F459212

General Info

Members Datasets Scaffolds Average Seq Length
525 267 512 154

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1048292|JGI24736J21556_10482921
Length 161
Sequence MIIATTAPTNEMPRLNWRAPFGLLARIGSTLFSPSLVLLVQRLGIAAVFFMSGRTKIAEGTWLTLSDDAFELFRTDYKLPFISPVPGAYAATTAEHLFPILLVLGLLTRFSACGLLVMTLVIEIFVYPDAWPTHLSWAGLLLPLIAFGGGKLSLDRALRIP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
9 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
10 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
13 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
14 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
265 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0.57
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.19
Rhizoplane 6.29
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1793279 2162886007 Bacteria 5449
2 SwRhRL2b_contig_3665959 2162886007 Bacteria 6817
3 SwRhRL2b_contig_875286 2162886007 Bacteria 1370
4 JGI24736J21556_1001357 3300001904 Bacteria 4467
5 JGI24736J21556_1048292 3300001904 Bacteria 655
6 JGI24740J21852_10067811 3300001979 Bacteria 964
7 JGI24739J22299_10014380 3300001989 Bacteria 2880
8 JGI24739J22299_10027977 3300001989 Bacteria 1968
9 JGI24737J22298_10072303 3300001990 Bacteria 1029
10 JGI24735J21928_10006833 3300002067 Bacteria 3738
11 rootH2_10065310 3300003320 Bacteria 6765
12 rootL2_10321619 3300003322 Bacteria 2279
13 Ga0055526_1003911 3300003771 Bacteria 9195
14 Ga0065704_10001975 3300005289 Bacteria 9225
15 Ga0065704_10072411 3300005289 Bacteria 8575
16 Ga0065704_10090137 3300005289 Bacteria 2810
17 Ga0065704_10094279 3300005289 Bacteria 2551
18 Ga0065707_10120005 3300005295 Bacteria 2145
19 Ga0070658_11100512 3300005327 Bacteria 691
20 Ga0070690_100001607 3300005330 Bacteria 11862
21 Ga0070670_100082900 3300005331 Bacteria 2755
22 Ga0070666_10000479 3300005335 Bacteria 24181
23 Ga0070666_10041134 3300005335 Bacteria 3087
24 Ga0068868_100000635 3300005338 Bacteria 23648
25 Ga0068868_101650346 3300005338 Bacteria 603
26 Ga0070660_100004200 3300005339 Bacteria 9947
27 Ga0070660_100009128 3300005339 Bacteria 6961
28 Ga0070660_100038884 3300005339 Bacteria 3614
29 Ga0070660_100563477 3300005339 Bacteria 951
30 Ga0070689_100233340 3300005340 Bacteria 1513
31 Ga0070689_101676395 3300005340 Bacteria 578
32 Ga0070687_100499913 3300005343 Bacteria 818
33 Ga0070661_100019603 3300005344 Bacteria 4821
34 Ga0070668_100005762 3300005347 Bacteria 9188
35 Ga0070668_100015102 3300005347 Bacteria 5770
36 Ga0070669_100002401 3300005353 Bacteria 13554
37 Ga0070669_100331721 3300005353 Bacteria 1231
38 Ga0070675_100143279 3300005354 Bacteria 2044
39 Ga0070675_100312855 3300005354 Bacteria 1386
40 Ga0070671_100006910 3300005355 Bacteria 9087
41 Ga0070671_100016603 3300005355 Bacteria 5951
42 Ga0070671_100354978 3300005355 Bacteria 1252
43 Ga0070671_100486842 3300005355 Bacteria 1060
44 Ga0070674_100000246 3300005356 Bacteria 26886
45 Ga0070674_100138505 3300005356 Bacteria 1824
46 Ga0070673_100010066 3300005364 Bacteria 6384
47 Ga0070673_100156831 3300005364 Bacteria 1932
48 Ga0070673_100198270 3300005364 Bacteria 1728
49 Ga0070673_100245457 3300005364 Bacteria 1558
50 Ga0070673_100332713 3300005364 Bacteria 1344
51 Ga0070688_100225628 3300005365 Bacteria 1323
52 Ga0070659_100005094 3300005366 Bacteria 9427
53 Ga0070659_100036279 3300005366 Bacteria 3843
54 Ga0070667_100001121 3300005367 Bacteria 24448
55 Ga0070667_100016694 3300005367 Bacteria 6076
56 Ga0070667_100017742 3300005367 Bacteria 5899
57 Ga0070667_100089557 3300005367 Bacteria 2643
58 Ga0070667_100095796 3300005367 Bacteria 2559
59 Ga0070667_100540919 3300005367 Bacteria 1070
60 Ga0070667_100576611 3300005367 Bacteria 1035
61 Ga0070705_100096093 3300005440 Bacteria 1859
62 Ga0070700_100555781 3300005441 Bacteria 892
63 Ga0070678_100000187 3300005456 Bacteria 27177
64 Ga0070678_100088587 3300005456 Bacteria 2366
65 Ga0070662_100021818 3300005457 Bacteria 4377
66 Ga0070662_100130023 3300005457 Bacteria 1940
67 Ga0070662_100168073 3300005457 Bacteria 1720
68 Ga0070662_101124767 3300005457 Bacteria 674
69 Ga0070681_11403643 3300005458 Bacteria 622
70 Ga0068867_100134612 3300005459 Bacteria 1925
71 Ga0068867_100604870 3300005459 Bacteria 956
72 Ga0070679_101599606 3300005530 Bacteria 599
73 Ga0068853_100278550 3300005539 Bacteria 1541
74 Ga0070672_100004299 3300005543 Bacteria 9316
75 Ga0070672_100135447 3300005543 Bacteria 2028
76 Ga0070672_100630132 3300005543 Bacteria 935
77 Ga0070686_101690383 3300005544 Bacteria 537
78 Ga0070665_100008625 3300005548 Bacteria 10317
79 Ga0070665_100022421 3300005548 Bacteria 6354
80 Ga0070665_100065537 3300005548 Bacteria 3644
81 Ga0070665_100168264 3300005548 Bacteria 2194
82 Ga0070665_100220573 3300005548 Bacteria 1897
83 Ga0068855_100192044 3300005563 Bacteria 2303
84 Ga0068855_100586790 3300005563 Bacteria 1203
85 Ga0068855_101917306 3300005563 Bacteria 600
86 Ga0070664_102260646 3300005564 Bacteria 516
87 Ga0068857_100030929 3300005577 Bacteria 4730
88 Ga0068854_100143073 3300005578 Bacteria 1837
89 Ga0068854_100721807 3300005578 Bacteria 862
90 Ga0068856_100014726 3300005614 Bacteria 7548
91 Ga0068856_100346664 3300005614 Bacteria 1504
92 Ga0068852_100012931 3300005616 Bacteria 6365
93 Ga0068852_100064682 3300005616 Bacteria 3189
94 Ga0068864_100055595 3300005618 Bacteria 3418
95 Ga0068864_100179977 3300005618 Bacteria 1932
96 Ga0068864_100307583 3300005618 Bacteria 1485
97 Ga0068864_101275321 3300005618 Bacteria 735
98 Ga0068866_10013963 3300005718 Bacteria 3535
99 Ga0068866_10633747 3300005718 Bacteria 726
100 Ga0068851_10112431 3300005834 Bacteria 1455
101 Ga0068870_11117047 3300005840 Bacteria 567
102 Ga0068863_100017809 3300005841 Bacteria 6800
103 Ga0068863_100022777 3300005841 Bacteria 5983
104 Ga0068863_100388341 3300005841 Bacteria 1364
105 Ga0068863_100489582 3300005841 Bacteria 1210
106 Ga0068858_100000310 3300005842 Bacteria 51909
107 Ga0068858_100000438 3300005842 Bacteria 43458
108 Ga0068858_100006991 3300005842 Bacteria 10963
109 Ga0068860_100051896 3300005843 Bacteria 3901
110 Ga0068860_100144614 3300005843 Bacteria 2287
111 Ga0068860_100327930 3300005843 Bacteria 1503
112 Ga0068860_100452845 3300005843 Bacteria 1276
113 Ga0068862_100016278 3300005844 Bacteria 6187
114 Ga0068862_100109858 3300005844 Bacteria 2419
115 Ga0068862_100133785 3300005844 Bacteria 2195
116 Ga0068862_100180026 3300005844 Bacteria 1897
117 Ga0097621_100048541 3300006237 Bacteria 3444
118 Ga0097621_100171811 3300006237 Bacteria 1869
119 Ga0097621_100217324 3300006237 Bacteria 1664
120 Ga0097621_101760654 3300006237 Bacteria 590
121 Ga0068871_100071578 3300006358 Bacteria 2852
122 Ga0075429_100286166 3300006880 Bacteria 1443
123 Ga0068865_101147267 3300006881 Bacteria 686
124 Ga0097620_100111006 3300006931 Bacteria 2804
125 Ga0105251_10052904 3300009011 Bacteria 1932
126 Ga0105251_10212572 3300009011 Bacteria 871
127 Ga0105250_10006080 3300009092 Bacteria 5314
128 Ga0105240_10000206 3300009093 Bacteria 119835
129 Ga0105240_10014310 3300009093 Bacteria 10835
130 Ga0105245_10075518 3300009098 Bacteria 3069
131 Ga0105245_10435056 3300009098 Bacteria 1317
132 Ga0105247_10122917 3300009101 Bacteria 1684
133 Ga0105243_10000077 3300009148 Bacteria 110432
134 Ga0105243_10045805 3300009148 Bacteria 3439
135 Ga0105242_10060071 3300009176 Bacteria 3121
