F459228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 525 | 235 | 525 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100125095|Ga0070669_1001250951 |
| Length | 290 |
| Sequence | VGSASRLQFVGSAFRRTVQQGAPVSDTPHDAAVTYGSYLRIDELLALQQPRSEGPEHDELLFIIVHQVYELWFKELLHELDRVIRLLQDDESHRAQHTLKRILTVLKVLVAQLDILETMTPLEFLSFRARLEAASGFQSDQFRQIEFVLGAKAEAAIARFPPASRARAALTARFTEPTLWDAFLRYLSREGYAVPPEQLARDVTATVVPSPVIQDLLIGLYRRDAKNAELCERLVDLDEGIQEWRYRHVRMVERTIGSKAGTGGSSGAAYLRNTVGGNLFPDLWEIRARL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 141 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 158 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 174 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 175 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 178 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 179 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 232 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 96.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10006305 | 3300003203 | Bacteria | 5469 |
| 2 | Ga0065714_10085730 | 3300005288 | Bacteria | 2135 |
| 3 | Ga0065712_10067845 | 3300005290 | Bacteria | 26280 |
| 4 | Ga0065712_10092521 | 3300005290 | Bacteria | 2328 |
| 5 | Ga0065715_10007164 | 3300005293 | Unclassified | 4716 |
| 6 | Ga0065715_10115075 | 3300005293 | Bacteria | 2427 |
| 7 | Ga0065707_10098440 | 3300005295 | Bacteria | 3086 |
| 8 | Ga0065707_10315156 | 3300005295 | Bacteria | 977 |
| 9 | Ga0070676_10281937 | 3300005328 | Bacteria | 1120 |
| 10 | Ga0070690_100039002 | 3300005330 | Bacteria | 3000 |
| 11 | Ga0070690_100092726 | 3300005330 | Bacteria | 1992 |
| 12 | Ga0070690_100327381 | 3300005330 | Bacteria | 1106 |
| 13 | Ga0070670_100063953 | 3300005331 | Bacteria | 3157 |
| 14 | Ga0070677_10054821 | 3300005333 | Bacteria | 1625 |
| 15 | Ga0068869_100364433 | 3300005334 | Bacteria | 1181 |
| 16 | Ga0068869_100429028 | 3300005334 | Bacteria | 1092 |
| 17 | Ga0070680_100091660 | 3300005336 | Bacteria | 2516 |
| 18 | Ga0068868_100058567 | 3300005338 | Bacteria | 3045 |
| 19 | Ga0068868_100169667 | 3300005338 | Bacteria | 1806 |
| 20 | Ga0068868_100203706 | 3300005338 | Bacteria | 1651 |
| 21 | Ga0070689_100054379 | 3300005340 | Bacteria | 3099 |
| 22 | Ga0070689_100094527 | 3300005340 | Bacteria | 2360 |
| 23 | Ga0070689_100251710 | 3300005340 | Bacteria | 1458 |
| 24 | Ga0070689_100336924 | 3300005340 | Bacteria | 1263 |
| 25 | Ga0070691_10004293 | 3300005341 | Bacteria | 6474 |
| 26 | Ga0070687_100003395 | 3300005343 | Bacteria | 6183 |
| 27 | Ga0070687_100007844 | 3300005343 | Bacteria | 4485 |
| 28 | Ga0070687_100055176 | 3300005343 | Bacteria | 2074 |
| 29 | Ga0070692_10030212 | 3300005345 | Bacteria | 2708 |
| 30 | Ga0070668_100780688 | 3300005347 | Bacteria | 847 |
| 31 | Ga0070669_100118510 | 3300005353 | Bacteria | 2016 |
| 32 | Ga0070669_100125095 | 3300005353 | Bacteria | 1966 |
| 33 | Ga0070669_100158676 | 3300005353 | Bacteria | 1756 |
| 34 | Ga0070675_100000179 | 3300005354 | Bacteria | 39545 |
| 35 | Ga0070675_100006593 | 3300005354 | Bacteria | 8923 |
| 36 | Ga0070675_100034264 | 3300005354 | Bacteria | 4120 |
| 37 | Ga0070675_100039245 | 3300005354 | Bacteria | 3863 |
| 38 | Ga0070675_100071309 | 3300005354 | Bacteria | 2882 |
| 39 | Ga0070674_100001365 | 3300005356 | Bacteria | 12895 |
| 40 | Ga0070673_100134835 | 3300005364 | Bacteria | 2077 |
| 41 | Ga0070673_100150306 | 3300005364 | Bacteria | 1972 |
| 42 | Ga0070673_100291709 | 3300005364 | Bacteria | 1434 |
| 43 | Ga0070673_100598143 | 3300005364 | Bacteria | 1006 |
| 44 | Ga0070688_100009438 | 3300005365 | Bacteria | 5337 |
| 45 | Ga0070688_100047973 | 3300005365 | Bacteria | 2652 |
| 46 | Ga0070667_100003115 | 3300005367 | Bacteria | 14253 |
| 47 | Ga0070701_10008286 | 3300005438 | Bacteria | 4489 |
| 48 | Ga0070701_10085993 | 3300005438 | Bacteria | 1713 |
| 49 | Ga0070711_100351494 | 3300005439 | Bacteria | 1185 |
| 50 | Ga0070705_100003426 | 3300005440 | Bacteria | 7778 |
| 51 | Ga0070700_100123902 | 3300005441 | Bacteria | 1735 |
| 52 | Ga0070694_100061506 | 3300005444 | Bacteria | 2563 |
| 53 | Ga0070694_100136978 | 3300005444 | Bacteria | 1775 |
| 54 | Ga0070694_100301039 | 3300005444 | Bacteria | 1229 |
| 55 | Ga0070708_100545999 | 3300005445 | Bacteria | 1093 |
| 56 | Ga0070708_100631144 | 3300005445 | Bacteria | 1010 |
| 57 | Ga0070663_100549849 | 3300005455 | Bacteria | 965 |
| 58 | Ga0070662_100484064 | 3300005457 | Bacteria | 1030 |
| 59 | Ga0070681_10702895 | 3300005458 | Bacteria | 927 |
| 60 | Ga0068867_100000594 | 3300005459 | Bacteria | 23939 |
| 61 | Ga0068867_100068389 | 3300005459 | Bacteria | 2651 |
| 62 | Ga0068867_100304923 | 3300005459 | Bacteria | 1314 |
| 63 | Ga0068867_100395087 | 3300005459 | Bacteria | 1165 |
| 64 | Ga0070685_10231851 | 3300005466 | Bacteria | 1215 |
| 65 | Ga0070706_100077239 | 3300005467 | Bacteria | 3082 |
| 66 | Ga0070707_100038969 | 3300005468 | Bacteria | 4541 |
| 67 | Ga0070707_100046186 | 3300005468 | Bacteria | 4168 |
| 68 | Ga0070707_100056411 | 3300005468 | Bacteria | 3768 |
| 69 | Ga0070707_100540911 | 3300005468 | Bacteria | 1127 |
| 70 | Ga0070698_100002373 | 3300005471 | Bacteria | 20779 |
| 71 | Ga0070699_100000753 | 3300005518 | Bacteria | 29961 |
| 72 | Ga0070699_100001411 | 3300005518 | Bacteria | 22076 |
| 73 | Ga0070699_100149510 | 3300005518 | Bacteria | 2065 |
| 74 | Ga0070684_100177056 | 3300005535 | Bacteria | 1938 |
| 75 | Ga0070684_100372915 | 3300005535 | Bacteria | 1314 |
| 76 | Ga0070672_100196376 | 3300005543 | Bacteria | 1686 |
| 77 | Ga0070672_100228457 | 3300005543 | Bacteria | 1563 |
| 78 | Ga0070672_100308847 | 3300005543 | Bacteria | 1342 |
| 79 | Ga0070686_100000738 | 3300005544 | Bacteria | 18935 |
| 80 | Ga0070686_100100327 | 3300005544 | Bacteria | 1954 |
| 81 | Ga0070686_100102003 | 3300005544 | Unclassified | 1940 |
| 82 | Ga0070695_100400251 | 3300005545 | Bacteria | 1041 |
| 83 | Ga0070696_100002025 | 3300005546 | Bacteria | 13300 |
| 84 | Ga0070696_100002689 | 3300005546 | Bacteria | 11784 |
| 85 | Ga0070696_100111560 | 3300005546 | Bacteria | 1970 |
| 86 | Ga0070696_100467734 | 3300005546 | Bacteria | 998 |
| 87 | Ga0070665_100003704 | 3300005548 | Bacteria | 16190 |
| 88 | Ga0070665_100018511 | 3300005548 | Bacteria | 6980 |
| 89 | Ga0070665_100345130 | 3300005548 | Bacteria | 1494 |
| 90 | Ga0070704_100002640 | 3300005549 | Bacteria | 10118 |
| 91 | Ga0070704_100004329 | 3300005549 | Bacteria | 8207 |
| 92 | Ga0070704_100112961 | 3300005549 | Bacteria | 2071 |
| 93 | Ga0068855_100491325 | 3300005563 | Bacteria | 1335 |
| 94 | Ga0068857_100357087 | 3300005577 | Bacteria | 1354 |
| 95 | Ga0068854_100041462 | 3300005578 | Bacteria | 3253 |
| 96 | Ga0068854_100085197 | 3300005578 | Bacteria | 2340 |
| 97 | Ga0070702_100008666 | 3300005615 | Bacteria | 4938 |
| 98 | Ga0068859_100006905 | 3300005617 | Bacteria | 11524 |
| 99 | Ga0068859_100012855 | 3300005617 | Bacteria | 8408 |
| 100 | Ga0068859_100520456 | 3300005617 | Bacteria | 1284 |
| 101 | Ga0068864_100062807 | 3300005618 | Bacteria | 3218 |
| 102 | Ga0068866_10133736 | 3300005718 | Bacteria | 1414 |
| 103 | Ga0068861_100001719 | 3300005719 | Bacteria | 14042 |
| 104 | Ga0068861_100030480 | 3300005719 | Bacteria | 3953 |
| 105 | Ga0068861_100139517 | 3300005719 | Bacteria | 1977 |
| 106 | Ga0068870_10009526 | 3300005840 | Bacteria | 4425 |
| 107 | Ga0068863_100006722 | 3300005841 | Bacteria | 11274 |
| 108 | Ga0068863_100556210 | 3300005841 | Bacteria | 1133 |
| 109 | Ga0068858_100001376 | 3300005842 | Bacteria | 25081 |
| 110 | Ga0068858_100016744 | 3300005842 | Bacteria | 6884 |
| 111 | Ga0068858_100136441 | 3300005842 | Bacteria | 2302 |
| 112 | Ga0068860_100013745 | 3300005843 | Bacteria | 7938 |
| 113 | Ga0068860_100069683 | 3300005843 | Bacteria | 3343 |
| 114 | Ga0068860_100242929 | 3300005843 | Bacteria | 1752 |
| 115 | Ga0068862_100000554 | 3300005844 | Bacteria | 39072 |
| 116 | Ga0068862_100010498 | 3300005844 | Bacteria | 7649 |
| 117 | Ga0068862_100492929 | 3300005844 | Bacteria | 1162 |
| 118 | Ga0081538_10039360 | 3300005981 | Bacteria | 3033 |
| 119 | Ga0081539_10000535 | 3300005985 | Bacteria | 78890 |
| 120 | Ga0081539_10003673 | 3300005985 | Bacteria | 18392 |
| 121 | Ga0081539_10071960 | 3300005985 | Bacteria | 1850 |
| 122 | Ga0075432_10090732 | 3300006058 | Bacteria | 1118 |
| 123 | Ga0075427_10022434 | 3300006194 | Bacteria | 1008 |
| 124 | Ga0075366_10050057 | 3300006195 | Bacteria | 2480 |
| 125 | Ga0075366_10075968 | 3300006195 | Bacteria | 2004 |
| 126 | Ga0097621_100083241 | 3300006237 | Bacteria | 2666 |
| 127 | Ga0097621_100137992 | 3300006237 | Bacteria | 2082 |
| 128 | Ga0097621_100384733 | 3300006237 | Bacteria | 1254 |
| 129 | Ga0068871_100002872 | 3300006358 | Bacteria | 11810 |
| 130 | Ga0068871_100314801 | 3300006358 | Bacteria | 1377 |
| 131 | Ga0068871_100456636 | 3300006358 | Bacteria | 1146 |
| 132 | Ga0075428_100004797 | 3300006844 | Bacteria | 14992 |
| 133 | Ga0075428_100022970 | 3300006844 | Bacteria | 6903 |
| 134 | Ga0075428_100043206 | 3300006844 | Bacteria | 4954 |
| 135 | Ga0075428_100047355 | 3300006844 | Bacteria | 4723 |
| 136 | Ga0075428_100055639 | 3300006844 | Bacteria | 4335 |
