 Ga0157372_10131041 3300013307 Bacteria 2885
221 Ga0157372_10177663 3300013307 Bacteria 2464
222 Ga0157375_10023763 3300013308 Bacteria 5663
223 Ga0157375_10073656 3300013308 Bacteria 3435
224 Ga0157375_10182494 3300013308 Bacteria 2251
225 Ga0157375_10500040 3300013308 Bacteria 1380
226 Ga0157375_10631634 3300013308 Bacteria 1228
227 Ga0163163_10002771 3300014325 Bacteria 14797
228 Ga0163163_10040544 3300014325 Bacteria 4547
229 Ga0163163_10371975 3300014325 Bacteria 1486
230 Ga0157380_10023530 3300014326 Bacteria 4648
231 Ga0157377_10000361 3300014745 Bacteria 20302
232 Ga0157379_10001669 3300014968 Bacteria 18349
233 Ga0157376_10007918 3300014969 Bacteria 7625
234 Ga0157376_10110333 3300014969 Bacteria 2420
235 Ga0157376_10248369 3300014969 Bacteria 1661
236 Ga0182007_10059774 3300015262 Bacteria 1249
237 Ga0163161_10034811 3300017792 Bacteria 3603
238 Ga0206356_11147558 3300020070 Bacteria 3033
239 Ga0207682_10027922 3300025893 Bacteria 2249
240 Ga0207688_10107937 3300025901 Bacteria 1613
241 Ga0207680_10182171 3300025903 Bacteria 1421
242 Ga0207699_10037618 3300025906 Bacteria 2768
243 Ga0207699_10041085 3300025906 Bacteria 2669
244 Ga0207645_10048955 3300025907 Bacteria 2699
245 Ga0207645_10062675 3300025907 Bacteria 2376
246 Ga0207645_10071034 3300025907 Bacteria 2228
247 Ga0207643_10002389 3300025908 Bacteria 10186
248 Ga0207643_10003121 3300025908 Bacteria 8913
249 Ga0207643_10038298 3300025908 Unclassified 2693
250 Ga0207643_10140316 3300025908 Bacteria 1443
251 Ga0207705_10006635 3300025909 Bacteria 8566
252 Ga0207705_10029168 3300025909 Bacteria 3933
253 Ga0207705_10070941 3300025909 Bacteria 2525
254 Ga0207684_10036904 3300025910 Bacteria 4148
255 Ga0207684_10089310 3300025910 Bacteria 2626
256 Ga0207707_10001274 3300025912 Bacteria 23506
257 Ga0207707_10003913 3300025912 Bacteria 13215
258 Ga0207707_10004622 3300025912 Bacteria 12092
259 Ga0207707_10015537 3300025912 Bacteria 6630
260 Ga0207707_10019956 3300025912 Bacteria 5849
261 Ga0207707_10024036 3300025912 Bacteria 5328
262 Ga0207707_10032322 3300025912 Bacteria 4579
263 Ga0207707_10034709 3300025912 Bacteria 4413
264 Ga0207707_10036663 3300025912 Bacteria 4286
265 Ga0207707_10042475 3300025912 Bacteria 3967
266 Ga0207695_10004134 3300025913 Bacteria 19930
267 Ga0207695_10017490 3300025913 Bacteria 8341
268 Ga0207695_10022295 3300025913 Bacteria 7196
269 Ga0207695_10296659 3300025913 Bacteria 1508
270 Ga0207695_10309910 3300025913 Bacteria 1469
271 Ga0207695_10369543 3300025913 Bacteria 1320
272 Ga0207671_10042557 3300025914 Bacteria 3361
273 Ga0207671_10106249 3300025914 Bacteria 2131
274 Ga0207693_10009781 3300025915 Bacteria 7807
275 Ga0207693_10124994 3300025915 Bacteria 2021
276 Ga0207660_10003457 3300025917 Bacteria 10302
277 Ga0207660_10005979 3300025917 Bacteria 7902
278 Ga0207660_10026731 3300025917 Bacteria 3932
279 Ga0207660_10027935 3300025917 Bacteria 3856
280 Ga0207660_10028418 3300025917 Bacteria 3825
281 Ga0207660_10034422 3300025917 Bacteria 3512
282 Ga0207660_10039964 3300025917 Bacteria 3281
283 Ga0207660_10162998 3300025917 Bacteria 1721
284 Ga0207660_10277457 3300025917 Bacteria 1329
285 Ga0207662_10002218 3300025918 Bacteria 9686
286 Ga0207662_10010164 3300025918 Bacteria 5188
287 Ga0207657_10030969 3300025919 Bacteria 4850
288 Ga0207657_10031470 3300025919 Bacteria 4805
289 Ga0207657_10059737 3300025919 Bacteria 3274
290 Ga0207657_10116369 3300025919 Bacteria 2203
291 Ga0207652_10000636 3300025921 Bacteria 34690
292 Ga0207652_10002058 3300025921 Bacteria 17320