136 Ga0105248_10000119 3300009177 Bacteria 89987
137 Ga0105248_10006802 3300009177 Bacteria 12535
138 Ga0105248_10012383 3300009177 Bacteria 9411
139 Ga0105248_10090684 3300009177 Bacteria 3442
140 Ga0105248_10171040 3300009177 Bacteria 2449
141 Ga0105248_10242747 3300009177 Bacteria 2028
142 Ga0105248_10296514 3300009177 Bacteria 1821
143 Ga0105248_10372960 3300009177 Bacteria 1607
144 Ga0105248_10393913 3300009177 Bacteria 1560
145 Ga0105237_10001347 3300009545 Bacteria 32527
146 Ga0105238_10538715 3300009551 Bacteria 1171
147 Ga0105249_10008812 3300009553 Bacteria 8808
148 Ga0105249_10158880 3300009553 Bacteria 2183
149 Ga0105249_10353216 3300009553 Bacteria 1490
150 Ga0105239_10000113 3300010375 Bacteria 114562
151 Ga0105239_10004322 3300010375 Bacteria 17032
152 Ga0157373_10001163 3300013100 Bacteria 20167
153 Ga0157371_10066794 3300013102 Bacteria 2546
154 Ga0157371_10290212 3300013102 Bacteria 1183
155 Ga0157370_10000176 3300013104 Bacteria 79656
156 Ga0157370_10300236 3300013104 Bacteria 1483
157 Ga0157369_10053466 3300013105 Bacteria 4365
158 Ga0157369_10229679 3300013105 Bacteria 1940
159 Ga0157374_10015658 3300013296 Bacteria 6657
160 Ga0157378_10082984 3300013297 Bacteria 2899
161 Ga0163162_10000793 3300013306 Bacteria 29396
162 Ga0163162_10021506 3300013306 Bacteria 6354
163 Ga0163162_10150550 3300013306 Bacteria 2444
164 Ga0163162_10648031 3300013306 Bacteria 1180
165 Ga0163162_11041418 3300013306 Bacteria 926
166 Ga0163162_11597483 3300013306 Bacteria 744
167 Ga0157372_11215970 3300013307 Bacteria 870
168 Ga0157375_10032576 3300013308 Bacteria 4944
169 Ga0157375_10375570 3300013308 Bacteria 1588
170 Ga0163163_10003777 3300014325 Bacteria 12903
171 Ga0163161_10047822 3300017792 Bacteria 3088
172 Ga0207427_100436 3300025231 Bacteria 23280
173 Ga0209437_105693 3300025233 Bacteria 2112
174 Ga0209026_1001456 3300025250 Bacteria 10450
175 Ga0209759_1023813 3300025256 Bacteria 1339
176 Ga0209233_1000213 3300025261 Bacteria 109881
177 Ga0209233_1000291 3300025261 Bacteria 64111
178 Ga0209564_1000670 3300025295 Bacteria 50564
179 Ga0209050_1001657 3300025298 Bacteria 22579
180 Ga0207697_10071765 3300025315 Bacteria 1451
181 Ga0207656_10172730 3300025321 Bacteria 1034
182 Ga0207696_1003816 3300025711 Bacteria 6703
183 Ga0207713_1010826 3300025735 Bacteria 5014
184 Ga0207713_1038698 3300025735 Bacteria 2021
185 Ga0207713_1165659 3300025735 Bacteria 701
186 Ga0207642_10023989 3300025899 Bacteria 2446
187 Ga0207710_10012934 3300025900 Bacteria 3515
188 Ga0207680_10001352 3300025903 Bacteria 11614
189 Ga0207680_10005803 3300025903 Bacteria 5927
190 Ga0207680_10027983 3300025903 Bacteria 3147
191 Ga0207647_10000447 3300025904 Bacteria 33519
192 Ga0207647_10015339 3300025904 Bacteria 5256
193 Ga0207647_10017721 3300025904 Bacteria 4836
194 Ga0207647_10139638 3300025904 Bacteria 1420
195 Ga0207645_10081372 3300025907 Bacteria 2076
196 Ga0207705_10000008 3300025909 Bacteria 589717
197 Ga0207705_10074150 3300025909 Bacteria 2470
198 Ga0207695_10046718 3300025913 Bacteria 4587
199 Ga0207695_10072811 3300025913 Bacteria 3504
200 Ga0207671_10001107 3300025914 Bacteria 32491
201 Ga0207671_10469146 3300025914 Bacteria 1003
202 Ga0207671_10905249 3300025914 Bacteria 697
203 Ga0207657_10000676 3300025919 Bacteria 36328
204 Ga0207657_10006429 3300025919 Bacteria 12187
205 Ga0207657_10054451 3300025919 Bacteria 3460
206 Ga0207657_10258412 3300025919 Bacteria 1386
207 Ga0207649_10229477 3300025920 Bacteria 1327
208 Ga0207681_10001728 3300025923 Bacteria 14035
209 Ga0207681_10272175 3300025923 Bacteria 1330
210 Ga0207681_10341987 3300025923 Bacteria 1195
211 Ga0207650_10085982 3300025925 Bacteria 2393
212 Ga0207659_10113360 3300025926 Bacteria 2065
213 Ga0207644_10003817 3300025931 Bacteria 9759
214 Ga0207644_10010505 3300025931 Bacteria 6102
215 Ga0207644_10014136 3300025931 Bacteria 5340
216 Ga0207644_10227048 3300025931 Bacteria 1482
217 Ga0207644_11657622 3300025931 Bacteria 536
218 Ga0207690_10007834 3300025932 Bacteria 6342
219 Ga0207690_10038499 3300025932 Bacteria 3113
220 Ga0207706_10015188 3300025933 Bacteria 6969
221 Ga0207706_10105371 3300025933 Bacteria 2481
222 Ga0207709_10000110 3300025935 Bacteria 127725
223 Ga0207709_10014707 3300025935 Bacteria 4325
224 Ga0207670_10838618 3300025936 Bacteria 767
225 Ga0207669_10000015 3300025937 Bacteria 125492
226 Ga0207669_10816877 3300025937 Bacteria 774
227 Ga0207691_10006960 3300025940 Bacteria 10909
228 Ga0207691_10324640 3300025940 Bacteria 1319
229 Ga0207711_10000047 3300025941 Bacteria 150849
230 Ga0207711_10020872 3300025941 Bacteria 5467
231 Ga0207711_10027260 3300025941 Bacteria 4798
232 Ga0207711_10037419 3300025941 Bacteria 4121
233 Ga0207711_10052190 3300025941 Bacteria 3504
234 Ga0207711_10170438 3300025941 Bacteria 1975
235 Ga0207711_10179823 3300025941 Bacteria 1923
236 Ga0207689_10755109 3300025942 Bacteria 821
237 Ga0207667_10139729 3300025949 Bacteria 2494
238 Ga0207667_10315477 3300025949 Bacteria 1597
239 Ga0207651_10000205 3300025960 Bacteria 25581
240 Ga0207651_10010071 3300025960 Bacteria 5217
241 Ga0207651_10167043 3300025960 Bacteria 1731
242 Ga0207712_10097482 3300025961 Bacteria 2178
243 Ga0207668_10005073 3300025972 Bacteria 7748
244 Ga0207668_10010874 3300025972 Bacteria 5515
245 Ga0207668_10021629 3300025972 Bacteria 4105
246 Ga0207668_10155036 3300025972 Bacteria 1778
247 Ga0207640_10164699 3300025981 Bacteria 1645
248 Ga0207640_10630780 3300025981 Bacteria 911
249 Ga0207658_10011589 3300025986 Bacteria 6001
250 Ga0207658_10029634 3300025986 Bacteria 3868
251 Ga0207658_10035471 3300025986 Bacteria 3573
252 Ga0207658_10083076 3300025986 Bacteria 2461
253 Ga0207658_10157189 3300025986 Bacteria 1859
254 Ga0207658_10882509 3300025986 Bacteria 814
255 Ga0207677_10003084 3300026023 Bacteria 8794
256 Ga0207703_10000917 3300026035 Bacteria 28709
257 Ga0207703_10009773 3300026035 Bacteria 7525
258 Ga0207703_10017621 3300026035 Bacteria 5575
259 Ga0207639_10050993 3300026041 Bacteria 3145
260 Ga0207678_10707731 3300026067 Bacteria 887
261 Ga0207708_10291811 3300026075 Bacteria 1324
262 Ga0207702_10006519 3300026078 Bacteria 10041
263 Ga0207641_10007041 3300026088 Bacteria 9397
264 Ga0207641_10047342 3300026088 Bacteria 3626
265 Ga0207641_10319522 3300026088 Bacteria 1472
266 Ga0207648_10126269 3300026089 Bacteria 2250
267 Ga0207676_10083723 3300026095 Bacteria 2598
268 Ga0207676_10197717 3300026095 Bacteria 1774
269 Ga0207676_10307474 3300026095 Bacteria 1450
270 Ga0207676_11227794 3300026095 Bacteria 743
271 Ga0207676_12082710 3300026095 Bacteria 566
272 Ga0207674_10431670 3300026116 Bacteria 1273
273 Ga0207683_10000954 3300026121 Bacteria 26517
274 Ga0207683_10031689 3300026121 Bacteria 4589
275 Ga0207683_10109620 3300026121 Bacteria 2471
276 Ga0207683_10353357 3300026121 Bacteria 1349
277 Ga0207683_11090466 3300026121 Bacteria 741
278 Ga0207698_10025031 3300026142 Bacteria 4198
279 Ga0207698_10087405 3300026142 Bacteria 2539
280 Ga0268266_10022849 3300028379 Bacteria 5323
281 Ga0268266_10022870 3300028379 Bacteria 5320
282 Ga0268266_10169223 3300028379 Bacteria 1982
283 Ga0268265_10010725 3300028380 Bacteria 6187
284 Ga0268265_10142153 3300028380 Bacteria 2010
285 Ga0268265_10162816 3300028380 Bacteria 1897
286 Ga0268265_10516453 3300028380 Bacteria 1128
287 Ga0268265_10804836 3300028380 Bacteria 916