| 137 | Ga0075428_100078356 | 3300006844 | Bacteria | 3607 |
| 138 | Ga0075428_100083210 | 3300006844 | Bacteria | 3491 |
| 139 | Ga0075428_100114242 | 3300006844 | Bacteria | 2941 |
| 140 | Ga0075428_100150797 | 3300006844 | Bacteria | 2525 |
| 141 | Ga0075430_100004000 | 3300006846 | Bacteria | 12430 |
| 142 | Ga0075430_100035928 | 3300006846 | Bacteria | 4202 |
| 143 | Ga0075430_100069036 | 3300006846 | Bacteria | 2965 |
| 144 | Ga0075430_100112338 | 3300006846 | Bacteria | 2271 |
| 145 | Ga0075430_100221724 | 3300006846 | Bacteria | 1569 |
| 146 | Ga0075430_100531520 | 3300006846 | Bacteria | 970 |
| 147 | Ga0075431_100013314 | 3300006847 | Bacteria | 8312 |
| 148 | Ga0075431_100022918 | 3300006847 | Bacteria | 6382 |
| 149 | Ga0075431_100111164 | 3300006847 | Bacteria | 2828 |
| 150 | Ga0075431_100475572 | 3300006847 | Bacteria | 1243 |
| 151 | Ga0075431_100555562 | 3300006847 | Bacteria | 1135 |
| 152 | Ga0075433_10000108 | 3300006852 | Bacteria | 40852 |
| 153 | Ga0075433_10001967 | 3300006852 | Bacteria | 15444 |
| 154 | Ga0075433_10021911 | 3300006852 | Bacteria | 5361 |
| 155 | Ga0075433_10025867 | 3300006852 | Bacteria | 4964 |
| 156 | Ga0075433_10027375 | 3300006852 | Bacteria | 4835 |
| 157 | Ga0075433_10048737 | 3300006852 | Bacteria | 3685 |
| 158 | Ga0075433_10097770 | 3300006852 | Unclassified | 2598 |
| 159 | Ga0075433_10097917 | 3300006852 | Unclassified | 2596 |
| 160 | Ga0075433_10204864 | 3300006852 | Bacteria | 1754 |
| 161 | Ga0075433_10406465 | 3300006852 | Bacteria | 1201 |
| 162 | Ga0075434_100002237 | 3300006871 | Bacteria | 16907 |
| 163 | Ga0075434_100004749 | 3300006871 | Bacteria | 12294 |
| 164 | Ga0075434_100011544 | 3300006871 | Bacteria | 8335 |
| 165 | Ga0075434_100051020 | 3300006871 | Bacteria | 4110 |
| 166 | Ga0075434_100088906 | 3300006871 | Bacteria | 3091 |
| 167 | Ga0075434_100092236 | 3300006871 | Bacteria | 3031 |
| 168 | Ga0075429_100024224 | 3300006880 | Bacteria | 5265 |
| 169 | Ga0075429_100035146 | 3300006880 | Bacteria | 4357 |
| 170 | Ga0075429_100040041 | 3300006880 | Unclassified | 4079 |
| 171 | Ga0075429_100143830 | 3300006880 | Bacteria | 2087 |
| 172 | Ga0075429_100470933 | 3300006880 | Bacteria | 1101 |
| 173 | Ga0075429_100526398 | 3300006880 | Bacteria | 1036 |
| 174 | Ga0068865_100083606 | 3300006881 | Bacteria | 2298 |
| 175 | Ga0075436_100001777 | 3300006914 | Bacteria | 14787 |
| 176 | Ga0075436_100124226 | 3300006914 | Bacteria | 1807 |
| 177 | Ga0097620_100006905 | 3300006931 | Bacteria | 11524 |
| 178 | Ga0097620_100012855 | 3300006931 | Bacteria | 8408 |
| 179 | Ga0097620_100520471 | 3300006931 | Bacteria | 1284 |
| 180 | Ga0075435_100000001 | 3300007076 | Bacteria | 207579 |
| 181 | Ga0075435_100056313 | 3300007076 | Bacteria | 3178 |
| 182 | Ga0075435_100074012 | 3300007076 | Bacteria | 2786 |
| 183 | Ga0075435_100156707 | 3300007076 | Bacteria | 1916 |
| 184 | Ga0075435_100487550 | 3300007076 | Bacteria | 1065 |
| 185 | Ga0105240_10092216 | 3300009093 | Bacteria | 3699 |
| 186 | Ga0105240_10717267 | 3300009093 | Bacteria | 1090 |
| 187 | Ga0111539_10000057 | 3300009094 | Bacteria | 114860 |
| 188 | Ga0111539_10000716 | 3300009094 | Bacteria | 43096 |
| 189 | Ga0111539_10002028 | 3300009094 | Bacteria | 27050 |
| 190 | Ga0111539_10002648 | 3300009094 | Bacteria | 23735 |
| 191 | Ga0111539_10005632 | 3300009094 | Bacteria | 16197 |
| 192 | Ga0111539_10039744 | 3300009094 | Bacteria | 5668 |
| 193 | Ga0111539_10051926 | 3300009094 | Bacteria | 4881 |
| 194 | Ga0111539_10115757 | 3300009094 | Bacteria | 3143 |
| 195 | Ga0111539_10163313 | 3300009094 | Bacteria | 2605 |
| 196 | Ga0111539_10364443 | 3300009094 | Bacteria | 1682 |
| 197 | Ga0111539_10488650 | 3300009094 | Bacteria | 1434 |
| 198 | Ga0111539_10715740 | 3300009094 | Bacteria | 1165 |
| 199 | Ga0111539_10842732 | 3300009094 | Bacteria | 1067 |
| 200 | Ga0105245_10026541 | 3300009098 | Bacteria | 5099 |
| 201 | Ga0105245_10041928 | 3300009098 | Bacteria | 4081 |
| 202 | Ga0114129_10000428 | 3300009147 | Bacteria | 49983 |
| 203 | Ga0114129_10001744 | 3300009147 | Bacteria | 29582 |
| 204 | Ga0114129_10005185 | 3300009147 | Bacteria | 18350 |
| 205 | Ga0114129_10013146 | 3300009147 | Bacteria | 11794 |
| 206 | Ga0114129_10024509 | 3300009147 | Bacteria | 8548 |
| 207 | Ga0114129_10091866 | 3300009147 | Bacteria | 4204 |
| 208 | Ga0114129_10134143 | 3300009147 | Bacteria | 3398 |
| 209 | Ga0114129_10153920 | 3300009147 | Bacteria | 3146 |
| 210 | Ga0114129_10162336 | 3300009147 | Bacteria | 3051 |
| 211 | Ga0114129_10164284 | 3300009147 | Bacteria | 3031 |
| 212 | Ga0114129_10198387 | 3300009147 | Bacteria | 2720 |
| 213 | Ga0114129_10218788 | 3300009147 | Bacteria | 2571 |
| 214 | Ga0114129_10258379 | 3300009147 | Bacteria | 2336 |
| 215 | Ga0114129_10423349 | 3300009147 | Bacteria | 1751 |
| 216 | Ga0105243_10009456 | 3300009148 | Bacteria | 7425 |
| 217 | Ga0105241_10063516 | 3300009174 | Bacteria | 2849 |
| 218 | Ga0105242_10008576 | 3300009176 | Bacteria | 7848 |
| 219 | Ga0105242_10012513 | 3300009176 | Bacteria | 6532 |
| 220 | Ga0105242_10300379 | 3300009176 | Bacteria | 1465 |
| 221 | Ga0105248_10033477 | 3300009177 | Bacteria | 5741 |
| 222 | Ga0105248_10109429 | 3300009177 | Bacteria | 3115 |
| 223 | Ga0105249_10089591 | 3300009553 | Bacteria | 2875 |
| 224 | Ga0105249_10101243 | 3300009553 | Bacteria | 2709 |
| 225 | Ga0105249_10313914 | 3300009553 | Bacteria | 1577 |
| 226 | Ga0105239_10190646 | 3300010375 | Bacteria | 2295 |
| 227 | Ga0105239_10750805 | 3300010375 | Bacteria | 1117 |
| 228 | Ga0157374_10048436 | 3300013296 | Bacteria | 3943 |
| 229 | Ga0157378_10077551 | 3300013297 | Bacteria | 2996 |
| 230 | Ga0157378_10123113 | 3300013297 | Bacteria | 2393 |
| 231 | Ga0163162_10017343 | 3300013306 | Bacteria | 7046 |
| 232 | Ga0163162_10121440 | 3300013306 | Bacteria | 2717 |
| 233 | Ga0163162_10410988 | 3300013306 | Bacteria | 1486 |
| 234 | Ga0157375_10158639 | 3300013308 | Bacteria | 2403 |
| 235 | Ga0157375_10294390 | 3300013308 | Bacteria | 1786 |
| 236 | Ga0157375_10555011 | 3300013308 | Bacteria | 1310 |
| 237 | Ga0157380_10101074 | 3300014326 | Bacteria | 2402 |
| 238 | Ga0157380_10163445 | 3300014326 | Bacteria | 1937 |
| 239 | Ga0157380_10370009 | 3300014326 | Bacteria | 1348 |
| 240 | Ga0157380_10573331 | 3300014326 | Bacteria | 1111 |
| 241 | Ga0157377_10046673 | 3300014745 | Bacteria | 2424 |
| 242 | Ga0157377_10205412 | 3300014745 | Bacteria | 1253 |
| 243 | Ga0157377_10232098 | 3300014745 | Unclassified | 1187 |
| 244 | Ga0157379_10037275 | 3300014968 | Bacteria | 4335 |
| 245 | Ga0157379_10108098 | 3300014968 | Bacteria | 2497 |
| 246 | Ga0157379_10157195 | 3300014968 | Bacteria | 2051 |
| 247 | Ga0157376_10035153 | 3300014969 | Bacteria | 4052 |
| 248 | Ga0157376_10071558 | 3300014969 | Bacteria | 2947 |
| 249 | Ga0182007_10047970 | 3300015262 | Bacteria | 1412 |
| 250 | Ga0207682_10046596 | 3300025893 | Bacteria | 1782 |
| 251 | Ga0207682_10059512 | 3300025893 | Bacteria | 1596 |
| 252 | Ga0207642_10192949 | 3300025899 | Bacteria | 1119 |
| 253 | Ga0207688_10198934 | 3300025901 | Bacteria | 1201 |
| 254 | Ga0207680_10174669 | 3300025903 | Bacteria | 1449 |
| 255 | Ga0207680_10350837 | 3300025903 | Bacteria | 1036 |
| 256 | Ga0207645_10058343 | 3300025907 | Bacteria | 2464 |
| 257 | Ga0207643_10003032 | 3300025908 | Bacteria | 9037 |
| 258 | Ga0207643_10003777 | 3300025908 | Bacteria | 8139 |
| 259 | Ga0207684_10101552 | 3300025910 | Bacteria | 2459 |
| 260 | Ga0207695_10097445 | 3300025913 | Bacteria | 2942 |
| 261 | Ga0207660_10348858 | 3300025917 | Bacteria | 1186 |
| 262 | Ga0207662_10007576 | 3300025918 | Bacteria | 5913 |
| 263 | Ga0207662_10019120 | 3300025918 | Bacteria | 3894 |
| 264 | Ga0207662_10104972 | 3300025918 | Bacteria | 1755 |
| 265 | Ga0207646_10040848 | 3300025922 | Bacteria | 4171 |
| 266 | Ga0207646_10105303 | 3300025922 | Bacteria | 2529 |
| 267 | Ga0207646_10129171 | 3300025922 | Bacteria | 2274 |
| 268 | Ga0207646_10459631 | 3300025922 | Bacteria | 1148 |
| 269 | Ga0207681_10073500 | 3300025923 | Bacteria | 2392 |
| 270 | Ga0207650_10040396 | 3300025925 | Bacteria | 3414 |
| 271 | Ga0207659_10000228 | 3300025926 | Bacteria | 34204 |
| 272 | Ga0207659_10005179 | 3300025926 | Bacteria | 7903 |
| 273 | Ga0207659_10007986 | 3300025926 | Bacteria | 6541 |
| 274 | Ga0207659_10526184 | 3300025926 | Bacteria | 1003 |
| 275 | Ga0207659_10551922 | 3300025926 | Bacteria | 979 |
| 276 | Ga0207644_10026302 | 3300025931 | Bacteria | 4008 |
| 277 | Ga0207706_10085680 | 3300025933 | Bacteria | 2770 |
| 278 | Ga0207706_10092710 | 3300025933 | Bacteria | 2656 |
| 279 | Ga0207706_10100915 | 3300025933 | Bacteria | 2539 |
| 280 | Ga0207706_10513796 | 3300025933 | Bacteria | 1033 |
| 281 | Ga0207686_10004308 | 3300025934 | Bacteria | 7632 |
| 282 | Ga0207686_10048988 | 3300025934 | Bacteria | 2620 |
| 283 | Ga0207670_10002302 | 3300025936 | Bacteria | 10011 |
| 284 | Ga0207669_10151967 | 3300025937 | Bacteria | 1623 |
| 285 | Ga0207704_10066338 | 3300025938 | Bacteria | 2265 |
| 286 | Ga0207704_10227723 | 3300025938 | Bacteria | 1384 |
| 287 | Ga0207704_10286166 | 3300025938 | Bacteria | 1255 |