293 Ga0207652_10003798 3300025921 Bacteria 12383
294 Ga0207652_10010341 3300025921 Bacteria 7516
295 Ga0207652_10033953 3300025921 Bacteria 4297
296 Ga0207652_10035111 3300025921 Bacteria 4230
297 Ga0207652_10112280 3300025921 Bacteria 2418
298 Ga0207652_10141794 3300025921 Bacteria 2149
299 Ga0207652_10177064 3300025921 Bacteria 1915
300 Ga0207646_10035542 3300025922 Bacteria 4500
301 Ga0207681_10001166 3300025923 Bacteria 16947
302 Ga0207681_10032103 3300025923 Bacteria 3436
303 Ga0207681_10077594 3300025923 Bacteria 2336
304 Ga0207694_10127219 3300025924 Bacteria 2040
305 Ga0207650_10020901 3300025925 Bacteria 4624
306 Ga0207650_10200054 3300025925 Bacteria 1600
307 Ga0207659_10006490 3300025926 Bacteria 7168
308 Ga0207659_10054273 3300025926 Bacteria 2862
309 Ga0207659_10100729 3300025926 Bacteria 2177
310 Ga0207687_10002512 3300025927 Bacteria 12443
311 Ga0207700_10001579 3300025928 Bacteria 12936
312 Ga0207700_10063341 3300025928 Bacteria 2812
313 Ga0207664_10033723 3300025929 Bacteria 3936
314 Ga0207664_10040806 3300025929 Bacteria 3612
315 Ga0207644_10046697 3300025931 Bacteria 3087
316 Ga0207690_10003410 3300025932 Bacteria 9488
317 Ga0207706_10006192 3300025933 Bacteria 11114
318 Ga0207706_10122547 3300025933 Bacteria 2287
319 Ga0207706_10216576 3300025933 Bacteria 1677
320 Ga0207706_10257060 3300025933 Bacteria 1525
321 Ga0207709_10108714 3300025935 Bacteria 1849
322 Ga0207669_10013126 3300025937 Bacteria 4103
323 Ga0207704_10019217 3300025938 Bacteria 3584
324 Ga0207691_10016638 3300025940 Bacteria 6983
325 Ga0207691_10018984 3300025940 Bacteria 6512
326 Ga0207691_10026902 3300025940 Bacteria 5397
327 Ga0207691_10030149 3300025940 Bacteria 5070
328 Ga0207711_10021340 3300025941 Bacteria 5411
329 Ga0207711_10235955 3300025941 Bacteria 1676
330 Ga0207689_10003321 3300025942 Bacteria 14722
331 Ga0207689_10044160 3300025942 Bacteria 3684
332 Ga0207661_10002251 3300025944 Bacteria 13303
333 Ga0207661_10011779 3300025944 Bacteria 6350
334 Ga0207661_10028981 3300025944 Bacteria 4247
335 Ga0207661_10034946 3300025944 Bacteria 3913
336 Ga0207661_10037775 3300025944 Bacteria 3779
337 Ga0207661_10053505 3300025944 Bacteria 3230
338 Ga0207661_10100013 3300025944 Bacteria 2433
339 Ga0207661_10166175 3300025944 Bacteria 1918
340 Ga0207661_10203919 3300025944 Bacteria 1740
341 Ga0207661_10231465 3300025944 Bacteria 1636
342 Ga0207661_10307475 3300025944 Bacteria 1422
343 Ga0207679_10009151 3300025945 Bacteria 6333
344 Ga0207679_10044518 3300025945 Bacteria 3203
345 Ga0207679_10129184 3300025945 Bacteria 2024
346 Ga0207712_10001263 3300025961 Bacteria 17420
347 Ga0207712_10004110 3300025961 Bacteria 9189
348 Ga0207668_10019443 3300025972 Bacteria 4294
349 Ga0207668_10027847 3300025972 Bacteria 3686
350 Ga0207668_10055322 3300025972 Bacteria 2758
351 Ga0207658_10050495 3300025986 Bacteria 3061
352 Ga0207639_10221437 3300026041 Bacteria 1634
353 Ga0207708_10122013 3300026075 Bacteria 2031
354 Ga0207702_10006369 3300026078 Bacteria 10188
355 Ga0207702_10082598 3300026078 Bacteria 2794
356 Ga0207641_10129055 3300026088 Bacteria 2267
357 Ga0207641_10234572 3300026088 Bacteria 1707
358 Ga0207648_10003275 3300026089 Bacteria 17030
359 Ga0207648_10037599 3300026089 Bacteria 4265
360 Ga0207676_10032435 3300026095 Bacteria 3936
361 Ga0207674_10000120 3300026116 Bacteria 91883
362 Ga0207674_10022748 3300026116 Bacteria 6726
363 Ga0207674_10084352 3300026116 Bacteria 3175
364 Ga0207674_10131472 3300026116 Bacteria 2466
365 Ga0207698_10004081 3300026142 Bacteria 8866
366 Ga0207698_10046074 3300026142 Bacteria 3290