288 Ga0268264_10015982 3300028381 Bacteria 6149
289 Ga0268264_10034353 3300028381 Bacteria 4171
290 Ga0268264_10414456 3300028381 Bacteria 1298
291 Ga0268264_11419343 3300028381 Bacteria 705
292 Ga0307408_100005457 3300031548 Bacteria 8510
293 Ga0307408_102001355 3300031548 Unclassified 557
294 Ga0307405_10018176 3300031731 Bacteria 3874
295 Ga0307410_10020715 3300031852 Bacteria 4029
296 Ga0307410_10147107 3300031852 Bacteria 1749
297 Ga0307406_11055236 3300031901 Bacteria 700
298 Ga0307407_10090146 3300031903 Bacteria 1877
299 Ga0307412_10003194 3300031911 Bacteria 9106
300 Ga0307412_10010732 3300031911 Bacteria 5283
301 Ga0307412_10060156 3300031911 Bacteria 2549
302 Ga0307412_10148740 3300031911 Bacteria 1725
303 Ga0307409_100060952 3300031995 Bacteria 2945
304 Ga0307409_100309521 3300031995 Bacteria 1473
305 Ga0307409_101401522 3300031995 Bacteria 725
306 Ga0307416_100001205 3300032002 Bacteria 13922
307 Ga0307416_100813351 3300032002 Bacteria 1031
308 Ga0307414_10117900 3300032004 Bacteria 2035
309 Ga0307411_10055509 3300032005 Bacteria 2606
310 Ga0307411_10074250 3300032005 Bacteria 2316
311 Ga0307411_10779360 3300032005 Bacteria 840
312 Ga0307411_12065523 3300032005 Bacteria 533
313 Ga0307415_100078375 3300032126 Bacteria 2350
314 Ga0307415_100136558 3300032126 Bacteria 1866
315 Ga0307415_100202805 3300032126 Bacteria 1575
316 Ga0373923_0200539 3300035111 Bacteria 922
317 Ga0395899_0006882 3300037312 Bacteria 8809
318 Ga0395899_0335255 3300037312 Bacteria 1015
319 Ga0395899_0592458 3300037312 Bacteria 707
320 Ga0395900_0101796 3300037418 Bacteria 2950
321 Ga0395900_0117624 3300037418 Bacteria 2727
322 Ga0395900_0578306 3300037418 Bacteria 1065
323 Ga0395898_0092215 3300037466 Bacteria 2913
324 Ga0395898_0893651 3300037466 Bacteria 827
325 Ga0395905_0002182 3300037471 Bacteria 22130
326 Ga0395905_0056128 3300037471 Bacteria 3686
327 Ga0395905_0789010 3300037471 Bacteria 853
328 Ga0395905_1339783 3300037471 Bacteria 620
329 Ga0395901_0011294 3300038443 Bacteria 9048
330 Ga0395901_0048402 3300038443 Bacteria 4415
331 Ga0436361_0850351 3300039447 Bacteria 3849
332 Ga0436363_0572110 3300039450 Bacteria 983
333 Ga0439438_009321 3300041405 Bacteria 3185
334 Ga0439438_049690 3300041405 Bacteria 1070
335 Ga0439447_014661 3300041407 Bacteria 2191
336 Ga0439447_038392 3300041407 Bacteria 1177
337 Ga0439466_0000502 3300041411 Bacteria 14823
338 Ga0439448_0036751 3300042005 Bacteria 1571
339 Ga0439432_000094 3300042006 Bacteria 28344
340 Ga0439455_0057445 3300042012 Bacteria 1026
341 Ga0450890_064093 3300042127 Bacteria 579
342 Ga0439446_0247561 3300042156 Bacteria 614
343 Ga0439458_0002046 3300042157 Bacteria 5014
344 Ga0466970_0280109 3300044765 Bacteria 938
345 Ga0495627_053343 3300046453 Bacteria 1210
346 Ga0495591_017335 3300046458 Bacteria 2476
347 Ga0495650_0003769 3300046471 Bacteria 10813
348 Ga0495605_0000033 3300046474 Bacteria 209203
349 Ga0495605_0000119 3300046474 Bacteria 102569
350 Ga0495605_0003643 3300046474 Bacteria 9143
351 Ga0495584_0001222 3300046491 Bacteria 15675
352 Ga0495594_0005312 3300046499 Bacteria 6614
353 Ga0495583_0000031 3300046506 Bacteria 253982
354 Ga0495606_0147793 3300046507 Bacteria 1382
355 Ga0495610_0022393 3300046512 Bacteria 3457
356 Ga0495620_0000038 3300046515 Bacteria 114064
357 Ga0495631_0000969 3300046518 Bacteria 17811
358 Ga0495632_0320546 3300046519 Bacteria 685
359 Ga0495637_0020492 3300046520 Bacteria 3043
360 Ga0495643_0004076 3300046522 Bacteria 10403
361 Ga0495654_0023230 3300046530 Bacteria 3212
362 Ga0495609_0000018 3300046538 Bacteria 302609
363 Ga0495621_0011850 3300046539 Bacteria 2708
364 Ga0495597_0004117 3300046542 Bacteria 8096
365 Ga0495633_0000062 3300046558 Bacteria 142101
366 Ga0495633_0011529 3300046558 Bacteria 4760
367 Ga0495668_0195554 3300046616 Bacteria 1107
368 Ga0495611_0032538 3300046648 Bacteria 2298
369 Ga0495625_0001696 3300046660 Bacteria 25671
370 Ga0495625_0020685 3300046660 Bacteria 5073
371 Ga0495661_0000016 3300046665 Bacteria 213593
372 Ga0495669_0000269 3300046684 Bacteria 29811
373 Ga0495669_0034049 3300046684 Bacteria 2244
374 Ga0495669_0130119 3300046684 Bacteria 1184
375 Ga0495671_0206338 3300046692 Bacteria 952
376 Ga0495649_0000030 3300046694 Bacteria 152164
377 Ga0495589_0000246 3300046794 Bacteria 44673
378 Ga0495660_0027129 3300046810 Bacteria 3240
379 Ga0495672_0000292 3300047320 Bacteria 69008
380 Ga0495672_0003559 3300047320 Bacteria 13256
381 Ga0495683_0000092 3300047323 Bacteria 91056
382 Ga0495687_002072 3300047443 Bacteria 16858
383 Ga0495679_000241 3300047446 Bacteria 45465
384 Ga0495685_066898 3300047447 Bacteria 1207
385 Ga0495673_0005253 3300047469 Bacteria 7866
386 Ga0495681_0035527 3300047470 Bacteria 2473
387 Ga0495686_0000550 3300047472 Bacteria 53672
388 Ga0495686_0054454 3300047472 Bacteria 2505
389 Ga0495686_0366045 3300047472 Bacteria 781
390 Ga0495686_0677342 3300047472 Bacteria 528
391 Ga0495626_0003882 3300048091 Bacteria 9372
392 Ga0496100_0005139 3300048903 Bacteria 7017
393 Ga0496100_0240101 3300048903 Bacteria 1336
394 Ga0496101_0027208 3300048904 Bacteria 3981
395 Ga0496102_0001484 3300048905 Bacteria 20725
396 Ga0496102_0167368 3300048905 Bacteria 2069
397 Ga0496102_0178333 3300048905 Bacteria 2001
398 Ga0496102_0399104 3300048905 Bacteria 1293
399 Ga0496103_0000111 3300048906 Bacteria 89596
400 Ga0496103_0426987 3300048906 Bacteria 851
401 Ga0496104_0005088 3300048907 Bacteria 11475
402 Ga0496105_0006966 3300048908 Bacteria 8709
403 Ga0496106_0037998 3300048909 Bacteria 3602
404 Ga0496106_0144335 3300048909 Bacteria 1874
405 Ga0496107_0286112 3300048910 Bacteria 1227
406 Ga0496107_1102491 3300048910 Bacteria 573
407 Ga0496108_0003893 3300048911 Bacteria 11988
408 Ga0496108_0022095 3300048911 Bacteria 5230
409 Ga0496108_1108993 3300048911 Bacteria 672
410 Ga0496109_0002880 3300048912 Bacteria 14401
411 Ga0496109_0046658 3300048912 Bacteria 3936
412 Ga0496109_0237705 3300048912 Bacteria 1714
413 Ga0496111_0621142 3300048914 Bacteria 790
414 Ga0496112_0003717 3300048915 Bacteria 12734
415 Ga0496112_0419941 3300048915 Bacteria 1276
416 Ga0496112_0867400 3300048915 Bacteria 826
417 Ga0496112_0946932 3300048915 Bacteria 782
418 Ga0496112_1296129 3300048915 Bacteria 644
419 Ga0496113_0000042 3300048916 Bacteria 53513
420 Ga0496113_0115471 3300048916 Bacteria 2094
421 Ga0496113_0231559 3300048916 Bacteria 1473
422 Ga0496114_0051132 3300048917 Bacteria 3440
423 Ga0496114_0758751 3300048917 Bacteria 848
424 Ga0496115_0103946 3300048918 Bacteria 2331
425 Ga0496116_0017586 3300048919 Bacteria 5542
426 Ga0496116_0036869 3300048919 Bacteria 3416
427 Ga0496116_0040950 3300048919 Bacteria 3184
428 Ga0496116_0104569 3300048919 Bacteria 1682
429 Ga0496116_0247704 3300048919 Bacteria 889
430 Ga0496117_0000414 3300048920 Bacteria 71876
431 Ga0496117_0006949 3300048920 Bacteria 11221
432 Ga0496117_0027635 3300048920 Bacteria 4414
433 Ga0496117_0222750 3300048920 Bacteria 1048
434 Ga0496117_0483760 3300048920 Bacteria 604
435 Ga0496117_0518743 3300048920 Bacteria 574
436 Ga0496118_0000901 3300048921 Bacteria 46540
437 Ga0496118_0006842 3300048921 Bacteria 12373
438 Ga0496118_0020431 3300048921 Bacteria 5872
439 Ga0496118_0024301 3300048921 Bacteria 5236
440 Ga0496118_0070633 3300048921 Bacteria 2520
441 Ga0496118_0323087 3300048921 Bacteria 836
442 Ga0496118_0361265 3300048921 Bacteria 769