| 288 | Ga0207691_10041837 | 3300025940 | Bacteria | 4227 |
| 289 | Ga0207691_10314266 | 3300025940 | Bacteria | 1344 |
| 290 | Ga0207691_10500017 | 3300025940 | Bacteria | 1032 |
| 291 | Ga0207711_10013029 | 3300025941 | Bacteria | 6906 |
| 292 | Ga0207711_10038837 | 3300025941 | Bacteria | 4048 |
| 293 | Ga0207689_10034373 | 3300025942 | Bacteria | 4211 |
| 294 | Ga0207689_10147641 | 3300025942 | Bacteria | 1937 |
| 295 | Ga0207689_10230799 | 3300025942 | Bacteria | 1529 |
| 296 | Ga0207679_10193457 | 3300025945 | Bacteria | 1693 |
| 297 | Ga0207679_10434786 | 3300025945 | Bacteria | 1161 |
| 298 | Ga0207667_10422600 | 3300025949 | Bacteria | 1356 |
| 299 | Ga0207651_10105240 | 3300025960 | Bacteria | 2104 |
| 300 | Ga0207651_10150080 | 3300025960 | Bacteria | 1813 |
| 301 | Ga0207712_10011132 | 3300025961 | Bacteria | 5726 |
| 302 | Ga0207712_10086466 | 3300025961 | Bacteria | 2296 |
| 303 | Ga0207668_10540422 | 3300025972 | Bacteria | 1008 |
| 304 | Ga0207640_10047741 | 3300025981 | Bacteria | 2763 |
| 305 | Ga0207640_10391353 | 3300025981 | Bacteria | 1129 |
| 306 | Ga0207658_10078610 | 3300025986 | Bacteria | 2521 |
| 307 | Ga0207658_10146400 | 3300025986 | Bacteria | 1919 |
| 308 | Ga0207677_10176439 | 3300026023 | Bacteria | 1676 |
| 309 | Ga0207703_10004495 | 3300026035 | Bacteria | 11448 |
| 310 | Ga0207708_10005596 | 3300026075 | Bacteria | 9271 |
| 311 | Ga0207708_10069079 | 3300026075 | Bacteria | 2704 |
| 312 | Ga0207708_10122048 | 3300026075 | Bacteria | 2031 |
| 313 | Ga0207641_10004085 | 3300026088 | Bacteria | 12730 |
| 314 | Ga0207641_10146165 | 3300026088 | Bacteria | 2138 |
| 315 | Ga0207641_10420163 | 3300026088 | Bacteria | 1287 |
| 316 | Ga0207648_10000600 | 3300026089 | Bacteria | 40518 |
| 317 | Ga0207648_10103151 | 3300026089 | Bacteria | 2501 |
| 318 | Ga0207648_10160643 | 3300026089 | Bacteria | 1984 |
| 319 | Ga0207648_10294496 | 3300026089 | Bacteria | 1454 |
| 320 | Ga0207676_10118475 | 3300026095 | Bacteria | 2228 |
| 321 | Ga0207674_10022060 | 3300026116 | Bacteria | 6846 |
| 322 | Ga0207674_10073523 | 3300026116 | Bacteria | 3432 |
| 323 | Ga0207675_100000622 | 3300026118 | Bacteria | 34726 |
| 324 | Ga0207675_100006784 | 3300026118 | Bacteria | 10833 |
| 325 | Ga0207675_100018513 | 3300026118 | Bacteria | 6496 |
| 326 | Ga0207675_100020479 | 3300026118 | Bacteria | 6165 |
| 327 | Ga0207675_100134754 | 3300026118 | Bacteria | 2343 |
| 328 | Ga0207675_100609090 | 3300026118 | Bacteria | 1096 |
| 329 | Ga0207683_10188639 | 3300026121 | Bacteria | 1871 |
| 330 | Ga0207683_10508838 | 3300026121 | Bacteria | 1112 |
| 331 | Ga0209813_10085713 | 3300027866 | Bacteria | 1049 |
| 332 | Ga0207428_10000520 | 3300027907 | Bacteria | 46036 |
| 333 | Ga0207428_10000801 | 3300027907 | Bacteria | 35543 |
| 334 | Ga0207428_10000838 | 3300027907 | Bacteria | 34614 |
| 335 | Ga0207428_10001137 | 3300027907 | Bacteria | 28857 |
| 336 | Ga0207428_10034163 | 3300027907 | Bacteria | 4170 |
| 337 | Ga0207428_10083185 | 3300027907 | Bacteria | 2497 |
| 338 | Ga0207428_10210451 | 3300027907 | Bacteria | 1461 |
| 339 | Ga0207428_10222166 | 3300027907 | Bacteria | 1416 |
| 340 | Ga0268266_10017934 | 3300028379 | Bacteria | 6034 |
| 341 | Ga0268266_10171169 | 3300028379 | Bacteria | 1971 |
| 342 | Ga0268265_10000625 | 3300028380 | Bacteria | 35281 |
| 343 | Ga0268265_10015718 | 3300028380 | Bacteria | 5185 |
| 344 | Ga0268265_10042987 | 3300028380 | Bacteria | 3356 |
| 345 | Ga0268265_10080446 | 3300028380 | Bacteria | 2569 |
| 346 | Ga0268265_10217202 | 3300028380 | Bacteria | 1670 |
| 347 | Ga0268264_10744485 | 3300028381 | Bacteria | 976 |
| 348 | Ga0307408_100092559 | 3300031548 | Bacteria | 2285 |
| 349 | Ga0316576_10005089 | 3300031727 | Bacteria | 7976 |
| 350 | Ga0316578_10107807 | 3300031728 | Unclassified | 1672 |
| 351 | Ga0307405_10325945 | 3300031731 | Bacteria | 1175 |
| 352 | Ga0307413_10232295 | 3300031824 | Bacteria | 1355 |
| 353 | Ga0307410_10023683 | 3300031852 | Bacteria | 3822 |
| 354 | Ga0307410_10086953 | 3300031852 | Bacteria | 2209 |
| 355 | Ga0307406_10007779 | 3300031901 | Bacteria | 5958 |
| 356 | Ga0307406_10105796 | 3300031901 | Bacteria | 1926 |
| 357 | Ga0307407_10016554 | 3300031903 | Bacteria | 3673 |
| 358 | Ga0307407_10106988 | 3300031903 | Bacteria | 1748 |
| 359 | Ga0307412_10021911 | 3300031911 | Bacteria | 3909 |
| 360 | Ga0307412_10104091 | 3300031911 | Bacteria | 2013 |
| 361 | Ga0307412_10108622 | 3300031911 | Bacteria | 1976 |
| 362 | Ga0307412_10202992 | 3300031911 | Bacteria | 1507 |
| 363 | Ga0307412_10359839 | 3300031911 | Bacteria | 1171 |
| 364 | Ga0307409_100011654 | 3300031995 | Bacteria | 5558 |
| 365 | Ga0307409_100043595 | 3300031995 | Bacteria | 3370 |
| 366 | Ga0307409_100050991 | 3300031995 | Bacteria | 3164 |
| 367 | Ga0307409_100165147 | 3300031995 | Bacteria | 1942 |
| 368 | Ga0307416_100080219 | 3300032002 | Bacteria | 2753 |
| 369 | Ga0307416_100083096 | 3300032002 | Bacteria | 2715 |
| 370 | Ga0307414_10070249 | 3300032004 | Bacteria | 2521 |
| 371 | Ga0307411_10130054 | 3300032005 | Bacteria | 1838 |
| 372 | Ga0307415_100367199 | 3300032126 | Bacteria | 1217 |
| 373 | Ga0373958_0007891 | 3300034819 | Bacteria | 1708 |
| 374 | Ga0373959_0007134 | 3300034820 | Bacteria | 1874 |
| 375 | Ga0373938_0000129 | 3300034957 | Bacteria | 10674 |
| 376 | Ga0373928_0002380 | 3300035084 | Bacteria | 3652 |
| 377 | Ga0373929_0006263 | 3300035085 | Bacteria | 2148 |
| 378 | Ga0373940_0002309 | 3300035088 | Bacteria | 3684 |
| 379 | Ga0373949_0001063 | 3300035090 | Bacteria | 8403 |
| 380 | Ga0373951_0006631 | 3300035091 | Bacteria | 2644 |
| 381 | Ga0373952_0042161 | 3300035092 | Bacteria | 1058 |
| 382 | Ga0373932_0000292 | 3300035112 | Bacteria | 15083 |
| 383 | Ga0373939_0000836 | 3300035114 | Bacteria | 7629 |
| 384 | Ga0373941_0000847 | 3300035115 | Bacteria | 6307 |
| 385 | Ga0373957_0083148 | 3300035120 | Bacteria | 1266 |
| 386 | Ga0373960_0001074 | 3300035121 | Bacteria | 5896 |
| 387 | Ga0373942_0001090 | 3300035207 | Bacteria | 7272 |
| 388 | Ga0373961_0031697 | 3300035241 | Bacteria | 1478 |
| 389 | Ga0373961_0040809 | 3300035241 | Bacteria | 1339 |
| 390 | Ga0373962_0011777 | 3300035242 | Bacteria | 2196 |
| 391 | Ga0373924_0108737 | 3300035410 | Bacteria | 1197 |
| 392 | Ga0373931_0207263 | 3300035691 | Bacteria | 1174 |
| 393 | Ga0373935_0371407 | 3300035692 | Bacteria | 1023 |
| 394 | Ga0316584_0009181 | 3300036712 | Bacteria | 6849 |
| 395 | Ga0439441_032344 | 3300042001 | Bacteria | 1019 |
| 396 | Ga0439462_0016556 | 3300042015 | Bacteria | 1905 |
| 397 | Ga0439434_0001966 | 3300042435 | Bacteria | 5951 |
| 398 | Ga0439435_0054479 | 3300042436 | Bacteria | 1152 |
| 399 | Ga0439444_0018384 | 3300042437 | Bacteria | 1210 |
| 400 | Ga0439444_0029074 | 3300042437 | Bacteria | 1027 |
| 401 | Ga0439464_0004793 | 3300042439 | Bacteria | 3466 |
| 402 | Ga0451576_0039905 | 3300045051 | Bacteria | 4969 |
| 403 | Ga0451576_0486180 | 3300045051 | Bacteria | 1297 |
| 404 | Ga0451576_0898351 | 3300045051 | Bacteria | 929 |
| 405 | Ga0495629_0115366 | 3300046459 | Bacteria | 1872 |
| 406 | Ga0495594_0031947 | 3300046499 | Bacteria | 2856 |
| 407 | Ga0495598_0004303 | 3300046537 | Bacteria | 3076 |
| 408 | Ga0495609_0146421 | 3300046538 | Bacteria | 1006 |
| 409 | Ga0495621_0005012 | 3300046539 | Bacteria | 3776 |
| 410 | Ga0495621_0059996 | 3300046539 | Bacteria | 1379 |
| 411 | Ga0495659_0006010 | 3300046664 | Bacteria | 3835 |
| 412 | Ga0495659_0006678 | 3300046664 | Bacteria | 3646 |
| 413 | Ga0495659_0031667 | 3300046664 | Bacteria | 1847 |
| 414 | Ga0495659_0040473 | 3300046664 | Bacteria | 1661 |
| 415 | Ga0495588_0055134 | 3300046674 | Bacteria | 2051 |
| 416 | Ga0495658_0381104 | 3300046683 | Bacteria | 898 |
| 417 | Ga0495669_0011309 | 3300046684 | Bacteria | 3789 |
| 418 | Ga0495669_0020113 | 3300046684 | Bacteria | 2886 |
| 419 | Ga0495670_0058597 | 3300046691 | Bacteria | 1933 |
| 420 | Ga0495581_0271130 | 3300047315 | Bacteria | 992 |
| 421 | Ga0495636_0072440 | 3300047318 | Bacteria | 1473 |
| 422 | Ga0495672_0047596 | 3300047320 | Bacteria | 2549 |
| 423 | Ga0495677_0093182 | 3300047445 | Bacteria | 1136 |
| 424 | Ga0496100_0150609 | 3300048903 | Bacteria | 1659 |
| 425 | Ga0496101_0116475 | 3300048904 | Bacteria | 2016 |
| 426 | Ga0496102_0039401 | 3300048905 | Bacteria | 4270 |
| 427 | Ga0496104_0118552 | 3300048907 | Bacteria | 2541 |
| 428 | Ga0496109_0282954 | 3300048912 | Bacteria | 1563 |
| 429 | Ga0496114_0019072 | 3300048917 | Bacteria | 5558 |
| 430 | Ga0496115_0021942 | 3300048918 | Bacteria | 4938 |
| 431 | Ga0501303_004763 | 3300049526 | Bacteria | 1132 |
| 432 | Ga0501031_0064864 | 3300049568 | Unclassified | 2379 |
| 433 | Ga0501031_0143748 | 3300049568 | Bacteria | 1559 |
| 434 | Ga0501036_0237783 | 3300049572 | Bacteria | 1528 |
| 435 | Ga0501040_0057652 | 3300049576 | Bacteria | 2667 |
| 436 | Ga0501041_0043877 | 3300049577 | Bacteria | 2718 |
| 437 | Ga0501042_0018949 | 3300049578 | Bacteria | 4773 |
| 438 | Ga0501042_0046405 | 3300049578 | Bacteria | 3097 |
| 439 | Ga0501071_0062459 | 3300049587 | Bacteria | 2699 |
| 440 | Ga0501072_0013878 | 3300049588 | Bacteria | 6173 |