367 Ga0207698_10048475 3300026142 Bacteria 3225
368 Ga0207428_10037258 3300027907 Bacteria 3958
369 Ga0268265_10001595 3300028380 Bacteria 18725
370 Ga0268265_10029086 3300028380 Bacteria 3963
371 Ga0268264_10187788 3300028381 Unclassified 1881
372 Ga0307408_100007743 3300031548 Bacteria 7105
373 Ga0307408_100041290 3300031548 Bacteria 3270
374 Ga0307405_10005306 3300031731 Bacteria 6200
375 Ga0307405_10006690 3300031731 Bacteria 5693
376 Ga0307410_10100626 3300031852 Bacteria 2071
377 Ga0307406_10021245 3300031901 Bacteria 3837
378 Ga0307407_10006838 3300031903 Bacteria 5113
379 Ga0307407_10019916 3300031903 Bacteria 3424
380 Ga0307412_10137685 3300031911 Bacteria 1783
381 Ga0307409_100002209 3300031995 Bacteria 10056
382 Ga0307409_100023682 3300031995 Bacteria 4262
383 Ga0307409_100065563 3300031995 Bacteria 2858
384 Ga0307416_100018746 3300032002 Bacteria 4886
385 Ga0307416_100026641 3300032002 Bacteria 4263
386 Ga0307416_100038762 3300032002 Bacteria 3679
387 Ga0307416_100195182 3300032002 Bacteria 1914
388 Ga0307416_100224637 3300032002 Bacteria 1804
389 Ga0307414_10005718 3300032004 Bacteria 6870
390 Ga0307414_10038033 3300032004 Bacteria 3227
391 Ga0307411_10159814 3300032005 Bacteria 1686
392 Ga0307411_10420757 3300032005 Bacteria 1110
393 Ga0307415_100001449 3300032126 Bacteria 11366
394 Ga0373926_0000847 3300035083 Bacteria 8715
395 Ga0373934_0000268 3300035086 Bacteria 18711
396 Ga0373923_0004528 3300035111 Bacteria 4622
397 Ga0373923_0052600 3300035111 Bacteria 1711
398 Ga0373953_0006058 3300035117 Bacteria 3964
399 Ga0373953_0023500 3300035117 Bacteria 2334
400 Ga0373954_0012964 3300035118 Bacteria 3712
401 Ga0373956_0001288 3300035119 Bacteria 10379
402 Ga0373946_0019839 3300035171 Bacteria 2593
403 Ga0373955_0009843 3300035172 Bacteria 4496
404 Ga0373955_0022976 3300035172 Bacteria 3171
405 Ga0373955_0028183 3300035172 Bacteria 2910
406 Ga0373935_0000326 3300035692 Bacteria 23943
407 Ga0373927_0005297 3300035695 Bacteria 8910
408 Ga0373933_0000033 3300035724 Bacteria 84415
409 Ga0373933_0052222 3300035724 Bacteria 2445
410 Ga0373947_0001264 3300035725 Bacteria 15571
411 Ga0373937_0000158 3300036401 Bacteria 65505
412 Ga0373937_0001025 3300036401 Bacteria 23637
413 Ga0373937_0086795 3300036401 Bacteria 2895
414 Ga0373925_0000986 3300037068 Bacteria 25937
415 Ga0395898_0157387 3300037466 Bacteria 2173
416 Ga0395905_0012027 3300037471 Bacteria 8346
417 Ga0395905_0025986 3300037471 Bacteria 5521
418 Ga0395901_0012275 3300038443 Bacteria 8694
419 Ga0450896_004842 3300042133 Bacteria 1831
420 Ga0451577_0000005 3300042876 Bacteria 712599
421 Ga0466969_0108285 3300044656 Bacteria 1303
422 Ga0466966_0129945 3300044684 Bacteria 1543
423 Ga0466959_0017315 3300045049 Bacteria 5281
424 Ga0466967_0025650 3300045976 Bacteria 4864
425 Ga0466967_0235142 3300045976 Bacteria 1746
426 Ga0495603_0016958 3300046455 Bacteria 4407
427 Ga0495629_0003679 3300046459 Bacteria 11589
428 Ga0495629_0045502 3300046459 Bacteria 3079
429 Ga0495651_0000572 3300046462 Bacteria 28583
430 Ga0495651_0004202 3300046462 Bacteria 11032
431 Ga0495651_0035342 3300046462 Bacteria 3891
432 Ga0495653_0000173 3300046463 Bacteria 53365
433 Ga0495653_0014450 3300046463 Bacteria 6442
434 Ga0495580_0006012 3300046472 Bacteria 9936
435 Ga0495580_0038935 3300046472 Bacteria 3402
436 Ga0495582_0008481 3300046473 Bacteria 5670
437 Ga0495662_0040127 3300046476 Bacteria 2261
438 Ga0495664_0013973 3300046477 Bacteria 4549
439 Ga0495594_0012106 3300046499 Bacteria 4491
440 Ga0495594_0043959 3300046499 Bacteria 2450