443 Ga0496119_0000838 3300048922 Bacteria 40796
444 Ga0496119_0028662 3300048922 Bacteria 3793
445 Ga0496120_0006566 3300048923 Bacteria 8885
446 Ga0496120_0024469 3300048923 Bacteria 3765
447 Ga0496120_0076345 3300048923 Bacteria 1826
448 Ga0496120_0450757 3300048923 Bacteria 560
449 Ga0496121_0000072 3300048924 Bacteria 244975
450 Ga0496121_0000356 3300048924 Bacteria 94447
451 Ga0496121_0000600 3300048924 Bacteria 67818
452 Ga0496121_0000653 3300048924 Bacteria 64947
453 Ga0496121_0002248 3300048924 Bacteria 30091
454 Ga0496121_0003957 3300048924 Bacteria 20469
455 Ga0496121_0012732 3300048924 Bacteria 9119
456 Ga0496121_0044616 3300048924 Bacteria 3821
457 Ga0496121_0165870 3300048924 Bacteria 1610
458 Ga0496121_0201411 3300048924 Bacteria 1418
459 Ga0496121_0283558 3300048924 Bacteria 1132
460 Ga0496122_0000269 3300048925 Bacteria 116292
461 Ga0496122_0005009 3300048925 Bacteria 16023
462 Ga0496122_0020346 3300048925 Bacteria 6001
463 Ga0496122_0029888 3300048925 Bacteria 4581
464 Ga0496122_0054464 3300048925 Bacteria 3004
465 Ga0496123_0000712 3300048926 Bacteria 54440
466 Ga0496123_0002434 3300048926 Bacteria 23130
467 Ga0496123_0004617 3300048926 Bacteria 14324
468 Ga0496123_0004954 3300048926 Bacteria 13649
469 Ga0496123_0006377 3300048926 Bacteria 11449
470 Ga0496123_0017117 3300048926 Bacteria 5849
471 Ga0496124_0000110 3300048927 Bacteria 166321
472 Ga0496124_0001293 3300048927 Bacteria 37983
473 Ga0496124_0001811 3300048927 Bacteria 29573
474 Ga0496124_0079230 3300048927 Bacteria 2705
475 Ga0496125_0000229 3300048928 Bacteria 114537
476 Ga0496125_0002079 3300048928 Bacteria 26983
477 Ga0496125_0016849 3300048928 Bacteria 7000
478 Ga0496125_0027965 3300048928 Bacteria 5100
479 Ga0496125_0748107 3300048928 Bacteria 512
480 Ga0496126_0000219 3300048929 Bacteria 125157
481 Ga0496126_0001930 3300048929 Bacteria 29576
482 Ga0496126_0015060 3300048929 Bacteria 7794
483 Ga0496126_0015817 3300048929 Bacteria 7577
484 Ga0496126_0089368 3300048929 Bacteria 2712
485 Ga0495678_000021 3300049459 Bacteria 239150
486 Ga0495678_000234 3300049459 Bacteria 63308
487 Ga0495678_025797 3300049459 Bacteria 2519
488 Ga0501043_0072404 3300049579 Bacteria 2707
489 Ga0501047_1388977 3300049581 Bacteria 517
490 Ga0501067_0146106 3300049583 Bacteria 1317
491 Ga0501068_0061842 3300049584 Bacteria 2276
492 Ga0501069_0223039 3300049585 Bacteria 1096
493 Ga0501222_000325 3300049662 Bacteria 7504
494 Ga0501257_084424 3300049686 Bacteria 821
495 Ga0501044_0030400 3300049823 Bacteria 5693
496 nmdc:mga00v17_425755_c1 3300050491 Bacteria 862
497 nmdc:mga07m45_446147_c1 3300050496 Bacteria 750
498 nmdc:mga0sz30_14580_c1 3300050516 Bacteria 3096
499 Ga0500583_0035133 3300053092 Bacteria 2234
500 Ga0500595_048421 3300053119 Bacteria 1328
501 Ga0500607_239431 3300053121 Bacteria 735
502 Ga0500618_108526 3300053125 Bacteria 626
503 Ga0500658_0000051 3300053134 Bacteria 62135
504 Ga0500568_0001663 3300053139 Bacteria 13936
505 Ga0500590_000472 3300053148 Bacteria 13775
506 Ga0500616_0080822 3300053153 Bacteria 1634
507 Ga0500627_0036386 3300053158 Bacteria 2096
508 Ga0500636_0045489 3300053177 Bacteria 2589
509 Ga0500596_047747 3300053735 Bacteria 695
510 Ga0587066_063268 3300059490 Bacteria 761
511 Ga0587068_036094 3300059641 Bacteria 878
512 Ga0587069_046471 3300059642 Bacteria 758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100089557 Ga0070667_1000895575 135
2 3300009177 Ga0105248_10242747 Ga0105248_102427472 135
3 3300025941 Ga0207711_10170438 Ga0207711_101704382 135
4 3300025986 Ga0207658_10035471 Ga0207658_100354712 135
5 3300050496 nmdc:mga07m45_446147_c1 nmdc:mga07m45_446147_c1_94_534 135
6 3300050516 nmdc:mga0sz30_14580_c1 nmdc:mga0sz30_14580_c1_2512_2952 135
7 3300047443 Ga0495687_002072 Ga0495687_002072_9551_10009 136
8 3300025909 Ga0207705_10074150 Ga0207705_100741503 137
9 3300048905 Ga0496102_0178333 Ga0496102_0178333_887_1369 137
10 3300048915 Ga0496112_0867400 Ga0496112_0867400_244_726 137
11 3300005364 Ga0070673_100332713 Ga0070673_1003327132 138
12 3300005842 Ga0068858_100000310 Ga0068858_10000031054 138
13 3300013306 Ga0163162_11041418 Ga0163162_110414181 138
14 3300026035 Ga0207703_10000917 Ga0207703_1000091733 138
15 3300013100 Ga0157373_10001163 Ga0157373_1000116311 139
16 3300046474 Ga0495605_0000119 Ga0495605_0000119_29286_29726 139
17 3300048906 Ga0496103_0426987 Ga0496103_0426987_15_455 139
18 3300048919 Ga0496116_0017586 Ga0496116_0017586_2720_3160 139
19 3300048920 Ga0496117_0006949 Ga0496117_0006949_3973_4413 139
20 3300048921 Ga0496118_0323087 Ga0496118_0323087_364_804 139
21 3300048924 Ga0496121_0044616 Ga0496121_0044616_3308_3748 139
22 3300048925 Ga0496122_0054464 Ga0496122_0054464_1996_2436 139
23 3300048926 Ga0496123_0004617 Ga0496123_0004617_13435_13875 139
24 3300048927 Ga0496124_0001293 Ga0496124_0001293_23855_24295 139
25 3300046539 Ga0495621_0011850 Ga0495621_0011850_2226_2666 141
26 3300048910 Ga0496107_1102491 Ga0496107_1102491_52_522 142
27 iso_pu_bacteria 2738541275 2738712365 142
28 iso_pu_bacteria 2738541301 2738850790 142
29 iso_pu_bacteria 2738541304 2738866519 142
30 iso_pu_bacteria 2738543022 2739299037 142
31 iso_pu_bacteria 2738543033 2739360715 142
32 3300001904 JGI24736J21556_1048292 JGI24736J21556_10482921 143
33 3300003322 rootL2_10321619 rootL2_103216193 143
34 3300005330 Ga0070690_100001607 Ga0070690_10000160710 143
35 3300005331 Ga0070670_100082900 Ga0070670_1000829003 143
36 3300005335 Ga0070666_10000479 Ga0070666_1000047923 143
37 3300005335 Ga0070666_10041134 Ga0070666_100411343 143
38 3300005338 Ga0068868_100000635 Ga0068868_10000063523 143
39 3300005339 Ga0070660_100004200 Ga0070660_1000042009 143
40 3300005339 Ga0070660_100038884 Ga0070660_1000388843 143
41 3300005340 Ga0070689_100233340 Ga0070689_1002333402 143
42 3300005340 Ga0070689_101676395 Ga0070689_1016763951 143
43 3300005343 Ga0070687_100499913 Ga0070687_1004999131 143
44 3300005344 Ga0070661_100019603 Ga0070661_1000196035 143
45 3300005354 Ga0070675_100143279 Ga0070675_1001432792 143
46 3300005354 Ga0070675_100312855 Ga0070675_1003128552 143
47 3300005355 Ga0070671_100006910 Ga0070671_10000691011 143
48 3300005355 Ga0070671_100016603 Ga0070671_1000166032 143
49 3300005355 Ga0070671_100486842 Ga0070671_1004868421 143
50 3300005356 Ga0070674_100000246 Ga0070674_10000024619 143
51 3300005364 Ga0070673_100010066 Ga0070673_1000100665 143
52 3300005364 Ga0070673_100156831 Ga0070673_1001568312 143
53 3300005364 Ga0070673_100198270 Ga0070673_1001982702 143
54 3300005364 Ga0070673_100245457 Ga0070673_1002454572 143
55 3300005365 Ga0070688_100225628 Ga0070688_1002256282 143
56 3300005366 Ga0070659_100005094 Ga0070659_1000050945 143
57 3300005367 Ga0070667_100001121 Ga0070667_1000011216 143
58 3300005367 Ga0070667_100016694 Ga0070667_1000166946 143
59 3300005367 Ga0070667_100095796 Ga0070667_1000957962 143
60 3300005456 Ga0070678_100000187 Ga0070678_1000001872 143
61 3300005457 Ga0070662_100130023 Ga0070662_1001300233 143
62 3300005457 Ga0070662_100168073 Ga0070662_1001680732 143
63 3300005459 Ga0068867_100134612 Ga0068867_1001346123 143
64 3300005543 Ga0070672_100004299 Ga0070672_1000042995 143
65 3300005543 Ga0070672_100135447 Ga0070672_1001354472 143
66 3300005544 Ga0070686_101690383 Ga0070686_1016903831 143
67 3300005548 Ga0070665_100008625 Ga0070665_1000086255 143