| 441 | Ga0501072_0275560 | 3300049588 | Unclassified | 1338 |
| 442 | Ga0501075_0015935 | 3300049591 | Bacteria | 5405 |
| 443 | Ga0501075_0189088 | 3300049591 | Bacteria | 1570 |
| 444 | Ga0501076_0061474 | 3300049592 | Bacteria | 2989 |
| 445 | Ga0501079_0029263 | 3300049741 | Bacteria | 4229 |
| 446 | Ga0501079_0073562 | 3300049741 | Bacteria | 2641 |
| 447 | Ga0501081_0024651 | 3300049743 | Bacteria | 4041 |
| 448 | Ga0501045_0068727 | 3300049824 | Bacteria | 2603 |
| 449 | Ga0501045_0446195 | 3300049824 | Bacteria | 962 |
| 450 | nmdc:mga00v17_49896_c1 | 3300050491 | Unclassified | 2540 |
| 451 | nmdc:mga0k408_118633_c1 | 3300050493 | Bacteria | 1566 |
| 452 | nmdc:mga0k408_36773_c1 | 3300050493 | Bacteria | 2810 |
| 453 | nmdc:mga06z11_7846_c1 | 3300050494 | Bacteria | 4416 |
| 454 | nmdc:mga04h51_121478_c1 | 3300050495 | Bacteria | 973 |
| 455 | nmdc:mga05p37_10459_c1 | 3300050507 | Bacteria | 11012 |
| 456 | nmdc:mga05p37_18629_c1 | 3300050507 | Bacteria | 8388 |
| 457 | nmdc:mga05p37_209343_c1 | 3300050507 | Bacteria | 2358 |
| 458 | nmdc:mga05p37_231858_c1 | 3300050507 | Bacteria | 2224 |
| 459 | nmdc:mga05p37_25324_c1 | 3300050507 | Bacteria | 7216 |
| 460 | nmdc:mga05p37_425952_c1 | 3300050507 | Bacteria | 1543 |
| 461 | nmdc:mga05p37_425984_c1 | 3300050507 | Bacteria | 1543 |
| 462 | nmdc:mga05p37_687_c1 | 3300050507 | Bacteria | 37482 |
| 463 | nmdc:mga05p37_7441_c1 | 3300050507 | Bacteria | 12912 |
| 464 | nmdc:mga09592_104349_c1 | 3300050508 | Bacteria | 2429 |
| 465 | nmdc:mga09592_114052_c1 | 3300050508 | Bacteria | 2319 |
| 466 | nmdc:mga09592_131377_c1 | 3300050508 | Bacteria | 2154 |
| 467 | nmdc:mga09592_149037_c1 | 3300050508 | Unclassified | 2018 |
| 468 | nmdc:mga09592_266639_c1 | 3300050508 | Bacteria | 1485 |
| 469 | nmdc:mga09592_27048_c1 | 3300050508 | Bacteria | 4757 |
| 470 | nmdc:mga09592_51094_c1 | 3300050508 | Bacteria | 3487 |
| 471 | nmdc:mga09592_512614_c1 | 3300050508 | Bacteria | 1032 |
| 472 | nmdc:mga09592_54226_c1 | 3300050508 | Bacteria | 3387 |
| 473 | nmdc:mga09592_630844_c1 | 3300050508 | Bacteria | 916 |
| 474 | nmdc:mga0qj67_10057_c1 | 3300050509 | Bacteria | 7059 |
| 475 | nmdc:mga0qj67_181255_c1 | 3300050509 | Bacteria | 1711 |
| 476 | nmdc:mga0qj67_46942_c1 | 3300050509 | Bacteria | 3411 |
| 477 | nmdc:mga0qj67_60928_c1 | 3300050509 | Bacteria | 2995 |
| 478 | nmdc:mga06r32_131091_c1 | 3300050510 | Bacteria | 2479 |
| 479 | nmdc:mga06r32_214999_c1 | 3300050510 | Bacteria | 1910 |
| 480 | nmdc:mga06r32_358525_c1 | 3300050510 | Bacteria | 1442 |
| 481 | nmdc:mga06r32_44120_c1 | 3300050510 | Bacteria | 4245 |
| 482 | nmdc:mga08y16_13137_c1 | 3300050511 | Bacteria | 8712 |
| 483 | nmdc:mga08y16_139614_c1 | 3300050511 | Bacteria | 2519 |
| 484 | nmdc:mga08y16_2353_c1 | 3300050511 | Bacteria | 19387 |
| 485 | nmdc:mga08y16_23882_c1 | 3300050511 | Bacteria | 6457 |
| 486 | nmdc:mga08y16_2693_c1 | 3300050511 | Bacteria | 18229 |
| 487 | nmdc:mga08y16_497_c1 | 3300050511 | Bacteria | 36217 |
| 488 | nmdc:mga08y16_5024_c1 | 3300050511 | Bacteria | 13831 |
| 489 | nmdc:mga08y16_52876_c1 | 3300050511 | Bacteria | 4248 |
| 490 | nmdc:mga08y16_9827_c1 | 3300050511 | Bacteria | 10043 |
| 491 | nmdc:mga0n895_179855_c1 | 3300050512 | Bacteria | 2146 |
| 492 | nmdc:mga0n895_2029_c1 | 3300050512 | Bacteria | 15577 |
| 493 | nmdc:mga0n895_23_c1 | 3300050512 | Bacteria | 92165 |
| 494 | nmdc:mga0n895_31680_c1 | 3300050512 | Bacteria | 5066 |
| 495 | nmdc:mga0n895_348344_c1 | 3300050512 | Bacteria | 1500 |
| 496 | nmdc:mga0n895_67400_c1 | 3300050512 | Bacteria | 3545 |
| 497 | nmdc:mga0n895_7121_c1 | 3300050512 | Bacteria | 9563 |
| 498 | nmdc:mga0n895_98706_c1 | 3300050512 | Bacteria | 2928 |
| 499 | nmdc:mga0rr50_11_c1 | 3300050513 | Bacteria | 216152 |
| 500 | nmdc:mga0rr50_284899_c1 | 3300050513 | Bacteria | 1379 |
| 501 | nmdc:mga0rr50_380943_c1 | 3300050513 | Bacteria | 1189 |
| 502 | nmdc:mga0rr50_442199_c1 | 3300050513 | Bacteria | 1102 |
| 503 | nmdc:mga0rr50_60996_c1 | 3300050513 | Bacteria | 2840 |
| 504 | nmdc:mga08x19_1418_c1 | 3300050514 | Bacteria | 14813 |
| 505 | nmdc:mga08x19_327940_c1 | 3300050514 | Bacteria | 1066 |
| 506 | nmdc:mga0a205_160243_c1 | 3300050515 | Bacteria | 2147 |
| 507 | nmdc:mga0a205_163529_c1 | 3300050515 | Unclassified | 2121 |
| 508 | nmdc:mga0a205_2134_c1 | 3300050515 | Bacteria | 17370 |
| 509 | nmdc:mga0a205_397522_c1 | 3300050515 | Bacteria | 1242 |
| 510 | nmdc:mga0a205_40495_c1 | 3300050515 | Bacteria | 4485 |
| 511 | nmdc:mga0a205_48625_c1 | 3300050515 | Unclassified | 4093 |
| 512 | nmdc:mga0a205_663_c1 | 3300050515 | Bacteria | 27409 |
| 513 | nmdc:mga0a205_78372_c1 | 3300050515 | Bacteria | 3192 |
| 514 | nmdc:mga0a205_8896_c1 | 3300050515 | Bacteria | 9151 |
| 515 | Ga0495619_0351826 | 3300053085 | Bacteria | 1019 |
| 516 | Ga0500568_0007187 | 3300053139 | Bacteria | 5489 |
| 517 | Ga0501084_0335318 | 3300054114 | Bacteria | 1277 |
| 518 | Ga0590071_011264 | 3300059421 | Bacteria | 2092 |
| 519 | Ga0590075_000949 | 3300059424 | Bacteria | 7539 |
| 520 | Ga0590075_010239 | 3300059424 | Bacteria | 2256 |
| 521 | Ga0590077_002784 | 3300059426 | Bacteria | 3680 |
| 522 | Ga0590077_004270 | 3300059426 | Bacteria | 2942 |
| 523 | Ga0590077_008914 | 3300059426 | Bacteria | 2054 |
| 524 | Ga0501082_0025685 | 3300060353 | Bacteria | 5076 |
| 525 | Ga0530510_0003289 | 3300061734 | Bacteria | 11122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100018511 | Ga0070665_1000185112 | 249 |
| 2 | 3300028379 | Ga0268266_10171169 | Ga0268266_101711692 | 249 |
| 3 | 3300005340 | Ga0070689_100336924 | Ga0070689_1003369241 | 252 |
| 4 | 3300005466 | Ga0070685_10231851 | Ga0070685_102318512 | 252 |
| 5 | 3300005577 | Ga0068857_100357087 | Ga0068857_1003570872 | 252 |
| 6 | 3300009094 | Ga0111539_10715740 | Ga0111539_107157402 | 252 |
| 7 | 3300009147 | Ga0114129_10198387 | Ga0114129_101983873 | 252 |
| 8 | 3300009147 | Ga0114129_10001744 | Ga0114129_100017445 | 253 |
| 9 | 3300013308 | Ga0157375_10555011 | Ga0157375_105550112 | 253 |
| 10 | 3300025926 | Ga0207659_10005179 | Ga0207659_100051796 | 253 |
| 11 | 3300026118 | Ga0207675_100609090 | Ga0207675_1006090902 | 253 |
| 12 | 3300028381 | Ga0268264_10744485 | Ga0268264_107444852 | 253 |
| 13 | 3300050507 | nmdc:mga05p37_231858_c1 | nmdc:mga05p37_231858_c1_27_824 | 253 |
| 14 | 3300006847 | Ga0075431_100111164 | Ga0075431_1001111643 | 256 |
| 15 | 3300009147 | Ga0114129_10258379 | Ga0114129_102583792 | 256 |
| 16 | 3300050507 | nmdc:mga05p37_425984_c1 | nmdc:mga05p37_425984_c1_671_1471 | 256 |
| 17 | 3300050510 | nmdc:mga06r32_214999_c1 | nmdc:mga06r32_214999_c1_308_1114 | 256 |
| 18 | 3300005445 | Ga0070708_100631144 | Ga0070708_1006311441 | 259 |
| 19 | 3300048903 | Ga0496100_0150609 | Ga0496100_0150609_297_1076 | 259 |
| 20 | 3300048904 | Ga0496101_0116475 | Ga0496101_0116475_279_1058 | 259 |
| 21 | 3300048912 | Ga0496109_0282954 | Ga0496109_0282954_637_1416 | 259 |
| 22 | 3300005459 | Ga0068867_100068389 | Ga0068867_1000683891 | 260 |
| 23 | 3300050514 | nmdc:mga08x19_327940_c1 | nmdc:mga08x19_327940_c1_97_879 | 260 |
| 24 | 3300005548 | Ga0070665_100345130 | Ga0070665_1003451301 | 262 |
| 25 | 3300010375 | Ga0105239_10750805 | Ga0105239_107508051 | 262 |
| 26 | 3300026121 | Ga0207683_10508838 | Ga0207683_105088381 | 262 |
| 27 | 3300031911 | Ga0307412_10202992 | Ga0307412_102029922 | 262 |
| 28 | 3300042015 | Ga0439462_0016556 | Ga0439462_0016556_965_1753 | 262 |
| 29 | 3300042435 | Ga0439434_0001966 | Ga0439434_0001966_4916_5704 | 262 |
| 30 | 3300050510 | nmdc:mga06r32_358525_c1 | nmdc:mga06r32_358525_c1_14_802 | 262 |
| 31 | 3300059424 | Ga0590075_010239 | Ga0590075_010239_1231_2019 | 262 |
| 32 | 3300005293 | Ga0065715_10007164 | Ga0065715_100071644 | 263 |
| 33 | 3300005330 | Ga0070690_100327381 | Ga0070690_1003273811 | 263 |
| 34 | 3300005343 | Ga0070687_100007844 | Ga0070687_1000078442 | 263 |
| 35 | 3300005439 | Ga0070711_100351494 | Ga0070711_1003514942 | 263 |
| 36 | 3300005544 | Ga0070686_100000738 | Ga0070686_1000007382 | 263 |
| 37 | 3300005544 | Ga0070686_100102003 | Ga0070686_1001020031 | 263 |
| 38 | 3300005563 | Ga0068855_100491325 | Ga0068855_1004913251 | 263 |
| 39 | 3300005981 | Ga0081538_10039360 | Ga0081538_100393602 | 263 |
| 40 | 3300006058 | Ga0075432_10090732 | Ga0075432_100907321 | 263 |
| 41 | 3300006844 | Ga0075428_100022970 | Ga0075428_1000229705 | 263 |
| 42 | 3300006844 | Ga0075428_100047355 | Ga0075428_1000473554 | 263 |
| 43 | 3300006846 | Ga0075430_100004000 | Ga0075430_10000400012 | 263 |
| 44 | 3300006846 | Ga0075430_100069036 | Ga0075430_1000690362 | 263 |
| 45 | 3300006847 | Ga0075431_100475572 | Ga0075431_1004755722 | 263 |
| 46 | 3300006852 | Ga0075433_10001967 | Ga0075433_100019676 | 263 |
| 47 | 3300006852 | Ga0075433_10097917 | Ga0075433_100979173 | 263 |
| 48 | 3300006880 | Ga0075429_100024224 | Ga0075429_1000242243 | 263 |
| 49 | 3300006880 | Ga0075429_100035146 | Ga0075429_1000351462 | 263 |
| 50 | 3300007076 | Ga0075435_100487550 | Ga0075435_1004875501 | 263 |
| 51 | 3300009093 | Ga0105240_10092216 | Ga0105240_100922162 | 263 |
| 52 | 3300009094 | Ga0111539_10002648 | Ga0111539_100026483 | 263 |