441 Ga0495594_0139221 3300046499 Bacteria 1376
442 Ga0495608_0000418 3300046511 Bacteria 29615
443 Ga0495618_0069736 3300046514 Bacteria 2235
444 Ga0495628_0000467 3300046516 Bacteria 37087
445 Ga0495628_0091911 3300046516 Bacteria 2348
446 Ga0495630_0001246 3300046517 Bacteria 17578
447 Ga0495630_0079628 3300046517 Bacteria 2471
448 Ga0495652_0000658 3300046529 Bacteria 40060
449 Ga0495652_0002827 3300046529 Bacteria 17480
450 Ga0495665_0000327 3300046531 Bacteria 24173
451 Ga0495587_0000247 3300046536 Bacteria 39646
452 Ga0495587_0003466 3300046536 Bacteria 10506
453 Ga0495587_0010322 3300046536 Bacteria 5951
454 Ga0495645_0000210 3300046543 Bacteria 41882
455 Ga0495645_0005284 3300046543 Bacteria 8846
456 Ga0495645_0022315 3300046543 Bacteria 4578
457 Ga0495645_0051695 3300046543 Bacteria 2989
458 Ga0495667_0004730 3300046559 Bacteria 9204
459 Ga0495634_0057120 3300046642 Bacteria 2606
460 Ga0495635_0000157 3300046663 Bacteria 41636
461 Ga0495635_0068088 3300046663 Bacteria 2442
462 Ga0495588_0001152 3300046674 Bacteria 11358
463 Ga0495657_0008627 3300046675 Bacteria 7779
464 Ga0495599_0000858 3300046678 Bacteria 16995
465 Ga0495599_0014299 3300046678 Bacteria 4915
466 Ga0495599_0030779 3300046678 Bacteria 3369
467 Ga0495623_0000014 3300046679 Bacteria 119814
468 Ga0495623_0001143 3300046679 Bacteria 17950
469 Ga0495646_0040531 3300046680 Bacteria 2867
470 Ga0495658_0000573 3300046683 Bacteria 20062
471 Ga0495613_0124651 3300046689 Bacteria 1848
472 Ga0495600_0000105 3300046809 Bacteria 46401
473 Ga0495581_0000150 3300047315 Bacteria 30837
474 Ga0495581_0023496 3300047315 Bacteria 3572
475 Ga0495604_0002679 3300047317 Bacteria 14280
476 Ga0495604_0208938 3300047317 Bacteria 1350
477 Ga0495674_0005036 3300047319 Bacteria 12709
478 Ga0495672_0003097 3300047320 Bacteria 14528
479 Ga0495680_0001244 3300047322 Bacteria 27949
480 Ga0495675_0021362 3300047444 Bacteria 4121
481 Ga0495675_0043803 3300047444 Bacteria 2851
482 Ga0495675_0083758 3300047444 Unclassified 2007
483 Ga0495684_0003598 3300047471 Bacteria 12086
484 Ga0495593_0000112 3300047673 Bacteria 38250
485 Ga0495602_0003519 3300048088 Bacteria 16197
486 Ga0495602_0034625 3300048088 Bacteria 4722
487 Ga0495602_0146808 3300048088 Bacteria 1859
488 Ga0495614_0000021 3300048089 Bacteria 45062
489 Ga0496105_0113580 3300048908 Bacteria 2235
490 Ga0496106_0137953 3300048909 Bacteria 1917
491 Ga0496108_0082404 3300048911 Bacteria 2728
492 Ga0496109_0007143 3300048912 Bacteria 9436
493 Ga0496112_0025310 3300048915 Bacteria 5698
494 Ga0496112_0050523 3300048915 Bacteria 4078
495 Ga0496112_0158895 3300048915 Bacteria 2227
496 Ga0496113_0017414 3300048916 Bacteria 4987
497 Ga0496114_0118358 3300048917 Bacteria 2276
498 Ga0496115_0003186 3300048918 Bacteria 11790
499 Ga0501031_0036006 3300049568 Bacteria 3228
500 Ga0501033_0006024 3300049570 Bacteria 9512
501 Ga0501034_0281481 3300049571 Bacteria 1602
502 Ga0501034_0315844 3300049571 Bacteria 1496
503 Ga0501036_0168888 3300049572 Bacteria 1843
504 Ga0501038_0032379 3300049574 Bacteria 4613
505 Ga0501038_0300825 3300049574 Bacteria 1259
506 Ga0501047_0067420 3300049581 Bacteria 3449
507 Ga0501080_0178552 3300049742 Bacteria 1955
508 Ga0501035_0203895 3300049822 Bacteria 1695
509 Ga0501035_0221324 3300049822 Bacteria 1616
510 Ga0501045_0009542 3300049824 Bacteria 6790
511 nmdc:mga05p37_116123_c1 3300050507 Bacteria 3289
512 nmdc:mga0qj67_149950_c1 3300050509 Bacteria 1892
513 nmdc:mga0qj67_27546_c1 3300050509 Bacteria 4406
514 nmdc:mga0qj67_303753_c1 3300050509 Bacteria 1293
515 nmdc:mga0qj67_3307_c1 3300050509 Bacteria 11613
516 nmdc:mga0qj67_42956_c1 3300050509 Bacteria 3560
517 nmdc:mga06r32_36854_c1 3300050510 Bacteria 4625
518 nmdc:mga06r32_57724_c1 3300050510 Bacteria 3729
519 nmdc:mga08y16_47765_c1 3300050511 Bacteria 4480
520 nmdc:mga0rr50_98846_c1 3300050513 Bacteria 2288
521 nmdc:mga08x19_6841_c1 3300050514 Bacteria 6773
522 Ga0495612_0004210 3300053078 Bacteria 5966
523 Ga0495619_0003661 3300053085 Bacteria 9906
524 Ga0501084_0183129 3300054114 Bacteria 1768
525 Ga0495629_0100630
526 Ga0065707_10092301
527 Ga0070658_10001483
528 Ga0070676_10042873
529 Ga0070676_10102670
530 Ga0070683_100001197
531 Ga0070683_100026676
532 Ga0070683_100033866
533 Ga0070683_100049685
534 Ga0070683_100100284
535 Ga0070683_100109671
536 Ga0070683_100128253
537 Ga0070690_100105005
538 Ga0070670_100001690
539 Ga0070670_100175930
540 Ga0068869_100006554
541 Ga0068869_100333923
542 Ga0070666_10190707
543 Ga0070680_100001664
544 Ga0070680_100002636
545 Ga0070680_100018440
546 Ga0070680_100029579
547 Ga0070680_100049831
548 Ga0070680_100124753
549 Ga0070680_100139430
550 Ga0070680_100192134
551 Ga0070660_100054163
552 Ga0070660_100091095
553 Ga0070660_100108771
554 Ga0070689_100128978
555 Ga0070687_100024037
556 Ga0070687_100069337
557 Ga0070661_100002651
558 Ga0070661_100020906
559 Ga0070692_10002754
560 Ga0070668_100019433
561 Ga0070668_100024411
562 Ga0070668_100046693
563 Ga0070669_100004597
564 Ga0070669_100141216
565 Ga0070669_100254161
566 Ga0070675_100001303
567 Ga0070675_100004851
568 Ga0070671_100010754
569 Ga0070671_100061277
570 Ga0070671_100072157
571 Ga0070674_100014636
572 Ga0070673_100178888
573 Ga0070688_100008049
574 Ga0070659_100005266
575 Ga0070659_100078772
576 Ga0070667_100081347
577 Ga0070667_100256759
578 Ga0070667_100309469
579 Ga0070709_10020880
580 Ga0070714_100016126
581 Ga0070714_100022232
582 Ga0070714_100035830
583 Ga0070713_100000274
584 Ga0070713_100062954
585 Ga0070710_10059049
586 Ga0070711_100051785
587 Ga0070708_100000045
588 Ga0070662_100054079
589 Ga0070662_100067162
590 Ga0070662_100082564
591 Ga0070662_100086544
592 Ga0070681_10000537
593 Ga0070681_10008034
594 Ga0070681_10013030
595 Ga0070681_10013515
596 Ga0070681_10029456
597 Ga0070681_10207396
598 Ga0068867_100035337
599 Ga0068867_100083776
600 Ga0070685_10017695
601 Ga0070685_10089744
602 Ga0070706_100029357
603 Ga0070706_100128581
604 Ga0070707_100029417
605 Ga0070698_100146751
606 Ga0070698_100205329
607 Ga0070699_100375959
608 Ga0070679_100000940
609 Ga0070679_100002624
610 Ga0070679_100013713
611 Ga0070679_100016000
612 Ga0070679_100049944
613 Ga0070679_100058934
614 Ga0070679_100171118
615 Ga0070684_100008121
616 Ga0070684_100016538
617 Ga0070684_100022918
618 Ga0070684_100026145
619 Ga0070684_100045645
620 Ga0070684_100056307
621 Ga0070684_100069933
622 Ga0070684_100094815
623 Ga0070684_100116562
624 Ga0070684_100245940
625 Ga0070684_100380168
626 Ga0070672_100016872
627 Ga0070672_100080441
628 Ga0070696_100005390
629 Ga0070696_100015929
630 Ga0070665_100204588
631 Ga0070665_100264590
632 Ga0068855_100013870
633 Ga0068855_100207602
634 Ga0068855_100441238
635 Ga0070664_100013127
636 Ga0070664_100092758
637 Ga0070664_100135355
638 Ga0070664_100163564
639 Ga0070664_100175397
640 Ga0068857_100008501
641 Ga0068857_100013444
642 Ga0068857_100040907
643 Ga0068857_100121082
644 Ga0068854_100031306
645 Ga0068854_100291151
646 Ga0068856_100008186
647 Ga0068856_100034774
648 Ga0068856_100176153
649 Ga0068856_100200303
650 Ga0068852_100041149
651 Ga0068852_100056074
652 Ga0068852_100063876
653 Ga0068859_100020877
654 Ga0068859_100056249
655 Ga0068864_100008979
656 Ga0068864_100090837
657 Ga0068866_10013526
658 Ga0068861_100012315
659 Ga0068851_10019465
660 Ga0068870_10010164
661 Ga0068870_10012345
662 Ga0068870_10012484
663 Ga0068870_10063097
664 Ga0068870_10163537
665 Ga0068863_100040124
666 Ga0068863_100305094
667 Ga0068858_100107302
668 Ga0068858_100451767
669 Ga0068860_100069019
670 Ga0068862_100000513
671 Ga0068862_100105087
672 Ga0081539_10000174
673 Ga0070717_10003227
674 Ga0070717_10165301
675 Ga0070712_100000729
676 Ga0068871_100043477
677 Ga0075430_100004889
678 Ga0075430_100015467
679 Ga0075430_100021793
680 Ga0075430_100053013
681 Ga0075430_100244046
682 Ga0075431_100001756
683 Ga0075431_100013780
684 Ga0075431_100073766
685 Ga0075434_100048454
686 Ga0075429_100012636
687 Ga0068865_100072567
688 Ga0075436_100002168
689 Ga0097620_100020878
690 Ga0097620_100056249
691 Ga0105240_10001786
692 Ga0105240_10018268
693 Ga0105240_10527918
694 Ga0111539_10037513
695 Ga0111539_10048767
696 Ga0105245_10095260
697 Ga0105245_10478892
698 Ga0114129_10177230
699 Ga0114129_10738944
700 Ga0105243_10179084
701 Ga0105241_10003130
702 Ga0105242_10007016
703 Ga0105242_10035562
704 Ga0105248_10010770
705 Ga0105248_10068953
706 Ga0105248_10071471
707 Ga0105248_10135631
708 Ga0105248_10151299
709 Ga0105237_10004438
710 Ga0105237_10115057
711 Ga0105238_10042389
712 Ga0105249_10000251
713 Ga0105249_10044399
714 Ga0105246_10002700
715 Ga0157373_10016174
716 Ga0157373_10070660
717 Ga0157371_10007718
718 Ga0157371_10011433
719 Ga0157371_10189813
720 Ga0157370_10007065
721 Ga0157370_10014177
722 Ga0157370_10025875
723 Ga0157370_10161439
724 Ga0157369_10004783
725 Ga0157369_10015607
726 Ga0157369_10028114
727 Ga0157369_10073946
728 Ga0157369_10109713
729 Ga0157369_10110302
730 Ga0157369_10154196
731 Ga0157374_10024820
732 Ga0157374_10239765
733 Ga0157378_10075869
734 Ga0157378_10107328
735 Ga0163162_10187794
736 Ga0157372_10003638
737 Ga0157372_10005371
738 Ga0157372_10011940
739 Ga0157372_10014215
740 Ga0157372_10025243
741 Ga0157372_10028700
742 Ga0157372_10094480
743 Ga0157372_10109733
744 Ga0157372_10131041
745 Ga0157372_10177663
746 Ga0157375_10023763
747 Ga0157375_10073656
748 Ga0157375_10182494
749 Ga0157375_10500040
750 Ga0157375_10631634
751 Ga0163163_10002771
752 Ga0163163_10040544
753 Ga0163163_10371975
754 Ga0157380_10023530
755 Ga0157377_10000361
756 Ga0157379_10001669
757 Ga0157376_10007918
758 Ga0157376_10110333
759 Ga0157376_10248369
760 Ga0182007_10059774
761 Ga0163161_10034811
762 Ga0206356_11147558
763 Ga0207682_10027922
764 Ga0207688_10107937
765 Ga0207680_10182171
766 Ga0207699_10037618
767 Ga0207699_10041085
768 Ga0207645_10048955
769 Ga0207645_10062675
770 Ga0207645_10071034
771 Ga0207643_10002389
772 Ga0207643_10003121
773 Ga0207643_10038298
774 Ga0207643_10140316
775 Ga0207705_10006635
776 Ga0207705_10029168
777 Ga0207705_10070941
778 Ga0207684_10036904
779 Ga0207684_10089310
780 Ga0207707_10001274
781 Ga0207707_10003913
782 Ga0207707_10004622
783 Ga0207707_10015537
784 Ga0207707_10019956
785 Ga0207707_10024036
786 Ga0207707_10032322
787 Ga0207707_10034709
788 Ga0207707_10036663
789 Ga0207707_10042475
790 Ga0207695_10004134
791 Ga0207695_10017490
792 Ga0207695_10022295
793 Ga0207695_10296659
794 Ga0207695_10309910
795 Ga0207695_10369543
796 Ga0207671_10042557
797 Ga0207671_10106249
798 Ga0207693_10009781
799 Ga0207693_10124994
800 Ga0207660_10003457
801 Ga0207660_10005979
802 Ga0207660_10026731
803 Ga0207660_10027935
804 Ga0207660_10028418
805 Ga0207660_10034422
806 Ga0207660_10039964
807 Ga0207660_10162998
808 Ga0207660_10277457
809 Ga0207662_10002218
810 Ga0207662_10010164
811 Ga0207657_10030969
812 Ga0207657_10031470
813 Ga0207657_10059737
814 Ga0207657_10116369
815 Ga0207652_10000636
816 Ga0207652_10002058
817 Ga0207652_10003798
818 Ga0207652_10010341
819 Ga0207652_10033953
820 Ga0207652_10035111
821 Ga0207652_10112280
822 Ga0207652_10141794
823 Ga0207652_10177064
824 Ga0207646_10035542
825 Ga0207681_10001166
826 Ga0207681_10032103
827 Ga0207681_10077594
828 Ga0207694_10127219
829 Ga0207650_10020901
830 Ga0207650_10200054
831 Ga0207659_10006490
832 Ga0207659_10054273
833 Ga0207659_10100729
834 Ga0207687_10002512
835 Ga0207700_10001579
836 Ga0207700_10063341
837 Ga0207664_10033723
838 Ga0207664_10040806
839 Ga0207644_10046697
840 Ga0207690_10003410
841 Ga0207706_10006192
842 Ga0207706_10122547
843 Ga0207706_10216576
844 Ga0207706_10257060
845 Ga0207709_10108714
846 Ga0207669_10013126
847 Ga0207704_10019217
848 Ga0207691_10016638
849 Ga0207691_10018984
850 Ga0207691_10026902
851 Ga0207691_10030149
852 Ga0207711_10021340
853 Ga0207711_10235955
854 Ga0207689_10003321
855 Ga0207689_10044160
856 Ga0207661_10002251
857 Ga0207661_10011779
858 Ga0207661_10028981
859 Ga0207661_10034946
860 Ga0207661_10037775
861 Ga0207661_10053505
862 Ga0207661_10100013
863 Ga0207661_10166175
864 Ga0207661_10203919
865 Ga0207661_10231465
866 Ga0207661_10307475
867 Ga0207679_10009151
868 Ga0207679_10044518
869 Ga0207679_10129184
870 Ga0207712_10001263
871 Ga0207712_10004110
872 Ga0207668_10019443
873 Ga0207668_10027847
874 Ga0207668_10055322
875 Ga0207658_10050495
876 Ga0207639_10221437
877 Ga0207708_10122013
878 Ga0207702_10006369
879 Ga0207702_10082598
880 Ga0207641_10129055
881 Ga0207641_10234572
882 Ga0207648_10003275
883 Ga0207648_10037599
884 Ga0207676_10032435
885 Ga0207674_10000120
886 Ga0207674_10022748
887 Ga0207674_10084352
888 Ga0207674_10131472
889 Ga0207698_10004081
890 Ga0207698_10046074
891 Ga0207698_10048475
892 Ga0207428_10037258
893 Ga0268265_10001595
894 Ga0268265_10029086
895 Ga0268264_10187788
896 Ga0307408_100007743
897 Ga0307408_100041290
898 Ga0307405_10005306
899 Ga0307405_10006690
900 Ga0307410_10100626
901 Ga0307406_10021245
902 Ga0307407_10006838
903 Ga0307407_10019916
904 Ga0307412_10137685
905 Ga0307409_100002209
906 Ga0307409_100023682
907 Ga0307409_100065563
908 Ga0307416_100018746
909 Ga0307416_100026641
910 Ga0307416_100038762
911 Ga0307416_100195182
912 Ga0307416_100224637
913 Ga0307414_10005718
914 Ga0307414_10038033
915 Ga0307411_10159814
916 Ga0307411_10420757
917 Ga0307415_100001449
918 Ga0373926_0000847
919 Ga0373934_0000268
920 Ga0373923_0004528
921 Ga0373923_0052600
922 Ga0373953_0006058
923 Ga0373953_0023500
924 Ga0373954_0012964
925 Ga0373956_0001288
926 Ga0373946_0019839
927 Ga0373955_0009843
928 Ga0373955_0022976
929 Ga0373955_0028183
930 Ga0373935_0000326
931 Ga0373927_0005297
932 Ga0373933_0000033
933 Ga0373933_0052222
934 Ga0373947_0001264
935 Ga0373937_0000158
936 Ga0373937_0001025
937 Ga0373937_0086795
938 Ga0373925_0000986
939 Ga0395898_0157387
940 Ga0395905_0012027
941 Ga0395905_0025986
942 Ga0395901_0012275
943 Ga0450896_004842
944 Ga0451577_0000005
945 Ga0466969_0108285
946 Ga0466966_0129945
947 Ga0466959_0017315
948 Ga0466967_0025650
949 Ga0466967_0235142
950 Ga0495603_0016958
951 Ga0495629_0003679
952 Ga0495629_0045502
953 Ga0495651_0000572
954 Ga0495651_0004202
955 Ga0495651_0035342
956 Ga0495653_0000173
957 Ga0495653_0014450
958 Ga0495580_0006012
959 Ga0495580_0038935
960 Ga0495582_0008481
961 Ga0495662_0040127
962 Ga0495664_0013973
963 Ga0495594_0012106
964 Ga0495594_0043959
965 Ga0495594_0139221
966 Ga0495608_0000418
967 Ga0495618_0069736
968 Ga0495628_0000467
969 Ga0495628_0091911
970 Ga0495630_0001246
971 Ga0495630_0079628
972 Ga0495652_0000658
973 Ga0495652_0002827
974 Ga0495665_0000327
975 Ga0495587_0000247
976 Ga0495587_0003466
977 Ga0495587_0010322
978 Ga0495645_0000210
979 Ga0495645_0005284
980 Ga0495645_0022315
981 Ga0495645_0051695
982 Ga0495667_0004730
983 Ga0495634_0057120
984 Ga0495635_0000157
985 Ga0495635_0068088
986 Ga0495588_0001152
987 Ga0495657_0008627
988 Ga0495599_0000858
989 Ga0495599_0014299
990 Ga0495599_0030779
991 Ga0495623_0000014
992 Ga0495623_0001143
993 Ga0495646_0040531
994 Ga0495658_0000573
995 Ga0495613_0124651
996 Ga0495600_0000105
997 Ga0495581_0000150
998 Ga0495581_0023496
999 Ga0495604_0002679
1000 Ga0495604_0208938
1001 Ga0495674_0005036
1002 Ga0495672_0003097
1003 Ga0495680_0001244
1004 Ga0495675_0021362
1005 Ga0495675_0043803
1006 Ga0495675_0083758
1007 Ga0495684_0003598
1008 Ga0495593_0000112
1009 Ga0495602_0003519
1010 Ga0495602_0034625
1011 Ga0495602_0146808
1012 Ga0495614_0000021
1013 Ga0496105_0113580
1014 Ga0496106_0137953
1015 Ga0496108_0082404
1016 Ga0496109_0007143
1017 Ga0496112_0025310
1018 Ga0496112_0050523
1019 Ga0496112_0158895
1020 Ga0496113_0017414
1021 Ga0496114_0118358
1022 Ga0496115_0003186
1023 Ga0501031_0036006
1024 Ga0501033_0006024
1025 Ga0501034_0281481
1026 Ga0501034_0315844
1027 Ga0501036_0168888
1028 Ga0501038_0032379
1029 Ga0501038_0300825
1030 Ga0501047_0067420
1031 Ga0501080_0178552
1032 Ga0501035_0203895
1033 Ga0501035_0221324
1034 Ga0501045_0009542
1035 nmdc:mga05p37_116123_c1
1036 nmdc:mga0qj67_149950_c1
1037 nmdc:mga0qj67_27546_c1
1038 nmdc:mga0qj67_303753_c1
1039 nmdc:mga0qj67_3307_c1
1040 nmdc:mga0qj67_42956_c1
1041 nmdc:mga06r32_36854_c1
1042 nmdc:mga06r32_57724_c1
1043 nmdc:mga08y16_47765_c1
1044 nmdc:mga0rr50_98846_c1
1045 nmdc:mga08x19_6841_c1
1046 Ga0495612_0004210
1047 Ga0495619_0003661
1048 Ga0501084_0183129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

13

123

0.98

PF13487

HD_5

HD domain

162

330

0.96

PF01966

HD

HD domain

175

298

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9564 20 137
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9562 21 137
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9549 21 137
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9545 21 137
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.951 20 137
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9672 19 99 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9558 19 99 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9516 22 136 3.40.50.2300
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9466 20 143 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9445 20 143 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A353LGX9-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9699 19 139 GO:0000160
GO:0005524
GO:0006355
GO:0043565
AF-A0A497IEC0-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9685 18 144 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7W7Y2B2-F1-model_v4 DNA-binding NtrC family response regulator 0.9635 20 138 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A1G1I1A7-F1-model_v4 Response regulatory domain-containing protein 0.9633 20 138 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A419DN44-F1-model_v4 DNA-binding response regulator 0.9624 20 130 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map