68 3300005548 Ga0070665_100220573 Ga0070665_1002205732 143
69 3300005564 Ga0070664_102260646 Ga0070664_1022606461 143
70 3300005616 Ga0068852_100012931 Ga0068852_1000129312 143
71 3300005618 Ga0068864_100055595 Ga0068864_1000555952 143
72 3300005618 Ga0068864_100179977 Ga0068864_1001799773 143
73 3300005618 Ga0068864_100307583 Ga0068864_1003075832 143
74 3300005618 Ga0068864_101275321 Ga0068864_1012753212 143
75 3300005718 Ga0068866_10013963 Ga0068866_100139634 143
76 3300005834 Ga0068851_10112431 Ga0068851_101124312 143
77 3300005840 Ga0068870_11117047 Ga0068870_111170471 143
78 3300005841 Ga0068863_100022777 Ga0068863_1000227777 143
79 3300005841 Ga0068863_100489582 Ga0068863_1004895822 143
80 3300005842 Ga0068858_100000438 Ga0068858_10000043824 143
81 3300005842 Ga0068858_100006991 Ga0068858_1000069918 143
82 3300005843 Ga0068860_100327930 Ga0068860_1003279301 143
83 3300005843 Ga0068860_100452845 Ga0068860_1004528452 143
84 3300005844 Ga0068862_100109858 Ga0068862_1001098583 143
85 3300006237 Ga0097621_100048541 Ga0097621_1000485414 143
86 3300006237 Ga0097621_100171811 Ga0097621_1001718113 143
87 3300006237 Ga0097621_100217324 Ga0097621_1002173242 143
88 3300006358 Ga0068871_100071578 Ga0068871_1000715783 143
89 3300006931 Ga0097620_100111006 Ga0097620_1001110062 143
90 3300009098 Ga0105245_10075518 Ga0105245_100755182 143
91 3300009148 Ga0105243_10000077 Ga0105243_1000007796 143
92 3300009177 Ga0105248_10000119 Ga0105248_1000011933 143
93 3300009177 Ga0105248_10090684 Ga0105248_100906843 143
94 3300009177 Ga0105248_10171040 Ga0105248_101710402 143
95 3300009177 Ga0105248_10393913 Ga0105248_103939131 143
96 3300009553 Ga0105249_10158880 Ga0105249_101588804 143
97 3300013102 Ga0157371_10066794 Ga0157371_100667943 143
98 3300013296 Ga0157374_10015658 Ga0157374_100156587 143
99 3300013297 Ga0157378_10082984 Ga0157378_100829843 143
100 3300013306 Ga0163162_10021506 Ga0163162_100215068 143
101 3300013306 Ga0163162_10150550 Ga0163162_101505504 143
102 3300013308 Ga0157375_10032576 Ga0157375_100325762 143
103 3300013308 Ga0157375_10375570 Ga0157375_103755702 143
104 3300014325 Ga0163163_10003777 Ga0163163_1000377711 143
105 3300017792 Ga0163161_10047822 Ga0163161_100478222 143
106 3300025315 Ga0207697_10071765 Ga0207697_100717652 143
107 3300025899 Ga0207642_10023989 Ga0207642_100239892 143
108 3300025903 Ga0207680_10001352 Ga0207680_100013525 143
109 3300025903 Ga0207680_10005803 Ga0207680_100058038 143
110 3300025904 Ga0207647_10000447 Ga0207647_1000044714 143
111 3300025907 Ga0207645_10081372 Ga0207645_100813723 143
112 3300025909 Ga0207705_10000008 Ga0207705_10000008275 143
113 3300025919 Ga0207657_10000676 Ga0207657_100006768 143
114 3300025919 Ga0207657_10054451 Ga0207657_100544513 143
115 3300025920 Ga0207649_10229477 Ga0207649_102294772 143
116 3300025923 Ga0207681_10272175 Ga0207681_102721752 143
117 3300025925 Ga0207650_10085982 Ga0207650_100859823 143
118 3300025926 Ga0207659_10113360 Ga0207659_101133602 143
119 3300025931 Ga0207644_10003817 Ga0207644_100038177 143
120 3300025931 Ga0207644_10010505 Ga0207644_100105055 143
121 3300025931 Ga0207644_10014136 Ga0207644_100141364 143
122 3300025931 Ga0207644_11657622 Ga0207644_116576221 143
123 3300025932 Ga0207690_10007834 Ga0207690_100078348 143
124 3300025933 Ga0207706_10105371 Ga0207706_101053714 143
125 3300025935 Ga0207709_10000110 Ga0207709_1000011031 143
126 3300025936 Ga0207670_10838618 Ga0207670_108386182 143
127 3300025937 Ga0207669_10000015 Ga0207669_1000001537 143
128 3300025937 Ga0207669_10816877 Ga0207669_108168771 143
129 3300025940 Ga0207691_10006960 Ga0207691_100069606 143
130 3300025940 Ga0207691_10324640 Ga0207691_103246402 143
131 3300025941 Ga0207711_10000047 Ga0207711_1000004798 143
132 3300025941 Ga0207711_10020872 Ga0207711_100208722 143
133 3300025941 Ga0207711_10027260 Ga0207711_100272607 143
134 3300025941 Ga0207711_10037419 Ga0207711_100374197 143
135 3300025960 Ga0207651_10000205 Ga0207651_100002057 143
136 3300025960 Ga0207651_10010071 Ga0207651_100100716 143
137 3300025960 Ga0207651_10167043 Ga0207651_101670432 143
138 3300025961 Ga0207712_10097482 Ga0207712_100974821 143
139 3300025972 Ga0207668_10155036 Ga0207668_101550362 143
140 3300025986 Ga0207658_10011589 Ga0207658_100115892 143
141 3300025986 Ga0207658_10029634 Ga0207658_100296342 143
142 3300025986 Ga0207658_10083076 Ga0207658_100830762 143
143 3300026023 Ga0207677_10003084 Ga0207677_100030849 143
144 3300026035 Ga0207703_10009773 Ga0207703_100097733 143
145 3300026035 Ga0207703_10017621 Ga0207703_100176213 143
146 3300026088 Ga0207641_10007041 Ga0207641_1000704111 143
147 3300026088 Ga0207641_10319522 Ga0207641_103195222 143
148 3300026089 Ga0207648_10126269 Ga0207648_101262693 143
149 3300026095 Ga0207676_10083723 Ga0207676_100837233 143
150 3300026095 Ga0207676_10197717 Ga0207676_101977172 143
151 3300026095 Ga0207676_10307474 Ga0207676_103074742 143
152 3300026095 Ga0207676_11227794 Ga0207676_112277942 143
153 3300026095 Ga0207676_12082710 Ga0207676_120827101 143
154 3300026121 Ga0207683_10000954 Ga0207683_1000095437 143
155 3300026121 Ga0207683_10031689 Ga0207683_100316895 143
156 3300026121 Ga0207683_11090466 Ga0207683_110904661 143
157 3300026142 Ga0207698_10087405 Ga0207698_100874052 143
158 3300028379 Ga0268266_10022849 Ga0268266_100228497 143
159 3300028380 Ga0268265_10516453 Ga0268265_105164532 143
160 3300028381 Ga0268264_10414456 Ga0268264_104144561 143
161 3300028381 Ga0268264_11419343 Ga0268264_114193432 143
162 3300031548 Ga0307408_102001355 Ga0307408_1020013551 143
163 3300031852 Ga0307410_10020715 Ga0307410_100207158 143
164 3300031903 Ga0307407_10090146 Ga0307407_100901462 143
165 3300031995 Ga0307409_100060952 Ga0307409_1000609522 143
166 3300031995 Ga0307409_101401522 Ga0307409_1014015221 143
167 3300032004 Ga0307414_10117900 Ga0307414_101179002 143
168 3300032005 Ga0307411_10055509 Ga0307411_100555094 143
169 3300032005 Ga0307411_10074250 Ga0307411_100742502 143
170 3300032005 Ga0307411_12065523 Ga0307411_120655231 143
171 3300032126 Ga0307415_100078375 Ga0307415_1000783753 143
172 3300032126 Ga0307415_100136558 Ga0307415_1001365583 143
173 3300037312 Ga0395899_0335255 Ga0395899_0335255_491_976 143
174 3300037312 Ga0395899_0592458 Ga0395899_0592458_105_563 143
175 3300037418 Ga0395900_0101796 Ga0395900_0101796_1124_1609 143
176 3300037418 Ga0395900_0578306 Ga0395900_0578306_215_673 143
177 3300037466 Ga0395898_0092215 Ga0395898_0092215_1342_1827 143
178 3300037471 Ga0395905_0002182 Ga0395905_0002182_2074_2559 143
179 3300037471 Ga0395905_0056128 Ga0395905_0056128_2943_3401 143
180 3300037471 Ga0395905_0789010 Ga0395905_0789010_93_551 143
181 3300037471 Ga0395905_1339783 Ga0395905_1339783_126_584 143
182 3300038443 Ga0395901_0011294 Ga0395901_0011294_1529_2014 143
183 3300038443 Ga0395901_0048402 Ga0395901_0048402_208_684 143
184 3300039450 Ga0436363_0572110 Ga0436363_0572110_220_687 143
185 3300046616 Ga0495668_0195554 Ga0495668_0195554_535_999 143
186 3300046660 Ga0495625_0020685 Ga0495625_0020685_2035_2514 143
187 3300046684 Ga0495669_0000269 Ga0495669_0000269_16439_16897 143
188 3300046684 Ga0495669_0034049 Ga0495669_0034049_513_971 143
189 3300046684 Ga0495669_0130119 Ga0495669_0130119_636_1094 143
190 3300047447 Ga0495685_066898 Ga0495685_066898_231_689 143
191 3300047472 Ga0495686_0366045 Ga0495686_0366045_32_490 143