| 53 | 3300009094 | Ga0111539_10163313 | Ga0111539_101633132 | 263 |
| 54 | 3300009147 | Ga0114129_10013146 | Ga0114129_1001314611 | 263 |
| 55 | 3300009147 | Ga0114129_10218788 | Ga0114129_102187882 | 263 |
| 56 | 3300009174 | Ga0105241_10063516 | Ga0105241_100635162 | 263 |
| 57 | 3300009177 | Ga0105248_10109429 | Ga0105248_101094293 | 263 |
| 58 | 3300014745 | Ga0157377_10232098 | Ga0157377_102320982 | 263 |
| 59 | 3300025903 | Ga0207680_10350837 | Ga0207680_103508371 | 263 |
| 60 | 3300025913 | Ga0207695_10097445 | Ga0207695_100974452 | 263 |
| 61 | 3300025917 | Ga0207660_10348858 | Ga0207660_103488581 | 263 |
| 62 | 3300025918 | Ga0207662_10007576 | Ga0207662_100075762 | 263 |
| 63 | 3300025933 | Ga0207706_10513796 | Ga0207706_105137962 | 263 |
| 64 | 3300025949 | Ga0207667_10422600 | Ga0207667_104226002 | 263 |
| 65 | 3300025981 | Ga0207640_10047741 | Ga0207640_100477413 | 263 |
| 66 | 3300026089 | Ga0207648_10294496 | Ga0207648_102944961 | 263 |
| 67 | 3300026118 | Ga0207675_100018513 | Ga0207675_1000185134 | 263 |
| 68 | 3300027907 | Ga0207428_10000838 | Ga0207428_1000083825 | 263 |
| 69 | 3300031731 | Ga0307405_10325945 | Ga0307405_103259452 | 263 |
| 70 | 3300031901 | Ga0307406_10105796 | Ga0307406_101057963 | 263 |
| 71 | 3300031911 | Ga0307412_10104091 | Ga0307412_101040912 | 263 |
| 72 | 3300032002 | Ga0307416_100080219 | Ga0307416_1000802192 | 263 |
| 73 | 3300034819 | Ga0373958_0007891 | Ga0373958_0007891_50_841 | 263 |
| 74 | 3300034820 | Ga0373959_0007134 | Ga0373959_0007134_94_885 | 263 |
| 75 | 3300034957 | Ga0373938_0000129 | Ga0373938_0000129_8508_9299 | 263 |
| 76 | 3300035084 | Ga0373928_0002380 | Ga0373928_0002380_1082_1873 | 263 |
| 77 | 3300035085 | Ga0373929_0006263 | Ga0373929_0006263_1042_1833 | 263 |
| 78 | 3300035088 | Ga0373940_0002309 | Ga0373940_0002309_1870_2661 | 263 |
| 79 | 3300035090 | Ga0373949_0001063 | Ga0373949_0001063_3192_3983 | 263 |
| 80 | 3300035091 | Ga0373951_0006631 | Ga0373951_0006631_113_904 | 263 |
| 81 | 3300035092 | Ga0373952_0042161 | Ga0373952_0042161_68_859 | 263 |
| 82 | 3300035112 | Ga0373932_0000292 | Ga0373932_0000292_3561_4352 | 263 |
| 83 | 3300035114 | Ga0373939_0000836 | Ga0373939_0000836_5836_6627 | 263 |
| 84 | 3300035115 | Ga0373941_0000847 | Ga0373941_0000847_3776_4567 | 263 |
| 85 | 3300035121 | Ga0373960_0001074 | Ga0373960_0001074_1382_2173 | 263 |
| 86 | 3300035207 | Ga0373942_0001090 | Ga0373942_0001090_2706_3497 | 263 |
| 87 | 3300035242 | Ga0373962_0011777 | Ga0373962_0011777_1136_1927 | 263 |
| 88 | 3300042001 | Ga0439441_032344 | Ga0439441_032344_178_969 | 263 |
| 89 | 3300042437 | Ga0439444_0029074 | Ga0439444_0029074_216_1007 | 263 |
| 90 | 3300042439 | Ga0439464_0004793 | Ga0439464_0004793_388_1179 | 263 |
| 91 | 3300048905 | Ga0496102_0039401 | Ga0496102_0039401_3361_4152 | 263 |
| 92 | 3300050507 | nmdc:mga05p37_10459_c1 | nmdc:mga05p37_10459_c1_9638_10429 | 263 |
| 93 | 3300050507 | nmdc:mga05p37_425952_c1 | nmdc:mga05p37_425952_c1_216_1007 | 263 |
| 94 | 3300050508 | nmdc:mga09592_27048_c1 | nmdc:mga09592_27048_c1_512_1303 | 263 |
| 95 | 3300050508 | nmdc:mga09592_54226_c1 | nmdc:mga09592_54226_c1_1867_2658 | 263 |
| 96 | 3300050508 | nmdc:mga09592_630844_c1 | nmdc:mga09592_630844_c1_44_835 | 263 |
| 97 | 3300050509 | nmdc:mga0qj67_10057_c1 | nmdc:mga0qj67_10057_c1_4963_5754 | 263 |
| 98 | 3300050510 | nmdc:mga06r32_44120_c1 | nmdc:mga06r32_44120_c1_2739_3530 | 263 |
| 99 | 3300050511 | nmdc:mga08y16_2353_c1 | nmdc:mga08y16_2353_c1_1222_2013 | 263 |
| 100 | 3300050512 | nmdc:mga0n895_348344_c1 | nmdc:mga0n895_348344_c1_10_801 | 263 |
| 101 | 3300050515 | nmdc:mga0a205_48625_c1 | nmdc:mga0a205_48625_c1_2259_3050 | 263 |
| 102 | 3300050515 | nmdc:mga0a205_8896_c1 | nmdc:mga0a205_8896_c1_6031_6822 | 263 |
| 103 | 3300059424 | Ga0590075_000949 | Ga0590075_000949_2059_2850 | 263 |
| 104 | 3300059426 | Ga0590077_002784 | Ga0590077_002784_1443_2234 | 263 |
| 105 | 3300059426 | Ga0590077_008914 | Ga0590077_008914_713_1504 | 263 |
| 106 | 3300005471 | Ga0070698_100002373 | Ga0070698_10000237315 | 264 |
| 107 | 3300005518 | Ga0070699_100001411 | Ga0070699_1000014115 | 264 |
| 108 | 3300005546 | Ga0070696_100002025 | Ga0070696_1000020256 | 264 |
| 109 | 3300006852 | Ga0075433_10021911 | Ga0075433_100219115 | 264 |
| 110 | 3300006880 | Ga0075429_100526398 | Ga0075429_1005263982 | 264 |
| 111 | 3300009147 | Ga0114129_10005185 | Ga0114129_100051853 | 264 |
| 112 | 3300014326 | Ga0157380_10163445 | Ga0157380_101634452 | 264 |
| 113 | 3300046537 | Ga0495598_0004303 | Ga0495598_0004303_859_1653 | 264 |
| 114 | 3300046664 | Ga0495659_0006010 | Ga0495659_0006010_810_1604 | 264 |
| 115 | 3300046691 | Ga0495670_0058597 | Ga0495670_0058597_1101_1895 | 264 |
| 116 | 3300050507 | nmdc:mga05p37_7441_c1 | nmdc:mga05p37_7441_c1_3661_4455 | 264 |
| 117 | 3300050512 | nmdc:mga0n895_98706_c1 | nmdc:mga0n895_98706_c1_103_897 | 264 |
| 118 | 3300050515 | nmdc:mga0a205_663_c1 | nmdc:mga0a205_663_c1_23343_24137 | 264 |
| 119 | 3300005288 | Ga0065714_10085730 | Ga0065714_100857302 | 265 |
| 120 | 3300005290 | Ga0065712_10067845 | Ga0065712_1006784512 | 265 |
| 121 | 3300005295 | Ga0065707_10098440 | Ga0065707_100984402 | 265 |
| 122 | 3300005295 | Ga0065707_10315156 | Ga0065707_103151561 | 265 |
| 123 | 3300005328 | Ga0070676_10281937 | Ga0070676_102819372 | 265 |
| 124 | 3300005330 | Ga0070690_100039002 | Ga0070690_1000390022 | 265 |
| 125 | 3300005331 | Ga0070670_100063953 | Ga0070670_1000639531 | 265 |
| 126 | 3300005333 | Ga0070677_10054821 | Ga0070677_100548212 | 265 |
| 127 | 3300005334 | Ga0068869_100364433 | Ga0068869_1003644332 | 265 |
| 128 | 3300005334 | Ga0068869_100429028 | Ga0068869_1004290282 | 265 |
| 129 | 3300005336 | Ga0070680_100091660 | Ga0070680_1000916602 | 265 |
| 130 | 3300005338 | Ga0068868_100169667 | Ga0068868_1001696672 | 265 |
| 131 | 3300005340 | Ga0070689_100094527 | Ga0070689_1000945272 | 265 |
| 132 | 3300005340 | Ga0070689_100251710 | Ga0070689_1002517102 | 265 |
| 133 | 3300005343 | Ga0070687_100003395 | Ga0070687_1000033956 | 265 |
| 134 | 3300005343 | Ga0070687_100055176 | Ga0070687_1000551762 | 265 |
| 135 | 3300005345 | Ga0070692_10030212 | Ga0070692_100302123 | 265 |
| 136 | 3300005347 | Ga0070668_100780688 | Ga0070668_1007806881 | 265 |
| 137 | 3300005353 | Ga0070669_100118510 | Ga0070669_1001185101 | 265 |
| 138 | 3300005354 | Ga0070675_100000179 | Ga0070675_10000017911 | 265 |
| 139 | 3300005354 | Ga0070675_100006593 | Ga0070675_1000065937 | 265 |
| 140 | 3300005354 | Ga0070675_100071309 | Ga0070675_1000713092 | 265 |
| 141 | 3300005364 | Ga0070673_100134835 | Ga0070673_1001348352 | 265 |
| 142 | 3300005364 | Ga0070673_100150306 | Ga0070673_1001503062 | 265 |
| 143 | 3300005364 | Ga0070673_100291709 | Ga0070673_1002917092 | 265 |
| 144 | 3300005364 | Ga0070673_100598143 | Ga0070673_1005981431 | 265 |
| 145 | 3300005365 | Ga0070688_100009438 | Ga0070688_1000094383 | 265 |
| 146 | 3300005365 | Ga0070688_100047973 | Ga0070688_1000479732 | 265 |
| 147 | 3300005367 | Ga0070667_100003115 | Ga0070667_1000031158 | 265 |
| 148 | 3300005438 | Ga0070701_10008286 | Ga0070701_100082862 | 265 |
| 149 | 3300005438 | Ga0070701_10085993 | Ga0070701_100859932 | 265 |
| 150 | 3300005455 | Ga0070663_100549849 | Ga0070663_1005498491 | 265 |
| 151 | 3300005457 | Ga0070662_100484064 | Ga0070662_1004840641 | 265 |
| 152 | 3300005458 | Ga0070681_10702895 | Ga0070681_107028951 | 265 |
| 153 | 3300005459 | Ga0068867_100000594 | Ga0068867_10000059418 | 265 |
| 154 | 3300005459 | Ga0068867_100304923 | Ga0068867_1003049233 | 265 |
| 155 | 3300005467 | Ga0070706_100077239 | Ga0070706_1000772392 | 265 |
| 156 | 3300005468 | Ga0070707_100046186 | Ga0070707_1000461862 | 265 |
| 157 | 3300005468 | Ga0070707_100056411 | Ga0070707_1000564111 | 265 |
| 158 | 3300005518 | Ga0070699_100000753 | Ga0070699_1000007534 | 265 |
| 159 | 3300005535 | Ga0070684_100177056 | Ga0070684_1001770562 | 265 |
| 160 | 3300005543 | Ga0070672_100196376 | Ga0070672_1001963762 | 265 |
| 161 | 3300005543 | Ga0070672_100228457 | Ga0070672_1002284572 | 265 |
| 162 | 3300005543 | Ga0070672_100308847 | Ga0070672_1003088472 | 265 |
| 163 | 3300005544 | Ga0070686_100100327 | Ga0070686_1001003271 | 265 |
| 164 | 3300005546 | Ga0070696_100111560 | Ga0070696_1001115602 | 265 |
| 165 | 3300005549 | Ga0070704_100002640 | Ga0070704_1000026403 | 265 |
| 166 | 3300005578 | Ga0068854_100085197 | Ga0068854_1000851972 | 265 |
| 167 | 3300005617 | Ga0068859_100006905 | Ga0068859_1000069057 | 265 |
| 168 | 3300005617 | Ga0068859_100012855 | Ga0068859_1000128554 | 265 |
| 169 | 3300005617 | Ga0068859_100520456 | Ga0068859_1005204563 | 265 |
| 170 | 3300005618 | Ga0068864_100062807 | Ga0068864_1000628072 | 265 |
| 171 | 3300005719 | Ga0068861_100030480 | Ga0068861_1000304802 | 265 |
| 172 | 3300005719 | Ga0068861_100139517 | Ga0068861_1001395172 | 265 |
| 173 | 3300005840 | Ga0068870_10009526 | Ga0068870_100095262 | 265 |
| 174 | 3300005841 | Ga0068863_100006722 | Ga0068863_1000067227 | 265 |
| 175 | 3300005841 | Ga0068863_100556210 | Ga0068863_1005562102 | 265 |
| 176 | 3300005842 | Ga0068858_100016744 | Ga0068858_1000167442 | 265 |
| 177 | 3300005842 | Ga0068858_100136441 | Ga0068858_1001364412 | 265 |
| 178 | 3300005843 | Ga0068860_100013745 | Ga0068860_1000137456 | 265 |
| 179 | 3300005843 | Ga0068860_100242929 | Ga0068860_1002429293 | 265 |
| 180 | 3300005844 | Ga0068862_100000554 | Ga0068862_10000055437 | 265 |
| 181 | 3300005844 | Ga0068862_100010498 | Ga0068862_1000104983 | 265 |
| 182 | 3300006195 | Ga0075366_10075968 | Ga0075366_100759682 | 265 |
| 183 | 3300006237 | Ga0097621_100083241 | Ga0097621_1000832412 | 265 |
| 184 | 3300006237 | Ga0097621_100384733 | Ga0097621_1003847332 | 265 |
| 185 | 3300006358 | Ga0068871_100456636 | Ga0068871_1004566362 | 265 |
| 186 | 3300006844 | Ga0075428_100004797 | Ga0075428_10000479712 | 265 |
| 187 | 3300006844 | Ga0075428_100083210 | Ga0075428_1000832103 | 265 |
| 188 | 3300006844 | Ga0075428_100114242 | Ga0075428_1001142422 | 265 |
| 189 | 3300006846 | Ga0075430_100221724 | Ga0075430_1002217242 | 265 |
| 190 | 3300006847 | Ga0075431_100555562 | Ga0075431_1005555621 | 265 |
| 191 | 3300006852 | Ga0075433_10000108 | Ga0075433_100001089 | 265 |
| 192 | 3300006852 | Ga0075433_10097770 | Ga0075433_100977702 | 265 |
| 193 | 3300006871 | Ga0075434_100004749 | Ga0075434_1000047496 | 265 |
| 194 | 3300006871 | Ga0075434_100011544 | Ga0075434_1000115449 | 265 |
| 195 | 3300006871 | Ga0075434_100051020 | Ga0075434_1000510203 | 265 |
| 196 | 3300006871 | Ga0075434_100092236 | Ga0075434_1000922362 | 265 |
| 197 | 3300006880 | Ga0075429_100040041 | Ga0075429_1000400412 | 265 |
| 198 | 3300006880 | Ga0075429_100470933 | Ga0075429_1004709331 | 265 |
| 199 | 3300006914 | Ga0075436_100124226 | Ga0075436_1001242261 | 265 |
| 200 | 3300006931 | Ga0097620_100006905 | Ga0097620_1000069057 | 265 |
| 201 | 3300006931 | Ga0097620_100012855 | Ga0097620_1000128554 | 265 |
| 202 | 3300006931 | Ga0097620_100520471 | Ga0097620_1005204711 | 265 |
| 203 | 3300007076 | Ga0075435_100056313 | Ga0075435_1000563133 | 265 |
| 204 | 3300007076 | Ga0075435_100074012 | Ga0075435_1000740122 | 265 |
| 205 | 3300007076 | Ga0075435_100156707 | Ga0075435_1001567072 | 265 |
| 206 | 3300009094 | Ga0111539_10000057 | Ga0111539_1000005760 | 265 |
| 207 | 3300009094 | Ga0111539_10039744 | Ga0111539_100397445 | 265 |
| 208 | 3300009094 | Ga0111539_10051926 | Ga0111539_100519263 | 265 |
| 209 | 3300009094 | Ga0111539_10115757 | Ga0111539_101157573 | 265 |
| 210 | 3300009094 | Ga0111539_10364443 | Ga0111539_103644432 | 265 |
| 211 | 3300009147 | Ga0114129_10000428 | Ga0114129_1000042849 | 265 |
| 212 | 3300009147 | Ga0114129_10091866 | Ga0114129_100918662 | 265 |
| 213 | 3300009147 | Ga0114129_10134143 | Ga0114129_101341433 | 265 |
| 214 | 3300009147 | Ga0114129_10153920 | Ga0114129_101539203 | 265 |
| 215 | 3300009147 | Ga0114129_10164284 | Ga0114129_101642842 | 265 |
| 216 | 3300009176 | Ga0105242_10300379 | Ga0105242_103003792 | 265 |
| 217 | 3300009177 | Ga0105248_10033477 | Ga0105248_100334774 | 265 |
| 218 | 3300009553 | Ga0105249_10101243 | Ga0105249_101012432 | 265 |
| 219 | 3300009553 | Ga0105249_10313914 | Ga0105249_103139143 | 265 |
| 220 | 3300013297 | Ga0157378_10077551 | Ga0157378_100775512 | 265 |
| 221 | 3300013297 | Ga0157378_10123113 | Ga0157378_101231132 | 265 |
| 222 | 3300013306 | Ga0163162_10017343 | Ga0163162_100173436 | 265 |
| 223 | 3300013306 | Ga0163162_10121440 | Ga0163162_101214403 | 265 |
| 224 | 3300013308 | Ga0157375_10158639 | Ga0157375_101586392 | 265 |
| 225 | 3300013308 | Ga0157375_10294390 | Ga0157375_102943902 | 265 |
| 226 | 3300014745 | Ga0157377_10046673 | Ga0157377_100466732 | 265 |
| 227 | 3300014745 | Ga0157377_10205412 | Ga0157377_102054122 | 265 |
| 228 | 3300014968 | Ga0157379_10108098 | Ga0157379_101080982 | 265 |
| 229 | 3300014968 | Ga0157379_10157195 | Ga0157379_101571952 | 265 |
| 230 | 3300025893 | Ga0207682_10046596 | Ga0207682_100465961 | 265 |
| 231 | 3300025893 | Ga0207682_10059512 | Ga0207682_100595122 | 265 |
| 232 | 3300025903 | Ga0207680_10174669 | Ga0207680_101746692 | 265 |
| 233 | 3300025907 | Ga0207645_10058343 | Ga0207645_100583432 | 265 |
| 234 | 3300025908 | Ga0207643_10003032 | Ga0207643_100030327 | 265 |
| 235 | 3300025908 | Ga0207643_10003777 | Ga0207643_100037777 | 265 |
| 236 | 3300025910 | Ga0207684_10101552 | Ga0207684_101015522 | 265 |
| 237 | 3300025918 | Ga0207662_10019120 | Ga0207662_100191203 | 265 |
| 238 | 3300025918 | Ga0207662_10104972 | Ga0207662_101049722 | 265 |
| 239 | 3300025922 | Ga0207646_10040848 | Ga0207646_100408482 | 265 |
| 240 | 3300025922 | Ga0207646_10129171 | Ga0207646_101291713 | 265 |
| 241 | 3300025925 | Ga0207650_10040396 | Ga0207650_100403961 | 265 |
| 242 | 3300025926 | Ga0207659_10000228 | Ga0207659_100002286 | 265 |
| 243 | 3300025926 | Ga0207659_10007986 | Ga0207659_100079863 | 265 |
| 244 | 3300025926 | Ga0207659_10551922 | Ga0207659_105519222 | 265 |
| 245 | 3300025931 | Ga0207644_10026302 | Ga0207644_100263024 | 265 |
| 246 | 3300025933 | Ga0207706_10085680 | Ga0207706_100856803 | 265 |
| 247 | 3300025933 | Ga0207706_10092710 | Ga0207706_100927102 | 265 |
| 248 | 3300025936 | Ga0207670_10002302 | Ga0207670_100023027 | 265 |
| 249 | 3300025938 | Ga0207704_10227723 | Ga0207704_102277232 | 265 |
| 250 | 3300025938 | Ga0207704_10286166 | Ga0207704_102861662 | 265 |
| 251 | 3300025940 | Ga0207691_10041837 | Ga0207691_100418373 | 265 |
| 252 | 3300025940 | Ga0207691_10314266 | Ga0207691_103142662 | 265 |
| 253 | 3300025940 | Ga0207691_10500017 | Ga0207691_105000172 | 265 |
| 254 | 3300025941 | Ga0207711_10013029 | Ga0207711_100130293 | 265 |
| 255 | 3300025942 | Ga0207689_10034373 | Ga0207689_100343732 | 265 |
| 256 | 3300025942 | Ga0207689_10147641 | Ga0207689_101476412 | 265 |
| 257 | 3300025942 | Ga0207689_10230799 | Ga0207689_102307992 | 265 |
| 258 | 3300025945 | Ga0207679_10193457 | Ga0207679_101934572 | 265 |
| 259 | 3300025945 | Ga0207679_10434786 | Ga0207679_104347861 | 265 |
| 260 | 3300025960 | Ga0207651_10105240 | Ga0207651_101052402 | 265 |
| 261 | 3300025960 | Ga0207651_10150080 | Ga0207651_101500802 | 265 |
| 262 | 3300025961 | Ga0207712_10011132 | Ga0207712_100111322 | 265 |
| 263 | 3300025972 | Ga0207668_10540422 | Ga0207668_105404221 | 265 |
| 264 | 3300025986 | Ga0207658_10078610 | Ga0207658_100786102 | 265 |
| 265 | 3300025986 | Ga0207658_10146400 | Ga0207658_101464002 | 265 |
| 266 | 3300026035 | Ga0207703_10004495 | Ga0207703_100044956 | 265 |
| 267 | 3300026088 | Ga0207641_10004085 | Ga0207641_1000408511 | 265 |
| 268 | 3300026088 | Ga0207641_10146165 | Ga0207641_101461652 | 265 |
| 269 | 3300026088 | Ga0207641_10420163 | Ga0207641_104201632 | 265 |
| 270 | 3300026089 | Ga0207648_10000600 | Ga0207648_1000060026 | 265 |
| 271 | 3300026089 | Ga0207648_10160643 | Ga0207648_101606432 | 265 |
| 272 | 3300026095 | Ga0207676_10118475 | Ga0207676_101184752 | 265 |
| 273 | 3300026116 | Ga0207674_10022060 | Ga0207674_100220602 | 265 |
| 274 | 3300026116 | Ga0207674_10073523 | Ga0207674_100735233 | 265 |
| 275 | 3300026118 | Ga0207675_100006784 | Ga0207675_1000067842 | 265 |
| 276 | 3300026118 | Ga0207675_100134754 | Ga0207675_1001347542 | 265 |
| 277 | 3300026121 | Ga0207683_10188639 | Ga0207683_101886391 | 265 |
| 278 | 3300027866 | Ga0209813_10085713 | Ga0209813_100857131 | 265 |
| 279 | 3300027907 | Ga0207428_10000520 | Ga0207428_1000052021 | 265 |
| 280 | 3300027907 | Ga0207428_10001137 | Ga0207428_100011378 | 265 |
| 281 | 3300027907 | Ga0207428_10034163 | Ga0207428_100341634 | 265 |
| 282 | 3300027907 | Ga0207428_10222166 | Ga0207428_102221661 | 265 |
| 283 | 3300028380 | Ga0268265_10000625 | Ga0268265_100006254 | 265 |
| 284 | 3300028380 | Ga0268265_10080446 | Ga0268265_100804464 | 265 |
| 285 | 3300028380 | Ga0268265_10217202 | Ga0268265_102172021 | 265 |
| 286 | 3300031852 | Ga0307410_10023683 | Ga0307410_100236832 | 265 |
| 287 | 3300031903 | Ga0307407_10016554 | Ga0307407_100165542 | 265 |
| 288 | 3300031995 | Ga0307409_100050991 | Ga0307409_1000509912 | 265 |
| 289 | 3300032004 | Ga0307414_10070249 | Ga0307414_100702492 | 265 |
| 290 | 3300035241 | Ga0373961_0031697 | Ga0373961_0031697_663_1460 | 265 |
| 291 | 3300035241 | Ga0373961_0040809 | Ga0373961_0040809_205_1002 | 265 |
| 292 | 3300035410 | Ga0373924_0108737 | Ga0373924_0108737_285_1082 | 265 |
| 293 | 3300045051 | Ga0451576_0039905 | Ga0451576_0039905_2781_3578 | 265 |
| 294 | 3300045051 | Ga0451576_0898351 | Ga0451576_0898351_110_907 | 265 |
| 295 | 3300046499 | Ga0495594_0031947 | Ga0495594_0031947_1386_2183 | 265 |
| 296 | 3300046538 | Ga0495609_0146421 | Ga0495609_0146421_147_944 | 265 |
| 297 | 3300046539 | Ga0495621_0005012 | Ga0495621_0005012_2268_3065 | 265 |
| 298 | 3300046539 | Ga0495621_0059996 | Ga0495621_0059996_172_969 | 265 |
| 299 | 3300046664 | Ga0495659_0006678 | Ga0495659_0006678_1248_2045 | 265 |
| 300 | 3300046664 | Ga0495659_0031667 | Ga0495659_0031667_946_1743 | 265 |
| 301 | 3300046664 | Ga0495659_0040473 | Ga0495659_0040473_322_1119 | 265 |
| 302 | 3300046674 | Ga0495588_0055134 | Ga0495588_0055134_570_1367 | 265 |
| 303 | 3300046684 | Ga0495669_0011309 | Ga0495669_0011309_790_1587 | 265 |
| 304 | 3300046684 | Ga0495669_0020113 | Ga0495669_0020113_640_1437 | 265 |
| 305 | 3300047315 | Ga0495581_0271130 | Ga0495581_0271130_164_961 | 265 |