192 3300048903 Ga0496100_0005139 Ga0496100_0005139_3751_4209 143
193 3300048904 Ga0496101_0027208 Ga0496101_0027208_2131_2589 143
194 3300048905 Ga0496102_0167368 Ga0496102_0167368_766_1224 143
195 3300048909 Ga0496106_0037998 Ga0496106_0037998_1595_2053 143
196 3300048910 Ga0496107_0286112 Ga0496107_0286112_297_785 143
197 3300048911 Ga0496108_0022095 Ga0496108_0022095_1295_1753 143
198 3300048912 Ga0496109_0002880 Ga0496109_0002880_3127_3585 143
199 3300048912 Ga0496109_0046658 Ga0496109_0046658_2271_2726 143
200 3300048912 Ga0496109_0237705 Ga0496109_0237705_271_750 143
201 3300048914 Ga0496111_0621142 Ga0496111_0621142_298_759 143
202 3300048915 Ga0496112_0003717 Ga0496112_0003717_5613_6071 143
203 3300048915 Ga0496112_0946932 Ga0496112_0946932_132_611 143
204 3300048915 Ga0496112_1296129 Ga0496112_1296129_111_569 143
205 3300048916 Ga0496113_0115471 Ga0496113_0115471_955_1434 143
206 3300048916 Ga0496113_0231559 Ga0496113_0231559_344_802 143
207 3300048917 Ga0496114_0051132 Ga0496114_0051132_1307_1765 143
208 3300048918 Ga0496115_0103946 Ga0496115_0103946_1602_2060 143
209 3300048921 Ga0496118_0070633 Ga0496118_0070633_1778_2245 143
210 3300048925 Ga0496122_0005009 Ga0496122_0005009_52_531 143
211 3300048926 Ga0496123_0017117 Ga0496123_0017117_1441_1920 143
212 3300048928 Ga0496125_0000229 Ga0496125_0000229_18665_19144 143
213 3300049583 Ga0501067_0146106 Ga0501067_0146106_402_860 143
214 3300049584 Ga0501068_0061842 Ga0501068_0061842_619_1077 143
215 3300049585 Ga0501069_0223039 Ga0501069_0223039_614_1072 143
216 3300050491 nmdc:mga00v17_425755_c1 nmdc:mga00v17_425755_c1_339_797 143
217 3300053134 Ga0500658_0000051 Ga0500658_0000051_19822_20286 143
218 3300053158 Ga0500627_0036386 Ga0500627_0036386_1065_1523 143
219 3300059490 Ga0587066_063268 Ga0587066_063268_20_496 143
220 3300059641 Ga0587068_036094 Ga0587068_036094_160_636 143
221 3300059642 Ga0587069_046471 Ga0587069_046471_184_660 143
222 iso_pu_bacteria 2884960567 2884961776 143
223 3300003320 rootH2_10065310 rootH2_1006531012 144
224 3300005338 Ga0068868_101650346 Ga0068868_1016503461 144
225 3300005356 Ga0070674_100138505 Ga0070674_1001385053 144
226 3300005457 Ga0070662_101124767 Ga0070662_1011247672 144
227 3300005459 Ga0068867_100604870 Ga0068867_1006048702 144
228 3300005543 Ga0070672_100630132 Ga0070672_1006301322 144
229 3300005718 Ga0068866_10633747 Ga0068866_106337472 144
230 3300006237 Ga0097621_101760654 Ga0097621_1017606541 144
231 3300006881 Ga0068865_101147267 Ga0068865_1011472671 144
232 3300009098 Ga0105245_10435056 Ga0105245_104350562 144
233 3300009176 Ga0105242_10060071 Ga0105242_100600712 144
234 3300009553 Ga0105249_10008812 Ga0105249_100088129 144
235 3300013306 Ga0163162_10648031 Ga0163162_106480312 144
236 3300025233 Ga0209437_105693 Ga0209437_1056932 144
237 3300025261 Ga0209233_1000213 Ga0209233_100021372 144
238 3300031731 Ga0307405_10018176 Ga0307405_100181764 144
239 3300031911 Ga0307412_10148740 Ga0307412_101487402 144
240 3300032002 Ga0307416_100001205 Ga0307416_1000012053 144
241 3300032005 Ga0307411_10779360 Ga0307411_107793602 144
242 3300032126 Ga0307415_100202805 Ga0307415_1002028052 144
243 3300039447 Ga0436361_0850351 Ga0436361_0850351_1423_1950 144
244 3300048924 Ga0496121_0000653 Ga0496121_0000653_2514_2975 144
245 iso_pu_bacteria 2808606377 2808929793 144
246 iso_pu_bacteria 2808606381 2808952132 144
247 iso_pu_bacteria 2808606382 2808961698 144
248 iso_pu_bacteria 2842815866 2842819875 144
249 3300005289 Ga0065704_10090137 Ga0065704_100901373 145
250 3300005295 Ga0065707_10120005 Ga0065707_101200051 145
251 3300005440 Ga0070705_100096093 Ga0070705_1000960931 145
252 3300005456 Ga0070678_100088587 Ga0070678_1000885874 145
253 3300005458 Ga0070681_11403643 Ga0070681_114036431 145
254 3300005530 Ga0070679_101599606 Ga0070679_1015996061 145
255 3300005843 Ga0068860_100144614 Ga0068860_1001446143 145
256 3300009011 Ga0105251_10052904 Ga0105251_100529043 145
257 3300009177 Ga0105248_10006802 Ga0105248_100068025 145
258 3300009177 Ga0105248_10372960 Ga0105248_103729601 145
259 3300009551 Ga0105238_10538715 Ga0105238_105387153 145
260 3300013306 Ga0163162_10000793 Ga0163162_100007939 145
261 3300025735 Ga0207713_1165659 Ga0207713_11656591 145
262 3300025903 Ga0207680_10027983 Ga0207680_100279835 145
263 3300025941 Ga0207711_10052190 Ga0207711_100521903 145
264 3300025942 Ga0207689_10755109 Ga0207689_107551091 145
265 3300026121 Ga0207683_10109620 Ga0207683_101096202 145
266 3300026121 Ga0207683_10353357 Ga0207683_103533572 145
267 3300028381 Ga0268264_10015982 Ga0268264_100159827 145
268 3300046453 Ga0495627_053343 Ga0495627_053343_69_515 145
269 3300046458 Ga0495591_017335 Ga0495591_017335_393_839 145
270 3300046471 Ga0495650_0003769 Ga0495650_0003769_8913_9359 145
271 3300046474 Ga0495605_0000033 Ga0495605_0000033_166093_166539 145
272 3300046499 Ga0495594_0005312 Ga0495594_0005312_1576_2022 145
273 3300046506 Ga0495583_0000031 Ga0495583_0000031_74954_75400 145
274 3300046512 Ga0495610_0022393 Ga0495610_0022393_2316_2762 145
275 3300046515 Ga0495620_0000038 Ga0495620_0000038_104762_105208 145
276 3300046518 Ga0495631_0000969 Ga0495631_0000969_151_597 145
277 3300046520 Ga0495637_0020492 Ga0495637_0020492_638_1084 145
278 3300046530 Ga0495654_0023230 Ga0495654_0023230_2205_2651 145
279 3300046538 Ga0495609_0000018 Ga0495609_0000018_265825_266271 145
280 3300046542 Ga0495597_0004117 Ga0495597_0004117_5410_5856 145
281 3300046558 Ga0495633_0000062 Ga0495633_0000062_69841_70287 145
282 3300046648 Ga0495611_0032538 Ga0495611_0032538_1345_1791 145
283 3300046660 Ga0495625_0001696 Ga0495625_0001696_16478_16957 145
284 3300046665 Ga0495661_0000016 Ga0495661_0000016_150810_151256 145
285 3300046692 Ga0495671_0206338 Ga0495671_0206338_285_731 145
286 3300046794 Ga0495589_0000246 Ga0495589_0000246_1937_2383 145
287 3300046810 Ga0495660_0027129 Ga0495660_0027129_1217_1663 145
288 3300047323 Ga0495683_0000092 Ga0495683_0000092_88478_88924 145
289 3300047446 Ga0495679_000241 Ga0495679_000241_42887_43333 145
290 3300047469 Ga0495673_0005253 Ga0495673_0005253_6044_6490 145
291 3300047470 Ga0495681_0035527 Ga0495681_0035527_844_1290 145
292 3300047472 Ga0495686_0677342 Ga0495686_0677342_60_506 145
293 3300048919 Ga0496116_0104569 Ga0496116_0104569_45_530 145
294 3300048920 Ga0496117_0027635 Ga0496117_0027635_2512_2997 145
295 3300048921 Ga0496118_0020431 Ga0496118_0020431_4248_4733 145
296 3300048922 Ga0496119_0028662 Ga0496119_0028662_770_1255 145
297 3300048923 Ga0496120_0024469 Ga0496120_0024469_808_1254 145
298 3300048924 Ga0496121_0000600 Ga0496121_0000600_20803_21288 145
299 3300048924 Ga0496121_0283558 Ga0496121_0283558_154_600 145
300 3300048925 Ga0496122_0020346 Ga0496122_0020346_1951_2397 145
301 3300048925 Ga0496122_0029888 Ga0496122_0029888_2112_2558 145
302 3300048926 Ga0496123_0002434 Ga0496123_0002434_19243_19689 145
303 3300048926 Ga0496123_0004954 Ga0496123_0004954_5587_6033 145
304 3300049459 Ga0495678_000021 Ga0495678_000021_168506_168952 145
305 3300053125 Ga0500618_108526 Ga0500618_108526_93_539 145
306 iso_pu_bacteria 2515154123 2515688268 145
307 2162886007 SwRhRL2b_contig_1793279 SwRhRL2b_0038.00008910 146
308 2162886007 SwRhRL2b_contig_3665959 SwRhRL2b_0394.00007230 146
309 2162886007 SwRhRL2b_contig_875286 SwRhRL2b_0807.00001640 146
310 3300001904 JGI24736J21556_1001357 JGI24736J21556_10013574 146
311 3300001979 JGI24740J21852_10067811 JGI24740J21852_100678112 146
312 3300001989 JGI24739J22299_10014380 JGI24739J22299_100143802 146
313 3300001989 JGI24739J22299_10027977 JGI24739J22299_100279772 146
314 3300001990 JGI24737J22298_10072303 JGI24737J22298_100723031 146
315 3300002067 JGI24735J21928_10006833 JGI24735J21928_100068333 146
316 3300003771 Ga0055526_1003911 Ga0055526_10039112 146
317 3300005289 Ga0065704_10001975 Ga0065704_1000197515 146
318 3300005289 Ga0065704_10072411 Ga0065704_100724116 146
319 3300005289 Ga0065704_10094279 Ga0065704_100942793 146
320 3300005327 Ga0070658_11100512 Ga0070658_111005121 146
321 3300005339 Ga0070660_100009128 Ga0070660_1000091289 146
322 3300005339 Ga0070660_100563477 Ga0070660_1005634772 146
323 3300005347 Ga0070668_100005762 Ga0070668_1000057627 146
324 3300005347 Ga0070668_100015102 Ga0070668_1000151026 146
325 3300005353 Ga0070669_100002401 Ga0070669_1000024015 146
326 3300005353 Ga0070669_100331721 Ga0070669_1003317212 146
327 3300005355 Ga0070671_100354978 Ga0070671_1003549782 146
328 3300005366 Ga0070659_100036279 Ga0070659_1000362796 146
329 3300005367 Ga0070667_100017742 Ga0070667_1000177426 146
330 3300005367 Ga0070667_100540919 Ga0070667_1005409191 146
331 3300005367 Ga0070667_100576611 Ga0070667_1005766112 146
332 3300005441 Ga0070700_100555781 Ga0070700_1005557812 146
333 3300005457 Ga0070662_100021818 Ga0070662_1000218182 146
334 3300005539 Ga0068853_100278550 Ga0068853_1002785503 146
335 3300005548 Ga0070665_100022421 Ga0070665_1000224214 146
336 3300005548 Ga0070665_100065537 Ga0070665_1000655373 146
337 3300005548 Ga0070665_100168264 Ga0070665_1001682643 146
338 3300005563 Ga0068855_100192044 Ga0068855_1001920442 146
339 3300005563 Ga0068855_100586790 Ga0068855_1005867902 146
340 3300005563 Ga0068855_101917306 Ga0068855_1019173061 146
341 3300005577 Ga0068857_100030929 Ga0068857_1000309297 146
342 3300005578 Ga0068854_100143073 Ga0068854_1001430732 146
343 3300005578 Ga0068854_100721807 Ga0068854_1007218072 146
344 3300005614 Ga0068856_100014726 Ga0068856_1000147262 146
345 3300005614 Ga0068856_100346664 Ga0068856_1003466642 146
346 3300005616 Ga0068852_100064682 Ga0068852_1000646825 146
347 3300005841 Ga0068863_100017809 Ga0068863_1000178097 146
348 3300005841 Ga0068863_100388341 Ga0068863_1003883413 146
349 3300005843 Ga0068860_100051896 Ga0068860_1000518962 146
350 3300005844 Ga0068862_100016278 Ga0068862_1000162785 146
351 3300005844 Ga0068862_100133785 Ga0068862_1001337852 146
352 3300005844 Ga0068862_100180026 Ga0068862_1001800262 146
353 3300006880 Ga0075429_100286166 Ga0075429_1002861664 146
354 3300009011 Ga0105251_10212572 Ga0105251_102125721 146
355 3300009092 Ga0105250_10006080 Ga0105250_100060804 146
356 3300009093 Ga0105240_10000206 Ga0105240_100002063 146
357 3300009093 Ga0105240_10014310 Ga0105240_100143108 146
358 3300009101 Ga0105247_10122917 Ga0105247_101229172 146
359 3300009148 Ga0105243_10045805 Ga0105243_100458052 146
360 3300009177 Ga0105248_10012383 Ga0105248_100123834 146
361 3300009177 Ga0105248_10296514 Ga0105248_102965143 146
362 3300009545 Ga0105237_10001347 Ga0105237_1000134718 146
363 3300009553 Ga0105249_10353216 Ga0105249_103532162 146
364 3300010375 Ga0105239_10000113 Ga0105239_10000113137 146
365 3300010375 Ga0105239_10004322 Ga0105239_100043228 146
366 3300013102 Ga0157371_10290212 Ga0157371_102902121 146
367 3300013104 Ga0157370_10000176 Ga0157370_1000017665 146
368 3300013104 Ga0157370_10300236 Ga0157370_103002363 146
369 3300013105 Ga0157369_10053466 Ga0157369_100534663 146
370 3300013105 Ga0157369_10229679 Ga0157369_102296792 146
371 3300013306 Ga0163162_11597483 Ga0163162_115974831 146
372 3300013307 Ga0157372_11215970 Ga0157372_112159701 146
373 3300025231 Ga0207427_100436 Ga0207427_10043619 146
374 3300025250 Ga0209026_1001456 Ga0209026_10014565 146
375 3300025256 Ga0209759_1023813 Ga0209759_10238131 146
376 3300025261 Ga0209233_1000291 Ga0209233_100029158 146
377 3300025295 Ga0209564_1000670 Ga0209564_100067011 146
378 3300025298 Ga0209050_1001657 Ga0209050_100165721 146
379 3300025321 Ga0207656_10172730 Ga0207656_101727301 146
380 3300025711 Ga0207696_1003816 Ga0207696_10038168 146
381 3300025735 Ga0207713_1010826 Ga0207713_10108268 146
382 3300025735 Ga0207713_1038698 Ga0207713_10386981 146
383 3300025900 Ga0207710_10012934 Ga0207710_100129343 146
384 3300025904 Ga0207647_10015339 Ga0207647_100153392 146
385 3300025904 Ga0207647_10017721 Ga0207647_100177216 146
386 3300025904 Ga0207647_10139638 Ga0207647_101396382 146
387 3300025913 Ga0207695_10046718 Ga0207695_100467182 146
388 3300025913 Ga0207695_10072811 Ga0207695_100728118 146
389 3300025914 Ga0207671_10001107 Ga0207671_1000110717 146
390 3300025914 Ga0207671_10469146 Ga0207671_104691461 146
391 3300025914 Ga0207671_10905249 Ga0207671_109052491 146
392 3300025919 Ga0207657_10006429 Ga0207657_100064295 146
393 3300025919 Ga0207657_10258412 Ga0207657_102584123 146
394 3300025923 Ga0207681_10001728 Ga0207681_100017286 146
395 3300025923 Ga0207681_10341987 Ga0207681_103419872 146
396 3300025931 Ga0207644_10227048 Ga0207644_102270483 146
397 3300025932 Ga0207690_10038499 Ga0207690_100384992 146
398 3300025933 Ga0207706_10015188 Ga0207706_100151889 146
399 3300025935 Ga0207709_10014707 Ga0207709_100147072 146
400 3300025941 Ga0207711_10179823 Ga0207711_101798234 146
401 3300025949 Ga0207667_10139729 Ga0207667_101397292 146
402 3300025949 Ga0207667_10315477 Ga0207667_103154772 146
403 3300025972 Ga0207668_10005073 Ga0207668_100050736 146
404 3300025972 Ga0207668_10010874 Ga0207668_100108746 146
405 3300025972 Ga0207668_10021629 Ga0207668_100216293 146
406 3300025981 Ga0207640_10164699 Ga0207640_101646992 146
407 3300025981 Ga0207640_10630780 Ga0207640_106307802 146
408 3300025986 Ga0207658_10157189 Ga0207658_101571893 146
409 3300025986 Ga0207658_10882509 Ga0207658_108825092 146
410 3300026041 Ga0207639_10050993 Ga0207639_100509932 146
411 3300026067 Ga0207678_10707731 Ga0207678_107077312 146
412 3300026075 Ga0207708_10291811 Ga0207708_102918112 146
413 3300026078 Ga0207702_10006519 Ga0207702_100065199 146
414 3300026088 Ga0207641_10047342 Ga0207641_100473422 146
415 3300026116 Ga0207674_10431670 Ga0207674_104316702 146
416 3300026142 Ga0207698_10025031 Ga0207698_100250315 146
417 3300028379 Ga0268266_10022870 Ga0268266_100228703 146
418 3300028379 Ga0268266_10169223 Ga0268266_101692233 146
419 3300028380 Ga0268265_10010725 Ga0268265_100107257 146
420 3300028380 Ga0268265_10142153 Ga0268265_101421531 146
421 3300028380 Ga0268265_10162816 Ga0268265_101628162 146
422 3300028380 Ga0268265_10804836 Ga0268265_108048362 146
423 3300028381 Ga0268264_10034353 Ga0268264_100343534 146
424 3300031548 Ga0307408_100005457 Ga0307408_1000054577 146
425 3300031852 Ga0307410_10147107 Ga0307410_101471072 146
426 3300031901 Ga0307406_11055236 Ga0307406_110552361 146
427 3300031911 Ga0307412_10003194 Ga0307412_100031942 146
428 3300031911 Ga0307412_10010732 Ga0307412_100107326 146
429 3300031911 Ga0307412_10060156 Ga0307412_100601563 146
430 3300031995 Ga0307409_100309521 Ga0307409_1003095212 146
431 3300032002 Ga0307416_100813351 Ga0307416_1008133512 146
432 3300035111 Ga0373923_0200539 Ga0373923_0200539_179_631 146
433 3300037312 Ga0395899_0006882 Ga0395899_0006882_2070_2537 146
434 3300037418 Ga0395900_0117624 Ga0395900_0117624_1598_2065 146
435 3300037466 Ga0395898_0893651 Ga0395898_0893651_53_520 146
436 3300041405 Ga0439438_009321 Ga0439438_009321_1661_2134 146
437 3300041405 Ga0439438_049690 Ga0439438_049690_317_790 146
438 3300041407 Ga0439447_014661 Ga0439447_014661_1137_1610 146
439 3300041407 Ga0439447_038392 Ga0439447_038392_413_886 146
440 3300041411 Ga0439466_0000502 Ga0439466_0000502_8434_8907 146
441 3300042005 Ga0439448_0036751 Ga0439448_0036751_22_567 146
442 3300042006 Ga0439432_000094 Ga0439432_000094_27839_28312 146
443 3300042012 Ga0439455_0057445 Ga0439455_0057445_463_1008 146
444 3300042127 Ga0450890_064093 Ga0450890_064093_16_489 146
445 3300042156 Ga0439446_0247561 Ga0439446_0247561_14_487 146
446 3300042157 Ga0439458_0002046 Ga0439458_0002046_663_1208 146
447 3300044765 Ga0466970_0280109 Ga0466970_0280109_286_762 146
448 3300046474 Ga0495605_0003643 Ga0495605_0003643_5432_5905 146
449 3300046491 Ga0495584_0001222 Ga0495584_0001222_3851_4324 146
450 3300046507 Ga0495606_0147793 Ga0495606_0147793_644_1105 146
451 3300046519 Ga0495632_0320546 Ga0495632_0320546_33_485 146
452 3300046522 Ga0495643_0004076 Ga0495643_0004076_5285_5758 146
453 3300046558 Ga0495633_0011529 Ga0495633_0011529_137_610 146
454 3300046694 Ga0495649_0000030 Ga0495649_0000030_122864_123337 146
455 3300047320 Ga0495672_0000292 Ga0495672_0000292_43174_43647 146
456 3300047320 Ga0495672_0003559 Ga0495672_0003559_11743_12216 146
457 3300047472 Ga0495686_0000550 Ga0495686_0000550_48601_49053 146
458 3300047472 Ga0495686_0054454 Ga0495686_0054454_2009_2455 146
459 3300048091 Ga0495626_0003882 Ga0495626_0003882_5172_5645 146
460 3300048903 Ga0496100_0240101 Ga0496100_0240101_495_959 146
461 3300048905 Ga0496102_0001484 Ga0496102_0001484_13938_14402 146
462 3300048905 Ga0496102_0399104 Ga0496102_0399104_56_535 146
463 3300048906 Ga0496103_0000111 Ga0496103_0000111_32633_33097 146
464 3300048907 Ga0496104_0005088 Ga0496104_0005088_5458_5922 146
465 3300048908 Ga0496105_0006966 Ga0496105_0006966_2162_2626 146
466 3300048909 Ga0496106_0144335 Ga0496106_0144335_1389_1835 146
467 3300048911 Ga0496108_0003893 Ga0496108_0003893_8300_8740 146
468 3300048911 Ga0496108_1108993 Ga0496108_1108993_159_605 146
469 3300048915 Ga0496112_0419941 Ga0496112_0419941_491_955 146
470 3300048916 Ga0496113_0000042 Ga0496113_0000042_31547_32011 146
471 3300048917 Ga0496114_0758751 Ga0496114_0758751_241_696 146
472 3300048919 Ga0496116_0036869 Ga0496116_0036869_2843_3307 146
473 3300048919 Ga0496116_0040950 Ga0496116_0040950_14_454 146
474 3300048919 Ga0496116_0247704 Ga0496116_0247704_373_837 146
475 3300048920 Ga0496117_0000414 Ga0496117_0000414_66960_67424 146
476 3300048920 Ga0496117_0222750 Ga0496117_0222750_172_636 146
477 3300048920 Ga0496117_0483760 Ga0496117_0483760_79_519 146
478 3300048920 Ga0496117_0518743 Ga0496117_0518743_45_494 146
479 3300048921 Ga0496118_0000901 Ga0496118_0000901_37085_37534 146
480 3300048921 Ga0496118_0006842 Ga0496118_0006842_11765_12229 146
481 3300048921 Ga0496118_0024301 Ga0496118_0024301_4312_4752 146
482 3300048921 Ga0496118_0361265 Ga0496118_0361265_145_609 146
483 3300048922 Ga0496119_0000838 Ga0496119_0000838_32625_33089 146
484 3300048923 Ga0496120_0006566 Ga0496120_0006566_6815_7279 146
485 3300048923 Ga0496120_0076345 Ga0496120_0076345_802_1314 146
486 3300048923 Ga0496120_0450757 Ga0496120_0450757_92_541 146
487 3300048924 Ga0496121_0000072 Ga0496121_0000072_212122_212583 146
488 3300048924 Ga0496121_0000356 Ga0496121_0000356_4535_4993 146
489 3300048924 Ga0496121_0002248 Ga0496121_0002248_26188_26640 146
490 3300048924 Ga0496121_0003957 Ga0496121_0003957_13866_14339 146
491 3300048924 Ga0496121_0012732 Ga0496121_0012732_2715_3155 146
492 3300048924 Ga0496121_0165870 Ga0496121_0165870_280_732 146
493 3300048924 Ga0496121_0201411 Ga0496121_0201411_145_609 146
494 3300048925 Ga0496122_0000269 Ga0496122_0000269_85646_86110 146
495 3300048926 Ga0496123_0000712 Ga0496123_0000712_24870_25334 146
496 3300048926 Ga0496123_0006377 Ga0496123_0006377_10577_11044 146
497 3300048927 Ga0496124_0000110 Ga0496124_0000110_145613_146080 146
498 3300048927 Ga0496124_0001811 Ga0496124_0001811_20844_21308 146
499 3300048927 Ga0496124_0079230 Ga0496124_0079230_647_1087 146
500 3300048928 Ga0496125_0002079 Ga0496125_0002079_6526_6990 146
501 3300048928 Ga0496125_0016849 Ga0496125_0016849_2327_2782 146
502 3300048928 Ga0496125_0027965 Ga0496125_0027965_1945_2403 146
503 3300048928 Ga0496125_0748107 Ga0496125_0748107_25_465 146
504 3300048929 Ga0496126_0000219 Ga0496126_0000219_39048_39512 146
505 3300048929 Ga0496126_0001930 Ga0496126_0001930_28222_28677 146
506 3300048929 Ga0496126_0015060 Ga0496126_0015060_853_1311 146
507 3300048929 Ga0496126_0015817 Ga0496126_0015817_258_698 146
508 3300048929 Ga0496126_0089368 Ga0496126_0089368_1979_2440 146
509 3300049459 Ga0495678_000234 Ga0495678_000234_34497_34970 146
510 3300049459 Ga0495678_025797 Ga0495678_025797_436_909 146
511 3300049579 Ga0501043_0072404 Ga0501043_0072404_1235_1690 146
512 3300049581 Ga0501047_1388977 Ga0501047_1388977_14_490 146
513 3300049662 Ga0501222_000325 Ga0501222_000325_6915_7388 146
514 3300049686 Ga0501257_084424 Ga0501257_084424_173_646 146
515 3300049823 Ga0501044_0030400 Ga0501044_0030400_1337_1792 146
516 3300053092 Ga0500583_0035133 Ga0500583_0035133_1327_1770 146
517 3300053119 Ga0500595_048421 Ga0500595_048421_736_1269 146
518 3300053121 Ga0500607_239431 Ga0500607_239431_239_688 146
519 3300053139 Ga0500568_0001663 Ga0500568_0001663_7185_7658 146
520 3300053148 Ga0500590_000472 Ga0500590_000472_10975_11430 146
521 3300053153 Ga0500616_0080822 Ga0500616_0080822_892_1344 146
522 3300053177 Ga0500636_0045489 Ga0500636_0045489_1851_2300 146
523 3300053735 Ga0500596_047747 Ga0500596_047747_71_526 146
524 iso_pu_bacteria 2816332133 2816470888 146
525 iso_pu_bacteria 2928531327 2928534941 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

37

128

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f9f-assembly1.cif.gz_A crystal structure of rig-i helicase-rd in complex with 24-mer blunt-end hairpin rna 0.4197 25 134
5f9f-assembly1.cif.gz_G crystal structure of rig-i helicase-rd in complex with 24-mer blunt-end hairpin rna 0.4087 25 135
4r5l-assembly1.cif.gz_A crystal structure of the dnak c-terminus (dnak-sbd-c) 0.3942 1 81
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.3886 13 130
8oir-assembly1.cif.gz_Aa 55s human mitochondrial ribosome with mtrf1 and p-site trna 0.3836 16 132
ID Description Score Start End Superfamily
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7305 20 133 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7269 21 144 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6676 15 132 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6628 28 127 1.20.120.550
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6563 7 133 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1G6RHJ0-F1-model_v4 deleted 0.9997 22 144
AF-A0A370X196-F1-model_v4 DoxX family protein 0.997 15 144 GO:0005886
AF-A0A3S0PRN6-F1-model_v4 DoxX family protein 0.9928 16 144 GO:0005886
AF-A0A4R1IQ19-F1-model_v4 deleted 0.9921 15 144
AF-W0VEU8-F1-model_v4 DoxX family protein 0.9918 11 144 GO:0005886

Feature Viewer

pLDDT pTM Quality
94.42 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map