| 306 | 3300047318 | Ga0495636_0072440 | Ga0495636_0072440_428_1225 | 265 |
| 307 | 3300047320 | Ga0495672_0047596 | Ga0495672_0047596_67_891 | 265 |
| 308 | 3300047445 | Ga0495677_0093182 | Ga0495677_0093182_270_1067 | 265 |
| 309 | 3300049568 | Ga0501031_0064864 | Ga0501031_0064864_417_1214 | 265 |
| 310 | 3300049576 | Ga0501040_0057652 | Ga0501040_0057652_1016_1813 | 265 |
| 311 | 3300049577 | Ga0501041_0043877 | Ga0501041_0043877_1417_2214 | 265 |
| 312 | 3300049578 | Ga0501042_0018949 | Ga0501042_0018949_2536_3333 | 265 |
| 313 | 3300049587 | Ga0501071_0062459 | Ga0501071_0062459_943_1740 | 265 |
| 314 | 3300049588 | Ga0501072_0275560 | Ga0501072_0275560_474_1271 | 265 |
| 315 | 3300049591 | Ga0501075_0189088 | Ga0501075_0189088_575_1372 | 265 |
| 316 | 3300049741 | Ga0501079_0073562 | Ga0501079_0073562_100_897 | 265 |
| 317 | 3300049743 | Ga0501081_0024651 | Ga0501081_0024651_1539_2336 | 265 |
| 318 | 3300049824 | Ga0501045_0068727 | Ga0501045_0068727_1418_2215 | 265 |
| 319 | 3300049824 | Ga0501045_0446195 | Ga0501045_0446195_28_825 | 265 |
| 320 | 3300050491 | nmdc:mga00v17_49896_c1 | nmdc:mga00v17_49896_c1_620_1438 | 265 |
| 321 | 3300050493 | nmdc:mga0k408_36773_c1 | nmdc:mga0k408_36773_c1_1235_2053 | 265 |
| 322 | 3300050494 | nmdc:mga06z11_7846_c1 | nmdc:mga06z11_7846_c1_400_1218 | 265 |
| 323 | 3300050495 | nmdc:mga04h51_121478_c1 | nmdc:mga04h51_121478_c1_71_889 | 265 |
| 324 | 3300050507 | nmdc:mga05p37_18629_c1 | nmdc:mga05p37_18629_c1_3833_4630 | 265 |
| 325 | 3300050507 | nmdc:mga05p37_25324_c1 | nmdc:mga05p37_25324_c1_219_1016 | 265 |
| 326 | 3300050508 | nmdc:mga09592_114052_c1 | nmdc:mga09592_114052_c1_557_1354 | 265 |
| 327 | 3300050508 | nmdc:mga09592_149037_c1 | nmdc:mga09592_149037_c1_182_979 | 265 |
| 328 | 3300050508 | nmdc:mga09592_266639_c1 | nmdc:mga09592_266639_c1_630_1427 | 265 |
| 329 | 3300050508 | nmdc:mga09592_512614_c1 | nmdc:mga09592_512614_c1_15_812 | 265 |
| 330 | 3300050509 | nmdc:mga0qj67_60928_c1 | nmdc:mga0qj67_60928_c1_240_1037 | 265 |
| 331 | 3300050511 | nmdc:mga08y16_139614_c1 | nmdc:mga08y16_139614_c1_1574_2371 | 265 |
| 332 | 3300050511 | nmdc:mga08y16_23882_c1 | nmdc:mga08y16_23882_c1_129_926 | 265 |
| 333 | 3300050511 | nmdc:mga08y16_497_c1 | nmdc:mga08y16_497_c1_17834_18631 | 265 |
| 334 | 3300050511 | nmdc:mga08y16_5024_c1 | nmdc:mga08y16_5024_c1_8845_9642 | 265 |
| 335 | 3300050511 | nmdc:mga08y16_9827_c1 | nmdc:mga08y16_9827_c1_3990_4787 | 265 |
| 336 | 3300050512 | nmdc:mga0n895_2029_c1 | nmdc:mga0n895_2029_c1_12019_12819 | 265 |
| 337 | 3300050512 | nmdc:mga0n895_67400_c1 | nmdc:mga0n895_67400_c1_954_1751 | 265 |
| 338 | 3300050512 | nmdc:mga0n895_7121_c1 | nmdc:mga0n895_7121_c1_911_1708 | 265 |
| 339 | 3300050513 | nmdc:mga0rr50_380943_c1 | nmdc:mga0rr50_380943_c1_207_1004 | 265 |
| 340 | 3300050515 | nmdc:mga0a205_163529_c1 | nmdc:mga0a205_163529_c1_535_1332 | 265 |
| 341 | 3300050515 | nmdc:mga0a205_2134_c1 | nmdc:mga0a205_2134_c1_6247_7047 | 265 |
| 342 | 3300053139 | Ga0500568_0007187 | Ga0500568_0007187_743_1567 | 265 |
| 343 | 3300060353 | Ga0501082_0025685 | Ga0501082_0025685_1778_2575 | 265 |
| 344 | 3300005330 | Ga0070690_100092726 | Ga0070690_1000927262 | 266 |
| 345 | 3300005338 | Ga0068868_100058567 | Ga0068868_1000585672 | 266 |
| 346 | 3300005338 | Ga0068868_100203706 | Ga0068868_1002037062 | 266 |
| 347 | 3300005341 | Ga0070691_10004293 | Ga0070691_100042934 | 266 |
| 348 | 3300005353 | Ga0070669_100158676 | Ga0070669_1001586762 | 266 |
| 349 | 3300005354 | Ga0070675_100034264 | Ga0070675_1000342644 | 266 |
| 350 | 3300005356 | Ga0070674_100001365 | Ga0070674_1000013652 | 266 |
| 351 | 3300005440 | Ga0070705_100003426 | Ga0070705_1000034267 | 266 |
| 352 | 3300005441 | Ga0070700_100123902 | Ga0070700_1001239022 | 266 |
| 353 | 3300005444 | Ga0070694_100061506 | Ga0070694_1000615062 | 266 |
| 354 | 3300005444 | Ga0070694_100136978 | Ga0070694_1001369781 | 266 |
| 355 | 3300005459 | Ga0068867_100395087 | Ga0068867_1003950872 | 266 |
| 356 | 3300005468 | Ga0070707_100038969 | Ga0070707_1000389695 | 266 |
| 357 | 3300005468 | Ga0070707_100540911 | Ga0070707_1005409112 | 266 |
| 358 | 3300005535 | Ga0070684_100372915 | Ga0070684_1003729152 | 266 |
| 359 | 3300005546 | Ga0070696_100002689 | Ga0070696_1000026899 | 266 |
| 360 | 3300005548 | Ga0070665_100003704 | Ga0070665_1000037048 | 266 |
| 361 | 3300005549 | Ga0070704_100004329 | Ga0070704_1000043293 | 266 |
| 362 | 3300005578 | Ga0068854_100041462 | Ga0068854_1000414622 | 266 |
| 363 | 3300005615 | Ga0070702_100008666 | Ga0070702_1000086662 | 266 |
| 364 | 3300005718 | Ga0068866_10133736 | Ga0068866_101337361 | 266 |
| 365 | 3300005719 | Ga0068861_100001719 | Ga0068861_1000017193 | 266 |
| 366 | 3300005842 | Ga0068858_100001376 | Ga0068858_10000137611 | 266 |
| 367 | 3300005843 | Ga0068860_100069683 | Ga0068860_1000696833 | 266 |
| 368 | 3300005985 | Ga0081539_10003673 | Ga0081539_100036737 | 266 |
| 369 | 3300006237 | Ga0097621_100137992 | Ga0097621_1001379923 | 266 |
| 370 | 3300006358 | Ga0068871_100002872 | Ga0068871_1000028725 | 266 |
| 371 | 3300006358 | Ga0068871_100314801 | Ga0068871_1003148012 | 266 |
| 372 | 3300006846 | Ga0075430_100531520 | Ga0075430_1005315201 | 266 |
| 373 | 3300006871 | Ga0075434_100002237 | Ga0075434_1000022376 | 266 |
| 374 | 3300006881 | Ga0068865_100083606 | Ga0068865_1000836062 | 266 |
| 375 | 3300006914 | Ga0075436_100001777 | Ga0075436_1000017776 | 266 |
| 376 | 3300007076 | Ga0075435_100000001 | Ga0075435_10000000179 | 266 |
| 377 | 3300009093 | Ga0105240_10717267 | Ga0105240_107172672 | 266 |
| 378 | 3300009094 | Ga0111539_10005632 | Ga0111539_100056325 | 266 |
| 379 | 3300009098 | Ga0105245_10026541 | Ga0105245_100265414 | 266 |
| 380 | 3300009098 | Ga0105245_10041928 | Ga0105245_100419284 | 266 |
| 381 | 3300009147 | Ga0114129_10423349 | Ga0114129_104233492 | 266 |
| 382 | 3300009148 | Ga0105243_10009456 | Ga0105243_100094563 | 266 |
| 383 | 3300009176 | Ga0105242_10008576 | Ga0105242_100085764 | 266 |
| 384 | 3300009176 | Ga0105242_10012513 | Ga0105242_100125133 | 266 |
| 385 | 3300009553 | Ga0105249_10089591 | Ga0105249_100895912 | 266 |
| 386 | 3300010375 | Ga0105239_10190646 | Ga0105239_101906462 | 266 |
| 387 | 3300013296 | Ga0157374_10048436 | Ga0157374_100484363 | 266 |
| 388 | 3300013306 | Ga0163162_10410988 | Ga0163162_104109882 | 266 |
| 389 | 3300014326 | Ga0157380_10370009 | Ga0157380_103700092 | 266 |
| 390 | 3300014968 | Ga0157379_10037275 | Ga0157379_100372752 | 266 |
| 391 | 3300014969 | Ga0157376_10035153 | Ga0157376_100351533 | 266 |
| 392 | 3300014969 | Ga0157376_10071558 | Ga0157376_100715583 | 266 |
| 393 | 3300015262 | Ga0182007_10047970 | Ga0182007_100479701 | 266 |
| 394 | 3300025899 | Ga0207642_10192949 | Ga0207642_101929491 | 266 |
| 395 | 3300025901 | Ga0207688_10198934 | Ga0207688_101989342 | 266 |
| 396 | 3300025922 | Ga0207646_10459631 | Ga0207646_104596312 | 266 |
| 397 | 3300025923 | Ga0207681_10073500 | Ga0207681_100735002 | 266 |
| 398 | 3300025926 | Ga0207659_10526184 | Ga0207659_105261841 | 266 |
| 399 | 3300025933 | Ga0207706_10100915 | Ga0207706_101009152 | 266 |
| 400 | 3300025934 | Ga0207686_10004308 | Ga0207686_100043084 | 266 |
| 401 | 3300025934 | Ga0207686_10048988 | Ga0207686_100489882 | 266 |
| 402 | 3300025937 | Ga0207669_10151967 | Ga0207669_101519671 | 266 |
| 403 | 3300025938 | Ga0207704_10066338 | Ga0207704_100663382 | 266 |
| 404 | 3300025941 | Ga0207711_10038837 | Ga0207711_100388373 | 266 |
| 405 | 3300025961 | Ga0207712_10086466 | Ga0207712_100864661 | 266 |
| 406 | 3300025981 | Ga0207640_10391353 | Ga0207640_103913531 | 266 |
| 407 | 3300026023 | Ga0207677_10176439 | Ga0207677_101764392 | 266 |
| 408 | 3300026075 | Ga0207708_10005596 | Ga0207708_100055965 | 266 |
| 409 | 3300026075 | Ga0207708_10069079 | Ga0207708_100690792 | 266 |
| 410 | 3300026089 | Ga0207648_10103151 | Ga0207648_101031513 | 266 |
| 411 | 3300026118 | Ga0207675_100000622 | Ga0207675_10000062224 | 266 |
| 412 | 3300027907 | Ga0207428_10210451 | Ga0207428_102104512 | 266 |
| 413 | 3300028379 | Ga0268266_10017934 | Ga0268266_100179345 | 266 |
| 414 | 3300028380 | Ga0268265_10015718 | Ga0268265_100157181 | 266 |
| 415 | 3300031548 | Ga0307408_100092559 | Ga0307408_1000925592 | 266 |
| 416 | 3300031727 | Ga0316576_10005089 | Ga0316576_100050896 | 266 |
| 417 | 3300031728 | Ga0316578_10107807 | Ga0316578_101078071 | 266 |
| 418 | 3300031824 | Ga0307413_10232295 | Ga0307413_102322951 | 266 |
| 419 | 3300031852 | Ga0307410_10086953 | Ga0307410_100869532 | 266 |
| 420 | 3300031901 | Ga0307406_10007779 | Ga0307406_100077793 | 266 |
| 421 | 3300031903 | Ga0307407_10106988 | Ga0307407_101069882 | 266 |
| 422 | 3300031911 | Ga0307412_10108622 | Ga0307412_101086221 | 266 |
| 423 | 3300031995 | Ga0307409_100043595 | Ga0307409_1000435952 | 266 |
| 424 | 3300031995 | Ga0307409_100165147 | Ga0307409_1001651473 | 266 |
| 425 | 3300032002 | Ga0307416_100083096 | Ga0307416_1000830962 | 266 |
| 426 | 3300032005 | Ga0307411_10130054 | Ga0307411_101300542 | 266 |
| 427 | 3300035120 | Ga0373957_0083148 | Ga0373957_0083148_349_1149 | 266 |
| 428 | 3300035691 | Ga0373931_0207263 | Ga0373931_0207263_53_853 | 266 |
| 429 | 3300035692 | Ga0373935_0371407 | Ga0373935_0371407_184_984 | 266 |
| 430 | 3300036712 | Ga0316584_0009181 | Ga0316584_0009181_4569_5369 | 266 |
| 431 | 3300042436 | Ga0439435_0054479 | Ga0439435_0054479_37_840 | 266 |
| 432 | 3300046459 | Ga0495629_0115366 | Ga0495629_0115366_361_1161 | 266 |
| 433 | 3300046683 | Ga0495658_0381104 | Ga0495658_0381104_82_882 | 266 |
| 434 | 3300048907 | Ga0496104_0118552 | Ga0496104_0118552_1411_2211 | 266 |
| 435 | 3300048917 | Ga0496114_0019072 | Ga0496114_0019072_3547_4347 | 266 |
| 436 | 3300048918 | Ga0496115_0021942 | Ga0496115_0021942_1927_2727 | 266 |
| 437 | 3300049526 | Ga0501303_004763 | Ga0501303_004763_20_820 | 266 |
| 438 | 3300050511 | nmdc:mga08y16_2693_c1 | nmdc:mga08y16_2693_c1_13909_14718 | 266 |
| 439 | 3300050512 | nmdc:mga0n895_23_c1 | nmdc:mga0n895_23_c1_7569_8369 | 266 |
| 440 | 3300050513 | nmdc:mga0rr50_11_c1 | nmdc:mga0rr50_11_c1_109269_110069 | 266 |
| 441 | 3300050513 | nmdc:mga0rr50_284899_c1 | nmdc:mga0rr50_284899_c1_116_916 | 266 |
| 442 | 3300050514 | nmdc:mga08x19_1418_c1 | nmdc:mga08x19_1418_c1_8358_9158 | 266 |
| 443 | 3300053085 | Ga0495619_0351826 | Ga0495619_0351826_38_838 | 266 |
| 444 | 3300059421 | Ga0590071_011264 | Ga0590071_011264_990_1790 | 266 |
| 445 | 3300059426 | Ga0590077_004270 | Ga0590077_004270_747_1547 | 266 |
| 446 | 3300003203 | JGI25406J46586_10006305 | JGI25406J46586_100063052 | 267 |
| 447 | 3300005290 | Ga0065712_10092521 | Ga0065712_100925212 | 267 |
| 448 | 3300005293 | Ga0065715_10115075 | Ga0065715_101150752 | 267 |
| 449 | 3300005340 | Ga0070689_100054379 | Ga0070689_1000543792 | 267 |
| 450 | 3300005353 | Ga0070669_100125095 | Ga0070669_1001250951 | 267 |
| 451 | 3300005354 | Ga0070675_100039245 | Ga0070675_1000392452 | 267 |
| 452 | 3300005444 | Ga0070694_100301039 | Ga0070694_1003010392 | 267 |
| 453 | 3300005445 | Ga0070708_100545999 | Ga0070708_1005459991 | 267 |
| 454 | 3300005518 | Ga0070699_100149510 | Ga0070699_1001495102 | 267 |
| 455 | 3300005545 | Ga0070695_100400251 | Ga0070695_1004002511 | 267 |
| 456 | 3300005546 | Ga0070696_100467734 | Ga0070696_1004677342 | 267 |
| 457 | 3300005549 | Ga0070704_100112961 | Ga0070704_1001129612 | 267 |
| 458 | 3300005844 | Ga0068862_100492929 | Ga0068862_1004929292 | 267 |
| 459 | 3300005985 | Ga0081539_10000535 | Ga0081539_1000053575 | 267 |
| 460 | 3300005985 | Ga0081539_10071960 | Ga0081539_100719601 | 267 |
| 461 | 3300006194 | Ga0075427_10022434 | Ga0075427_100224342 | 267 |
| 462 | 3300006195 | Ga0075366_10050057 | Ga0075366_100500572 | 267 |
| 463 | 3300006844 | Ga0075428_100043206 | Ga0075428_1000432063 | 267 |
| 464 | 3300006844 | Ga0075428_100055639 | Ga0075428_1000556391 | 267 |
| 465 | 3300006844 | Ga0075428_100078356 | Ga0075428_1000783564 | 267 |
| 466 | 3300006844 | Ga0075428_100150797 | Ga0075428_1001507972 | 267 |
| 467 | 3300006846 | Ga0075430_100035928 | Ga0075430_1000359283 | 267 |
| 468 | 3300006846 | Ga0075430_100112338 | Ga0075430_1001123382 | 267 |
| 469 | 3300006847 | Ga0075431_100013314 | Ga0075431_1000133142 | 267 |
| 470 | 3300006847 | Ga0075431_100022918 | Ga0075431_1000229185 | 267 |
| 471 | 3300006852 | Ga0075433_10025867 | Ga0075433_100258677 | 267 |
| 472 | 3300006852 | Ga0075433_10027375 | Ga0075433_100273754 | 267 |
| 473 | 3300006852 | Ga0075433_10048737 | Ga0075433_100487372 | 267 |
| 474 | 3300006852 | Ga0075433_10204864 | Ga0075433_102048642 | 267 |
| 475 | 3300006852 | Ga0075433_10406465 | Ga0075433_104064652 | 267 |
| 476 | 3300006871 | Ga0075434_100088906 | Ga0075434_1000889062 | 267 |
| 477 | 3300006880 | Ga0075429_100143830 | Ga0075429_1001438302 | 267 |
| 478 | 3300009094 | Ga0111539_10000716 | Ga0111539_1000071611 | 267 |
| 479 | 3300009094 | Ga0111539_10002028 | Ga0111539_100020288 | 267 |
| 480 | 3300009094 | Ga0111539_10488650 | Ga0111539_104886502 | 267 |
| 481 | 3300009094 | Ga0111539_10842732 | Ga0111539_108427321 | 267 |
| 482 | 3300009147 | Ga0114129_10024509 | Ga0114129_100245094 | 267 |
| 483 | 3300009147 | Ga0114129_10162336 | Ga0114129_101623362 | 267 |
| 484 | 3300014326 | Ga0157380_10101074 | Ga0157380_101010743 | 267 |
| 485 | 3300014326 | Ga0157380_10573331 | Ga0157380_105733311 | 267 |
| 486 | 3300025922 | Ga0207646_10105303 | Ga0207646_101053032 | 267 |
| 487 | 3300026075 | Ga0207708_10122048 | Ga0207708_101220483 | 267 |
| 488 | 3300026118 | Ga0207675_100020479 | Ga0207675_1000204792 | 267 |
| 489 | 3300027907 | Ga0207428_10000801 | Ga0207428_100008015 | 267 |
| 490 | 3300027907 | Ga0207428_10083185 | Ga0207428_100831852 | 267 |
| 491 | 3300028380 | Ga0268265_10042987 | Ga0268265_100429872 | 267 |
| 492 | 3300031911 | Ga0307412_10021911 | Ga0307412_100219112 | 267 |
| 493 | 3300031911 | Ga0307412_10359839 | Ga0307412_103598392 | 267 |
| 494 | 3300031995 | Ga0307409_100011654 | Ga0307409_1000116543 | 267 |
| 495 | 3300032126 | Ga0307415_100367199 | Ga0307415_1003671992 | 267 |
| 496 | 3300042437 | Ga0439444_0018384 | Ga0439444_0018384_253_1056 | 267 |
| 497 | 3300045051 | Ga0451576_0486180 | Ga0451576_0486180_73_876 | 267 |
| 498 | 3300049568 | Ga0501031_0143748 | Ga0501031_0143748_520_1323 | 267 |
| 499 | 3300049572 | Ga0501036_0237783 | Ga0501036_0237783_504_1307 | 267 |
| 500 | 3300049578 | Ga0501042_0046405 | Ga0501042_0046405_1029_1832 | 267 |
| 501 | 3300049588 | Ga0501072_0013878 | Ga0501072_0013878_4987_5790 | 267 |
| 502 | 3300049591 | Ga0501075_0015935 | Ga0501075_0015935_3660_4463 | 267 |
| 503 | 3300049592 | Ga0501076_0061474 | Ga0501076_0061474_413_1216 | 267 |
| 504 | 3300049741 | Ga0501079_0029263 | Ga0501079_0029263_695_1498 | 267 |
| 505 | 3300050493 | nmdc:mga0k408_118633_c1 | nmdc:mga0k408_118633_c1_106_936 | 267 |
| 506 | 3300050507 | nmdc:mga05p37_209343_c1 | nmdc:mga05p37_209343_c1_1075_1878 | 267 |
| 507 | 3300050507 | nmdc:mga05p37_687_c1 | nmdc:mga05p37_687_c1_34558_35361 | 267 |
| 508 | 3300050508 | nmdc:mga09592_104349_c1 | nmdc:mga09592_104349_c1_588_1391 | 267 |
| 509 | 3300050508 | nmdc:mga09592_131377_c1 | nmdc:mga09592_131377_c1_62_865 | 267 |
| 510 | 3300050508 | nmdc:mga09592_51094_c1 | nmdc:mga09592_51094_c1_2590_3396 | 267 |
| 511 | 3300050509 | nmdc:mga0qj67_181255_c1 | nmdc:mga0qj67_181255_c1_324_1127 | 267 |
| 512 | 3300050509 | nmdc:mga0qj67_46942_c1 | nmdc:mga0qj67_46942_c1_1450_2256 | 267 |
| 513 | 3300050510 | nmdc:mga06r32_131091_c1 | nmdc:mga06r32_131091_c1_1553_2356 | 267 |
| 514 | 3300050511 | nmdc:mga08y16_13137_c1 | nmdc:mga08y16_13137_c1_1926_2732 | 267 |
| 515 | 3300050511 | nmdc:mga08y16_52876_c1 | nmdc:mga08y16_52876_c1_3213_4016 | 267 |
| 516 | 3300050512 | nmdc:mga0n895_179855_c1 | nmdc:mga0n895_179855_c1_446_1249 | 267 |
| 517 | 3300050512 | nmdc:mga0n895_31680_c1 | nmdc:mga0n895_31680_c1_56_859 | 267 |
| 518 | 3300050513 | nmdc:mga0rr50_442199_c1 | nmdc:mga0rr50_442199_c1_14_817 | 267 |
| 519 | 3300050513 | nmdc:mga0rr50_60996_c1 | nmdc:mga0rr50_60996_c1_109_912 | 267 |
| 520 | 3300050515 | nmdc:mga0a205_160243_c1 | nmdc:mga0a205_160243_c1_447_1259 | 267 |
| 521 | 3300050515 | nmdc:mga0a205_397522_c1 | nmdc:mga0a205_397522_c1_287_1093 | 267 |
| 522 | 3300050515 | nmdc:mga0a205_40495_c1 | nmdc:mga0a205_40495_c1_2817_3620 | 267 |
| 523 | 3300050515 | nmdc:mga0a205_78372_c1 | nmdc:mga0a205_78372_c1_883_1686 | 267 |
| 524 | 3300054114 | Ga0501084_0335318 | Ga0501084_0335318_46_852 | 267 |
| 525 | 3300061734 | Ga0530510_0003289 | Ga0530510_0003289_6089_6892 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bk9-assembly2.cif.gz_G | h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris | 0.8346 | 11 | 267 |
| 1yw0-assembly1.cif.gz_B | crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13. | 0.8335 | 11 | 265 |
| 2nox-assembly4.cif.gz_O | crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans | 0.8329 | 11 | 267 |
| 2nox-assembly3.cif.gz_I | crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans | 0.8327 | 11 | 267 |
| 2nox-assembly4.cif.gz_M | crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans | 0.8317 | 11 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2noxJ00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8305 | 10 | 267 | 1.20.58.480 |
| 2noxJ00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8214 | 10 | 267 | 1.20.58.480 |
| 2nw9B00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8014 | 5 | 267 | 1.20.58.480 |
| 3bk9C00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.794 | 1 | 267 | 1.20.58.480 |
| 3bk9C00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7912 | 1 | 267 | 1.20.58.480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2J7U4-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9703 | 112 | 209 |
GO:0019441
GO:0020037 GO:0046872 GO:0051213 |
| AF-A0A3D2J7U4-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9329 | 112 | 209 |
GO:0019441
GO:0020037 GO:0046872 GO:0051213 |
| AF-A0A7C7K913-F1-model_v4 | deleted | 0.9244 | 54 | 267 |
|
| AF-K1Y6N8-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9227 | 68 | 267 |
GO:0004833
GO:0019441 GO:0019442 GO:0020037 GO:0046872 |
| AF-A0A388P2M3-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9166 | 38 | 267 |
GO:0004833
GO:0019441 GO:0019442 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar