F459228

General Info

Members Datasets Scaffolds Average Seq Length
525 235 525 265

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100125095|Ga0070669_1001250951
Length 290
Sequence VGSASRLQFVGSAFRRTVQQGAPVSDTPHDAAVTYGSYLRIDELLALQQPRSEGPEHDELLFIIVHQVYELWFKELLHELDRVIRLLQDDESHRAQHTLKRILTVLKVLVAQLDILETMTPLEFLSFRARLEAASGFQSDQFRQIEFVLGAKAEAAIARFPPASRARAALTARFTEPTLWDAFLRYLSREGYAVPPEQLARDVTATVVPSPVIQDLLIGLYRRDAKNAELCERLVDLDEGIQEWRYRHVRMVERTIGSKAGTGGSSGAAYLRNTVGGNLFPDLWEIRARL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 1.33
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006305 3300003203 Bacteria 5469
2 Ga0065714_10085730 3300005288 Bacteria 2135
3 Ga0065712_10067845 3300005290 Bacteria 26280
4 Ga0065712_10092521 3300005290 Bacteria 2328
5 Ga0065715_10007164 3300005293 Unclassified 4716
6 Ga0065715_10115075 3300005293 Bacteria 2427
7 Ga0065707_10098440 3300005295 Bacteria 3086
8 Ga0065707_10315156 3300005295 Bacteria 977
9 Ga0070676_10281937 3300005328 Bacteria 1120
10 Ga0070690_100039002 3300005330 Bacteria 3000
11 Ga0070690_100092726 3300005330 Bacteria 1992
12 Ga0070690_100327381 3300005330 Bacteria 1106
13 Ga0070670_100063953 3300005331 Bacteria 3157
14 Ga0070677_10054821 3300005333 Bacteria 1625
15 Ga0068869_100364433 3300005334 Bacteria 1181
16 Ga0068869_100429028 3300005334 Bacteria 1092
17 Ga0070680_100091660 3300005336 Bacteria 2516
18 Ga0068868_100058567 3300005338 Bacteria 3045
19 Ga0068868_100169667 3300005338 Bacteria 1806
20 Ga0068868_100203706 3300005338 Bacteria 1651
21 Ga0070689_100054379 3300005340 Bacteria 3099
22 Ga0070689_100094527 3300005340 Bacteria 2360
23 Ga0070689_100251710 3300005340 Bacteria 1458
24 Ga0070689_100336924 3300005340 Bacteria 1263
25 Ga0070691_10004293 3300005341 Bacteria 6474
26 Ga0070687_100003395 3300005343 Bacteria 6183
27 Ga0070687_100007844 3300005343 Bacteria 4485
28 Ga0070687_100055176 3300005343 Bacteria 2074
29 Ga0070692_10030212 3300005345 Bacteria 2708
30 Ga0070668_100780688 3300005347 Bacteria 847
31 Ga0070669_100118510 3300005353 Bacteria 2016
32 Ga0070669_100125095 3300005353 Bacteria 1966
33 Ga0070669_100158676 3300005353 Bacteria 1756
34 Ga0070675_100000179 3300005354 Bacteria 39545
35 Ga0070675_100006593 3300005354 Bacteria 8923
36 Ga0070675_100034264 3300005354 Bacteria 4120
37 Ga0070675_100039245 3300005354 Bacteria 3863
38 Ga0070675_100071309 3300005354 Bacteria 2882
39 Ga0070674_100001365 3300005356 Bacteria 12895
40 Ga0070673_100134835 3300005364 Bacteria 2077
41 Ga0070673_100150306 3300005364 Bacteria 1972
42 Ga0070673_100291709 3300005364 Bacteria 1434
43 Ga0070673_100598143 3300005364 Bacteria 1006
44 Ga0070688_100009438 3300005365 Bacteria 5337
45 Ga0070688_100047973 3300005365 Bacteria 2652
46 Ga0070667_100003115 3300005367 Bacteria 14253
47 Ga0070701_10008286 3300005438 Bacteria 4489
48 Ga0070701_10085993 3300005438 Bacteria 1713
49 Ga0070711_100351494 3300005439 Bacteria 1185
50 Ga0070705_100003426 3300005440 Bacteria 7778
51 Ga0070700_100123902 3300005441 Bacteria 1735
52 Ga0070694_100061506 3300005444 Bacteria 2563
53 Ga0070694_100136978 3300005444 Bacteria 1775
54 Ga0070694_100301039 3300005444 Bacteria 1229
55 Ga0070708_100545999 3300005445 Bacteria 1093
56 Ga0070708_100631144 3300005445 Bacteria 1010
57 Ga0070663_100549849 3300005455 Bacteria 965
58 Ga0070662_100484064 3300005457 Bacteria 1030
59 Ga0070681_10702895 3300005458 Bacteria 927
60 Ga0068867_100000594 3300005459 Bacteria 23939
61 Ga0068867_100068389 3300005459 Bacteria 2651
62 Ga0068867_100304923 3300005459 Bacteria 1314
63 Ga0068867_100395087 3300005459 Bacteria 1165
64 Ga0070685_10231851 3300005466 Bacteria 1215
65 Ga0070706_100077239 3300005467 Bacteria 3082
66 Ga0070707_100038969 3300005468 Bacteria 4541
67 Ga0070707_100046186 3300005468 Bacteria 4168
68 Ga0070707_100056411 3300005468 Bacteria 3768
69 Ga0070707_100540911 3300005468 Bacteria 1127
70 Ga0070698_100002373 3300005471 Bacteria 20779
71 Ga0070699_100000753 3300005518 Bacteria 29961
72 Ga0070699_100001411 3300005518 Bacteria 22076
73 Ga0070699_100149510 3300005518 Bacteria 2065
74 Ga0070684_100177056 3300005535 Bacteria 1938
75 Ga0070684_100372915 3300005535 Bacteria 1314
76 Ga0070672_100196376 3300005543 Bacteria 1686
77 Ga0070672_100228457 3300005543 Bacteria 1563
78 Ga0070672_100308847 3300005543 Bacteria 1342
79 Ga0070686_100000738 3300005544 Bacteria 18935
80 Ga0070686_100100327 3300005544 Bacteria 1954
81 Ga0070686_100102003 3300005544 Unclassified 1940
82 Ga0070695_100400251 3300005545 Bacteria 1041
83 Ga0070696_100002025 3300005546 Bacteria 13300
84 Ga0070696_100002689 3300005546 Bacteria 11784
85 Ga0070696_100111560 3300005546 Bacteria 1970
86 Ga0070696_100467734 3300005546 Bacteria 998
87 Ga0070665_100003704 3300005548 Bacteria 16190
88 Ga0070665_100018511 3300005548 Bacteria 6980
89 Ga0070665_100345130 3300005548 Bacteria 1494
90 Ga0070704_100002640 3300005549 Bacteria 10118
91 Ga0070704_100004329 3300005549 Bacteria 8207
92 Ga0070704_100112961 3300005549 Bacteria 2071
93 Ga0068855_100491325 3300005563 Bacteria 1335
94 Ga0068857_100357087 3300005577 Bacteria 1354
95 Ga0068854_100041462 3300005578 Bacteria 3253
96 Ga0068854_100085197 3300005578 Bacteria 2340
97 Ga0070702_100008666 3300005615 Bacteria 4938
98 Ga0068859_100006905 3300005617 Bacteria 11524
99 Ga0068859_100012855 3300005617 Bacteria 8408
100 Ga0068859_100520456 3300005617 Bacteria 1284
101 Ga0068864_100062807 3300005618 Bacteria 3218
102 Ga0068866_10133736 3300005718 Bacteria 1414
103 Ga0068861_100001719 3300005719 Bacteria 14042
104 Ga0068861_100030480 3300005719 Bacteria 3953
105 Ga0068861_100139517 3300005719 Bacteria 1977
106 Ga0068870_10009526 3300005840 Bacteria 4425
107 Ga0068863_100006722 3300005841 Bacteria 11274
108 Ga0068863_100556210 3300005841 Bacteria 1133
109 Ga0068858_100001376 3300005842 Bacteria 25081
110 Ga0068858_100016744 3300005842 Bacteria 6884
111 Ga0068858_100136441 3300005842 Bacteria 2302
112 Ga0068860_100013745 3300005843 Bacteria 7938
113 Ga0068860_100069683 3300005843 Bacteria 3343
114 Ga0068860_100242929 3300005843 Bacteria 1752
115 Ga0068862_100000554 3300005844 Bacteria 39072
116 Ga0068862_100010498 3300005844 Bacteria 7649
117 Ga0068862_100492929 3300005844 Bacteria 1162
118 Ga0081538_10039360 3300005981 Bacteria 3033
119 Ga0081539_10000535 3300005985 Bacteria 78890
120 Ga0081539_10003673 3300005985 Bacteria 18392
121 Ga0081539_10071960 3300005985 Bacteria 1850
122 Ga0075432_10090732 3300006058 Bacteria 1118
123 Ga0075427_10022434 3300006194 Bacteria 1008
124 Ga0075366_10050057 3300006195 Bacteria 2480
125 Ga0075366_10075968 3300006195 Bacteria 2004
126 Ga0097621_100083241 3300006237 Bacteria 2666
127 Ga0097621_100137992 3300006237 Bacteria 2082
128 Ga0097621_100384733 3300006237 Bacteria 1254
129 Ga0068871_100002872 3300006358 Bacteria 11810
130 Ga0068871_100314801 3300006358 Bacteria 1377
131 Ga0068871_100456636 3300006358 Bacteria 1146
132 Ga0075428_100004797 3300006844 Bacteria 14992
133 Ga0075428_100022970 3300006844 Bacteria 6903
134 Ga0075428_100043206 3300006844 Bacteria 4954
135 Ga0075428_100047355 3300006844 Bacteria 4723
136 Ga0075428_100055639 3300006844 Bacteria 4335
137 Ga0075428_100078356 3300006844 Bacteria 3607
138 Ga0075428_100083210 3300006844 Bacteria 3491
139 Ga0075428_100114242 3300006844 Bacteria 2941
140 Ga0075428_100150797 3300006844 Bacteria 2525
141 Ga0075430_100004000 3300006846 Bacteria 12430
142 Ga0075430_100035928 3300006846 Bacteria 4202
143 Ga0075430_100069036 3300006846 Bacteria 2965
144 Ga0075430_100112338 3300006846 Bacteria 2271
145 Ga0075430_100221724 3300006846 Bacteria 1569
146 Ga0075430_100531520 3300006846 Bacteria 970
147 Ga0075431_100013314 3300006847 Bacteria 8312
148 Ga0075431_100022918 3300006847 Bacteria 6382
149 Ga0075431_100111164 3300006847 Bacteria 2828
150 Ga0075431_100475572 3300006847 Bacteria 1243
151 Ga0075431_100555562 3300006847 Bacteria 1135
152 Ga0075433_10000108 3300006852 Bacteria 40852
153 Ga0075433_10001967 3300006852 Bacteria 15444
154 Ga0075433_10021911 3300006852 Bacteria 5361
155 Ga0075433_10025867 3300006852 Bacteria 4964
156 Ga0075433_10027375 3300006852 Bacteria 4835
157 Ga0075433_10048737 3300006852 Bacteria 3685
158 Ga0075433_10097770 3300006852 Unclassified 2598
159 Ga0075433_10097917 3300006852 Unclassified 2596
160 Ga0075433_10204864 3300006852 Bacteria 1754
161 Ga0075433_10406465 3300006852 Bacteria 1201
162 Ga0075434_100002237 3300006871 Bacteria 16907
163 Ga0075434_100004749 3300006871 Bacteria 12294
164 Ga0075434_100011544 3300006871 Bacteria 8335
165 Ga0075434_100051020 3300006871 Bacteria 4110
166 Ga0075434_100088906 3300006871 Bacteria 3091
167 Ga0075434_100092236 3300006871 Bacteria 3031
168 Ga0075429_100024224 3300006880 Bacteria 5265
169 Ga0075429_100035146 3300006880 Bacteria 4357
170 Ga0075429_100040041 3300006880 Unclassified 4079
171 Ga0075429_100143830 3300006880 Bacteria 2087
172 Ga0075429_100470933 3300006880 Bacteria 1101
173 Ga0075429_100526398 3300006880 Bacteria 1036
174 Ga0068865_100083606 3300006881 Bacteria 2298
175 Ga0075436_100001777 3300006914 Bacteria 14787
176 Ga0075436_100124226 3300006914 Bacteria 1807
177 Ga0097620_100006905 3300006931 Bacteria 11524
178 Ga0097620_100012855 3300006931 Bacteria 8408
179 Ga0097620_100520471 3300006931 Bacteria 1284
180 Ga0075435_100000001 3300007076 Bacteria 207579
181 Ga0075435_100056313 3300007076 Bacteria 3178
182 Ga0075435_100074012 3300007076 Bacteria 2786
183 Ga0075435_100156707 3300007076 Bacteria 1916
184 Ga0075435_100487550 3300007076 Bacteria 1065
185 Ga0105240_10092216 3300009093 Bacteria 3699
186 Ga0105240_10717267 3300009093 Bacteria 1090
187 Ga0111539_10000057 3300009094 Bacteria 114860
188 Ga0111539_10000716 3300009094 Bacteria 43096
189 Ga0111539_10002028 3300009094 Bacteria 27050
190 Ga0111539_10002648 3300009094 Bacteria 23735
191 Ga0111539_10005632 3300009094 Bacteria 16197
192 Ga0111539_10039744 3300009094 Bacteria 5668
193 Ga0111539_10051926 3300009094 Bacteria 4881
194 Ga0111539_10115757 3300009094 Bacteria 3143
195 Ga0111539_10163313 3300009094 Bacteria 2605
196 Ga0111539_10364443 3300009094 Bacteria 1682
197 Ga0111539_10488650 3300009094 Bacteria 1434
198 Ga0111539_10715740 3300009094 Bacteria 1165
199 Ga0111539_10842732 3300009094 Bacteria 1067
200 Ga0105245_10026541 3300009098 Bacteria 5099
201 Ga0105245_10041928 3300009098 Bacteria 4081
202 Ga0114129_10000428 3300009147 Bacteria 49983
203 Ga0114129_10001744 3300009147 Bacteria 29582
204 Ga0114129_10005185 3300009147 Bacteria 18350
205 Ga0114129_10013146 3300009147 Bacteria 11794
206 Ga0114129_10024509 3300009147 Bacteria 8548
207 Ga0114129_10091866 3300009147 Bacteria 4204
208 Ga0114129_10134143 3300009147 Bacteria 3398
209 Ga0114129_10153920 3300009147 Bacteria 3146
210 Ga0114129_10162336 3300009147 Bacteria 3051
211 Ga0114129_10164284 3300009147 Bacteria 3031
212 Ga0114129_10198387 3300009147 Bacteria 2720
213 Ga0114129_10218788 3300009147 Bacteria 2571
214 Ga0114129_10258379 3300009147 Bacteria 2336
215 Ga0114129_10423349 3300009147 Bacteria 1751
216 Ga0105243_10009456 3300009148 Bacteria 7425
217 Ga0105241_10063516 3300009174 Bacteria 2849
218 Ga0105242_10008576 3300009176 Bacteria 7848
219 Ga0105242_10012513 3300009176 Bacteria 6532
220 Ga0105242_10300379 3300009176 Bacteria 1465
221 Ga0105248_10033477 3300009177 Bacteria 5741
222 Ga0105248_10109429 3300009177 Bacteria 3115
223 Ga0105249_10089591 3300009553 Bacteria 2875
224 Ga0105249_10101243 3300009553 Bacteria 2709
225 Ga0105249_10313914 3300009553 Bacteria 1577
226 Ga0105239_10190646 3300010375 Bacteria 2295
227 Ga0105239_10750805 3300010375 Bacteria 1117
228 Ga0157374_10048436 3300013296 Bacteria 3943
229 Ga0157378_10077551 3300013297 Bacteria 2996
230 Ga0157378_10123113 3300013297 Bacteria 2393
231 Ga0163162_10017343 3300013306 Bacteria 7046
232 Ga0163162_10121440 3300013306 Bacteria 2717
233 Ga0163162_10410988 3300013306 Bacteria 1486
234 Ga0157375_10158639 3300013308 Bacteria 2403
235 Ga0157375_10294390 3300013308 Bacteria 1786
236 Ga0157375_10555011 3300013308 Bacteria 1310
237 Ga0157380_10101074 3300014326 Bacteria 2402
238 Ga0157380_10163445 3300014326 Bacteria 1937
239 Ga0157380_10370009 3300014326 Bacteria 1348
240 Ga0157380_10573331 3300014326 Bacteria 1111
241 Ga0157377_10046673 3300014745 Bacteria 2424
242 Ga0157377_10205412 3300014745 Bacteria 1253
243 Ga0157377_10232098 3300014745 Unclassified 1187
244 Ga0157379_10037275 3300014968 Bacteria 4335
245 Ga0157379_10108098 3300014968 Bacteria 2497
246 Ga0157379_10157195 3300014968 Bacteria 2051
247 Ga0157376_10035153 3300014969 Bacteria 4052
248 Ga0157376_10071558 3300014969 Bacteria 2947
249 Ga0182007_10047970 3300015262 Bacteria 1412
250 Ga0207682_10046596 3300025893 Bacteria 1782
251 Ga0207682_10059512 3300025893 Bacteria 1596
252 Ga0207642_10192949 3300025899 Bacteria 1119
253 Ga0207688_10198934 3300025901 Bacteria 1201
254 Ga0207680_10174669 3300025903 Bacteria 1449
255 Ga0207680_10350837 3300025903 Bacteria 1036
256 Ga0207645_10058343 3300025907 Bacteria 2464
257 Ga0207643_10003032 3300025908 Bacteria 9037
258 Ga0207643_10003777 3300025908 Bacteria 8139
259 Ga0207684_10101552 3300025910 Bacteria 2459
260 Ga0207695_10097445 3300025913 Bacteria 2942
261 Ga0207660_10348858 3300025917 Bacteria 1186
262 Ga0207662_10007576 3300025918 Bacteria 5913
263 Ga0207662_10019120 3300025918 Bacteria 3894
264 Ga0207662_10104972 3300025918 Bacteria 1755
265 Ga0207646_10040848 3300025922 Bacteria 4171
266 Ga0207646_10105303 3300025922 Bacteria 2529
267 Ga0207646_10129171 3300025922 Bacteria 2274
268 Ga0207646_10459631 3300025922 Bacteria 1148
269 Ga0207681_10073500 3300025923 Bacteria 2392
270 Ga0207650_10040396 3300025925 Bacteria 3414
271 Ga0207659_10000228 3300025926 Bacteria 34204
272 Ga0207659_10005179 3300025926 Bacteria 7903
273 Ga0207659_10007986 3300025926 Bacteria 6541
274 Ga0207659_10526184 3300025926 Bacteria 1003
275 Ga0207659_10551922 3300025926 Bacteria 979
276 Ga0207644_10026302 3300025931 Bacteria 4008
277 Ga0207706_10085680 3300025933 Bacteria 2770
278 Ga0207706_10092710 3300025933 Bacteria 2656
279 Ga0207706_10100915 3300025933 Bacteria 2539
280 Ga0207706_10513796 3300025933 Bacteria 1033
281 Ga0207686_10004308 3300025934 Bacteria 7632
282 Ga0207686_10048988 3300025934 Bacteria 2620
283 Ga0207670_10002302 3300025936 Bacteria 10011
284 Ga0207669_10151967 3300025937 Bacteria 1623
285 Ga0207704_10066338 3300025938 Bacteria 2265
286 Ga0207704_10227723 3300025938 Bacteria 1384
287 Ga0207704_10286166 3300025938 Bacteria 1255
288 Ga0207691_10041837 3300025940 Bacteria 4227
289 Ga0207691_10314266 3300025940 Bacteria 1344
290 Ga0207691_10500017 3300025940 Bacteria 1032
291 Ga0207711_10013029 3300025941 Bacteria 6906
292 Ga0207711_10038837 3300025941 Bacteria 4048
293 Ga0207689_10034373 3300025942 Bacteria 4211
294 Ga0207689_10147641 3300025942 Bacteria 1937
295 Ga0207689_10230799 3300025942 Bacteria 1529
296 Ga0207679_10193457 3300025945 Bacteria 1693
297 Ga0207679_10434786 3300025945 Bacteria 1161
298 Ga0207667_10422600 3300025949 Bacteria 1356
299 Ga0207651_10105240 3300025960 Bacteria 2104
300 Ga0207651_10150080 3300025960 Bacteria 1813
301 Ga0207712_10011132 3300025961 Bacteria 5726
302 Ga0207712_10086466 3300025961 Bacteria 2296
303 Ga0207668_10540422 3300025972 Bacteria 1008
304 Ga0207640_10047741 3300025981 Bacteria 2763
305 Ga0207640_10391353 3300025981 Bacteria 1129
306 Ga0207658_10078610 3300025986 Bacteria 2521
307 Ga0207658_10146400 3300025986 Bacteria 1919
308 Ga0207677_10176439 3300026023 Bacteria 1676
309 Ga0207703_10004495 3300026035 Bacteria 11448
310 Ga0207708_10005596 3300026075 Bacteria 9271
311 Ga0207708_10069079 3300026075 Bacteria 2704
312 Ga0207708_10122048 3300026075 Bacteria 2031
313 Ga0207641_10004085 3300026088 Bacteria 12730
314 Ga0207641_10146165 3300026088 Bacteria 2138
315 Ga0207641_10420163 3300026088 Bacteria 1287
316 Ga0207648_10000600 3300026089 Bacteria 40518
317 Ga0207648_10103151 3300026089 Bacteria 2501
318 Ga0207648_10160643 3300026089 Bacteria 1984
319 Ga0207648_10294496 3300026089 Bacteria 1454
320 Ga0207676_10118475 3300026095 Bacteria 2228
321 Ga0207674_10022060 3300026116 Bacteria 6846
322 Ga0207674_10073523 3300026116 Bacteria 3432
323 Ga0207675_100000622 3300026118 Bacteria 34726
324 Ga0207675_100006784 3300026118 Bacteria 10833
325 Ga0207675_100018513 3300026118 Bacteria 6496
326 Ga0207675_100020479 3300026118 Bacteria 6165
327 Ga0207675_100134754 3300026118 Bacteria 2343
328 Ga0207675_100609090 3300026118 Bacteria 1096
329 Ga0207683_10188639 3300026121 Bacteria 1871
330 Ga0207683_10508838 3300026121 Bacteria 1112
331 Ga0209813_10085713 3300027866 Bacteria 1049
332 Ga0207428_10000520 3300027907 Bacteria 46036
333 Ga0207428_10000801 3300027907 Bacteria 35543
334 Ga0207428_10000838 3300027907 Bacteria 34614
335 Ga0207428_10001137 3300027907 Bacteria 28857
336 Ga0207428_10034163 3300027907 Bacteria 4170
337 Ga0207428_10083185 3300027907 Bacteria 2497
338 Ga0207428_10210451 3300027907 Bacteria 1461
339 Ga0207428_10222166 3300027907 Bacteria 1416
340 Ga0268266_10017934 3300028379 Bacteria 6034
341 Ga0268266_10171169 3300028379 Bacteria 1971
342 Ga0268265_10000625 3300028380 Bacteria 35281
343 Ga0268265_10015718 3300028380 Bacteria 5185
344 Ga0268265_10042987 3300028380 Bacteria 3356
345 Ga0268265_10080446 3300028380 Bacteria 2569
346 Ga0268265_10217202 3300028380 Bacteria 1670
347 Ga0268264_10744485 3300028381 Bacteria 976
348 Ga0307408_100092559 3300031548 Bacteria 2285
349 Ga0316576_10005089 3300031727 Bacteria 7976
350 Ga0316578_10107807 3300031728 Unclassified 1672
351 Ga0307405_10325945 3300031731 Bacteria 1175
352 Ga0307413_10232295 3300031824 Bacteria 1355
353 Ga0307410_10023683 3300031852 Bacteria 3822
354 Ga0307410_10086953 3300031852 Bacteria 2209
355 Ga0307406_10007779 3300031901 Bacteria 5958
356 Ga0307406_10105796 3300031901 Bacteria 1926
357 Ga0307407_10016554 3300031903 Bacteria 3673
358 Ga0307407_10106988 3300031903 Bacteria 1748
359 Ga0307412_10021911 3300031911 Bacteria 3909
360 Ga0307412_10104091 3300031911 Bacteria 2013
361 Ga0307412_10108622 3300031911 Bacteria 1976
362 Ga0307412_10202992 3300031911 Bacteria 1507
363 Ga0307412_10359839 3300031911 Bacteria 1171
364 Ga0307409_100011654 3300031995 Bacteria 5558
365 Ga0307409_100043595 3300031995 Bacteria 3370
366 Ga0307409_100050991 3300031995 Bacteria 3164
367 Ga0307409_100165147 3300031995 Bacteria 1942
368 Ga0307416_100080219 3300032002 Bacteria 2753
369 Ga0307416_100083096 3300032002 Bacteria 2715
370 Ga0307414_10070249 3300032004 Bacteria 2521
371 Ga0307411_10130054 3300032005 Bacteria 1838
372 Ga0307415_100367199 3300032126 Bacteria 1217
373 Ga0373958_0007891 3300034819 Bacteria 1708
374 Ga0373959_0007134 3300034820 Bacteria 1874
375 Ga0373938_0000129 3300034957 Bacteria 10674
376 Ga0373928_0002380 3300035084 Bacteria 3652
377 Ga0373929_0006263 3300035085 Bacteria 2148
378 Ga0373940_0002309 3300035088 Bacteria 3684
379 Ga0373949_0001063 3300035090 Bacteria 8403
380 Ga0373951_0006631 3300035091 Bacteria 2644
381 Ga0373952_0042161 3300035092 Bacteria 1058
382 Ga0373932_0000292 3300035112 Bacteria 15083
383 Ga0373939_0000836 3300035114 Bacteria 7629
384 Ga0373941_0000847 3300035115 Bacteria 6307
385 Ga0373957_0083148 3300035120 Bacteria 1266
386 Ga0373960_0001074 3300035121 Bacteria 5896
387 Ga0373942_0001090 3300035207 Bacteria 7272
388 Ga0373961_0031697 3300035241 Bacteria 1478
389 Ga0373961_0040809 3300035241 Bacteria 1339
390 Ga0373962_0011777 3300035242 Bacteria 2196
391 Ga0373924_0108737 3300035410 Bacteria 1197
392 Ga0373931_0207263 3300035691 Bacteria 1174
393 Ga0373935_0371407 3300035692 Bacteria 1023
394 Ga0316584_0009181 3300036712 Bacteria 6849
395 Ga0439441_032344 3300042001 Bacteria 1019
396 Ga0439462_0016556 3300042015 Bacteria 1905
397 Ga0439434_0001966 3300042435 Bacteria 5951
398 Ga0439435_0054479 3300042436 Bacteria 1152
399 Ga0439444_0018384 3300042437 Bacteria 1210
400 Ga0439444_0029074 3300042437 Bacteria 1027
401 Ga0439464_0004793 3300042439 Bacteria 3466
402 Ga0451576_0039905 3300045051 Bacteria 4969
403 Ga0451576_0486180 3300045051 Bacteria 1297
404 Ga0451576_0898351 3300045051 Bacteria 929
405 Ga0495629_0115366 3300046459 Bacteria 1872
406 Ga0495594_0031947 3300046499 Bacteria 2856
407 Ga0495598_0004303 3300046537 Bacteria 3076
408 Ga0495609_0146421 3300046538 Bacteria 1006
409 Ga0495621_0005012 3300046539 Bacteria 3776
410 Ga0495621_0059996 3300046539 Bacteria 1379
411 Ga0495659_0006010 3300046664 Bacteria 3835
412 Ga0495659_0006678 3300046664 Bacteria 3646
413 Ga0495659_0031667 3300046664 Bacteria 1847
414 Ga0495659_0040473 3300046664 Bacteria 1661
415 Ga0495588_0055134 3300046674 Bacteria 2051
416 Ga0495658_0381104 3300046683 Bacteria 898
417 Ga0495669_0011309 3300046684 Bacteria 3789
418 Ga0495669_0020113 3300046684 Bacteria 2886
419 Ga0495670_0058597 3300046691 Bacteria 1933
420 Ga0495581_0271130 3300047315 Bacteria 992
421 Ga0495636_0072440 3300047318 Bacteria 1473
422 Ga0495672_0047596 3300047320 Bacteria 2549
423 Ga0495677_0093182 3300047445 Bacteria 1136
424 Ga0496100_0150609 3300048903 Bacteria 1659
425 Ga0496101_0116475 3300048904 Bacteria 2016
426 Ga0496102_0039401 3300048905 Bacteria 4270
427 Ga0496104_0118552 3300048907 Bacteria 2541
428 Ga0496109_0282954 3300048912 Bacteria 1563
429 Ga0496114_0019072 3300048917 Bacteria 5558
430 Ga0496115_0021942 3300048918 Bacteria 4938
431 Ga0501303_004763 3300049526 Bacteria 1132
432 Ga0501031_0064864 3300049568 Unclassified 2379
433 Ga0501031_0143748 3300049568 Bacteria 1559
434 Ga0501036_0237783 3300049572 Bacteria 1528
435 Ga0501040_0057652 3300049576 Bacteria 2667
436 Ga0501041_0043877 3300049577 Bacteria 2718
437 Ga0501042_0018949 3300049578 Bacteria 4773
438 Ga0501042_0046405 3300049578 Bacteria 3097
439 Ga0501071_0062459 3300049587 Bacteria 2699
440 Ga0501072_0013878 3300049588 Bacteria 6173
441 Ga0501072_0275560 3300049588 Unclassified 1338
442 Ga0501075_0015935 3300049591 Bacteria 5405
443 Ga0501075_0189088 3300049591 Bacteria 1570
444 Ga0501076_0061474 3300049592 Bacteria 2989
445 Ga0501079_0029263 3300049741 Bacteria 4229
446 Ga0501079_0073562 3300049741 Bacteria 2641
447 Ga0501081_0024651 3300049743 Bacteria 4041
448 Ga0501045_0068727 3300049824 Bacteria 2603
449 Ga0501045_0446195 3300049824 Bacteria 962
450 nmdc:mga00v17_49896_c1 3300050491 Unclassified 2540
451 nmdc:mga0k408_118633_c1 3300050493 Bacteria 1566
452 nmdc:mga0k408_36773_c1 3300050493 Bacteria 2810
453 nmdc:mga06z11_7846_c1 3300050494 Bacteria 4416
454 nmdc:mga04h51_121478_c1 3300050495 Bacteria 973
455 nmdc:mga05p37_10459_c1 3300050507 Bacteria 11012
456 nmdc:mga05p37_18629_c1 3300050507 Bacteria 8388
457 nmdc:mga05p37_209343_c1 3300050507 Bacteria 2358
458 nmdc:mga05p37_231858_c1 3300050507 Bacteria 2224
459 nmdc:mga05p37_25324_c1 3300050507 Bacteria 7216
460 nmdc:mga05p37_425952_c1 3300050507 Bacteria 1543
461 nmdc:mga05p37_425984_c1 3300050507 Bacteria 1543
462 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
463 nmdc:mga05p37_7441_c1 3300050507 Bacteria 12912
464 nmdc:mga09592_104349_c1 3300050508 Bacteria 2429
465 nmdc:mga09592_114052_c1 3300050508 Bacteria 2319
466 nmdc:mga09592_131377_c1 3300050508 Bacteria 2154
467 nmdc:mga09592_149037_c1 3300050508 Unclassified 2018
468 nmdc:mga09592_266639_c1 3300050508 Bacteria 1485
469 nmdc:mga09592_27048_c1 3300050508 Bacteria 4757
470 nmdc:mga09592_51094_c1 3300050508 Bacteria 3487
471 nmdc:mga09592_512614_c1 3300050508 Bacteria 1032
472 nmdc:mga09592_54226_c1 3300050508 Bacteria 3387
473 nmdc:mga09592_630844_c1 3300050508 Bacteria 916
474 nmdc:mga0qj67_10057_c1 3300050509 Bacteria 7059
475 nmdc:mga0qj67_181255_c1 3300050509 Bacteria 1711
476 nmdc:mga0qj67_46942_c1 3300050509 Bacteria 3411
477 nmdc:mga0qj67_60928_c1 3300050509 Bacteria 2995
478 nmdc:mga06r32_131091_c1 3300050510 Bacteria 2479
479 nmdc:mga06r32_214999_c1 3300050510 Bacteria 1910
480 nmdc:mga06r32_358525_c1 3300050510 Bacteria 1442
481 nmdc:mga06r32_44120_c1 3300050510 Bacteria 4245
482 nmdc:mga08y16_13137_c1 3300050511 Bacteria 8712
483 nmdc:mga08y16_139614_c1 3300050511 Bacteria 2519
484 nmdc:mga08y16_2353_c1 3300050511 Bacteria 19387
485 nmdc:mga08y16_23882_c1 3300050511 Bacteria 6457
486 nmdc:mga08y16_2693_c1 3300050511 Bacteria 18229
487 nmdc:mga08y16_497_c1 3300050511 Bacteria 36217
488 nmdc:mga08y16_5024_c1 3300050511 Bacteria 13831
489 nmdc:mga08y16_52876_c1 3300050511 Bacteria 4248
490 nmdc:mga08y16_9827_c1 3300050511 Bacteria 10043
491 nmdc:mga0n895_179855_c1 3300050512 Bacteria 2146
492 nmdc:mga0n895_2029_c1 3300050512 Bacteria 15577
493 nmdc:mga0n895_23_c1 3300050512 Bacteria 92165
494 nmdc:mga0n895_31680_c1 3300050512 Bacteria 5066
495 nmdc:mga0n895_348344_c1 3300050512 Bacteria 1500
496 nmdc:mga0n895_67400_c1 3300050512 Bacteria 3545
497 nmdc:mga0n895_7121_c1 3300050512 Bacteria 9563
498 nmdc:mga0n895_98706_c1 3300050512 Bacteria 2928
499 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
500 nmdc:mga0rr50_284899_c1 3300050513 Bacteria 1379
501 nmdc:mga0rr50_380943_c1 3300050513 Bacteria 1189
502 nmdc:mga0rr50_442199_c1 3300050513 Bacteria 1102
503 nmdc:mga0rr50_60996_c1 3300050513 Bacteria 2840
504 nmdc:mga08x19_1418_c1 3300050514 Bacteria 14813
505 nmdc:mga08x19_327940_c1 3300050514 Bacteria 1066
506 nmdc:mga0a205_160243_c1 3300050515 Bacteria 2147
507 nmdc:mga0a205_163529_c1 3300050515 Unclassified 2121
508 nmdc:mga0a205_2134_c1 3300050515 Bacteria 17370
509 nmdc:mga0a205_397522_c1 3300050515 Bacteria 1242
510 nmdc:mga0a205_40495_c1 3300050515 Bacteria 4485
511 nmdc:mga0a205_48625_c1 3300050515 Unclassified 4093
512 nmdc:mga0a205_663_c1 3300050515 Bacteria 27409
513 nmdc:mga0a205_78372_c1 3300050515 Bacteria 3192
514 nmdc:mga0a205_8896_c1 3300050515 Bacteria 9151
515 Ga0495619_0351826 3300053085 Bacteria 1019
516 Ga0500568_0007187 3300053139 Bacteria 5489
517 Ga0501084_0335318 3300054114 Bacteria 1277
518 Ga0590071_011264 3300059421 Bacteria 2092
519 Ga0590075_000949 3300059424 Bacteria 7539
520 Ga0590075_010239 3300059424 Bacteria 2256
521 Ga0590077_002784 3300059426 Bacteria 3680
522 Ga0590077_004270 3300059426 Bacteria 2942
523 Ga0590077_008914 3300059426 Bacteria 2054
524 Ga0501082_0025685 3300060353 Bacteria 5076
525 Ga0530510_0003289 3300061734 Bacteria 11122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100018511 Ga0070665_1000185112 249
2 3300028379 Ga0268266_10171169 Ga0268266_101711692 249
3 3300005340 Ga0070689_100336924 Ga0070689_1003369241 252
4 3300005466 Ga0070685_10231851 Ga0070685_102318512 252
5 3300005577 Ga0068857_100357087 Ga0068857_1003570872 252
6 3300009094 Ga0111539_10715740 Ga0111539_107157402 252
7 3300009147 Ga0114129_10198387 Ga0114129_101983873 252
8 3300009147 Ga0114129_10001744 Ga0114129_100017445 253
9 3300013308 Ga0157375_10555011 Ga0157375_105550112 253
10 3300025926 Ga0207659_10005179 Ga0207659_100051796 253
11 3300026118 Ga0207675_100609090 Ga0207675_1006090902 253
12 3300028381 Ga0268264_10744485 Ga0268264_107444852 253
13 3300050507 nmdc:mga05p37_231858_c1 nmdc:mga05p37_231858_c1_27_824 253
14 3300006847 Ga0075431_100111164 Ga0075431_1001111643 256
15 3300009147 Ga0114129_10258379 Ga0114129_102583792 256
16 3300050507 nmdc:mga05p37_425984_c1 nmdc:mga05p37_425984_c1_671_1471 256
17 3300050510 nmdc:mga06r32_214999_c1 nmdc:mga06r32_214999_c1_308_1114 256
18 3300005445 Ga0070708_100631144 Ga0070708_1006311441 259
19 3300048903 Ga0496100_0150609 Ga0496100_0150609_297_1076 259
20 3300048904 Ga0496101_0116475 Ga0496101_0116475_279_1058 259
21 3300048912 Ga0496109_0282954 Ga0496109_0282954_637_1416 259
22 3300005459 Ga0068867_100068389 Ga0068867_1000683891 260
23 3300050514 nmdc:mga08x19_327940_c1 nmdc:mga08x19_327940_c1_97_879 260
24 3300005548 Ga0070665_100345130 Ga0070665_1003451301 262
25 3300010375 Ga0105239_10750805 Ga0105239_107508051 262
26 3300026121 Ga0207683_10508838 Ga0207683_105088381 262
27 3300031911 Ga0307412_10202992 Ga0307412_102029922 262
28 3300042015 Ga0439462_0016556 Ga0439462_0016556_965_1753 262
29 3300042435 Ga0439434_0001966 Ga0439434_0001966_4916_5704 262
30 3300050510 nmdc:mga06r32_358525_c1 nmdc:mga06r32_358525_c1_14_802 262
31 3300059424 Ga0590075_010239 Ga0590075_010239_1231_2019 262
32 3300005293 Ga0065715_10007164 Ga0065715_100071644 263
33 3300005330 Ga0070690_100327381 Ga0070690_1003273811 263
34 3300005343 Ga0070687_100007844 Ga0070687_1000078442 263
35 3300005439 Ga0070711_100351494 Ga0070711_1003514942 263
36 3300005544 Ga0070686_100000738 Ga0070686_1000007382 263
37 3300005544 Ga0070686_100102003 Ga0070686_1001020031 263
38 3300005563 Ga0068855_100491325 Ga0068855_1004913251 263
39 3300005981 Ga0081538_10039360 Ga0081538_100393602 263
40 3300006058 Ga0075432_10090732 Ga0075432_100907321 263
41 3300006844 Ga0075428_100022970 Ga0075428_1000229705 263
42 3300006844 Ga0075428_100047355 Ga0075428_1000473554 263
43 3300006846 Ga0075430_100004000 Ga0075430_10000400012 263
44 3300006846 Ga0075430_100069036 Ga0075430_1000690362 263
45 3300006847 Ga0075431_100475572 Ga0075431_1004755722 263
46 3300006852 Ga0075433_10001967 Ga0075433_100019676 263
47 3300006852 Ga0075433_10097917 Ga0075433_100979173 263
48 3300006880 Ga0075429_100024224 Ga0075429_1000242243 263
49 3300006880 Ga0075429_100035146 Ga0075429_1000351462 263
50 3300007076 Ga0075435_100487550 Ga0075435_1004875501 263
51 3300009093 Ga0105240_10092216 Ga0105240_100922162 263
52 3300009094 Ga0111539_10002648 Ga0111539_100026483 263
53 3300009094 Ga0111539_10163313 Ga0111539_101633132 263
54 3300009147 Ga0114129_10013146 Ga0114129_1001314611 263
55 3300009147 Ga0114129_10218788 Ga0114129_102187882 263
56 3300009174 Ga0105241_10063516 Ga0105241_100635162 263
57 3300009177 Ga0105248_10109429 Ga0105248_101094293 263
58 3300014745 Ga0157377_10232098 Ga0157377_102320982 263
59 3300025903 Ga0207680_10350837 Ga0207680_103508371 263
60 3300025913 Ga0207695_10097445 Ga0207695_100974452 263
61 3300025917 Ga0207660_10348858 Ga0207660_103488581 263
62 3300025918 Ga0207662_10007576 Ga0207662_100075762 263
63 3300025933 Ga0207706_10513796 Ga0207706_105137962 263
64 3300025949 Ga0207667_10422600 Ga0207667_104226002 263
65 3300025981 Ga0207640_10047741 Ga0207640_100477413 263
66 3300026089 Ga0207648_10294496 Ga0207648_102944961 263
67 3300026118 Ga0207675_100018513 Ga0207675_1000185134 263
68 3300027907 Ga0207428_10000838 Ga0207428_1000083825 263
69 3300031731 Ga0307405_10325945 Ga0307405_103259452 263
70 3300031901 Ga0307406_10105796 Ga0307406_101057963 263
71 3300031911 Ga0307412_10104091 Ga0307412_101040912 263
72 3300032002 Ga0307416_100080219 Ga0307416_1000802192 263
73 3300034819 Ga0373958_0007891 Ga0373958_0007891_50_841 263
74 3300034820 Ga0373959_0007134 Ga0373959_0007134_94_885 263
75 3300034957 Ga0373938_0000129 Ga0373938_0000129_8508_9299 263
76 3300035084 Ga0373928_0002380 Ga0373928_0002380_1082_1873 263
77 3300035085 Ga0373929_0006263 Ga0373929_0006263_1042_1833 263
78 3300035088 Ga0373940_0002309 Ga0373940_0002309_1870_2661 263
79 3300035090 Ga0373949_0001063 Ga0373949_0001063_3192_3983 263
80 3300035091 Ga0373951_0006631 Ga0373951_0006631_113_904 263
81 3300035092 Ga0373952_0042161 Ga0373952_0042161_68_859 263
82 3300035112 Ga0373932_0000292 Ga0373932_0000292_3561_4352 263
83 3300035114 Ga0373939_0000836 Ga0373939_0000836_5836_6627 263
84 3300035115 Ga0373941_0000847 Ga0373941_0000847_3776_4567 263
85 3300035121 Ga0373960_0001074 Ga0373960_0001074_1382_2173 263
86 3300035207 Ga0373942_0001090 Ga0373942_0001090_2706_3497 263
87 3300035242 Ga0373962_0011777 Ga0373962_0011777_1136_1927 263
88 3300042001 Ga0439441_032344 Ga0439441_032344_178_969 263
89 3300042437 Ga0439444_0029074 Ga0439444_0029074_216_1007 263
90 3300042439 Ga0439464_0004793 Ga0439464_0004793_388_1179 263
91 3300048905 Ga0496102_0039401 Ga0496102_0039401_3361_4152 263
92 3300050507 nmdc:mga05p37_10459_c1 nmdc:mga05p37_10459_c1_9638_10429 263
93 3300050507 nmdc:mga05p37_425952_c1 nmdc:mga05p37_425952_c1_216_1007 263
94 3300050508 nmdc:mga09592_27048_c1 nmdc:mga09592_27048_c1_512_1303 263
95 3300050508 nmdc:mga09592_54226_c1 nmdc:mga09592_54226_c1_1867_2658 263
96 3300050508 nmdc:mga09592_630844_c1 nmdc:mga09592_630844_c1_44_835 263
97 3300050509 nmdc:mga0qj67_10057_c1 nmdc:mga0qj67_10057_c1_4963_5754 263
98 3300050510 nmdc:mga06r32_44120_c1 nmdc:mga06r32_44120_c1_2739_3530 263
99 3300050511 nmdc:mga08y16_2353_c1 nmdc:mga08y16_2353_c1_1222_2013 263
100 3300050512 nmdc:mga0n895_348344_c1 nmdc:mga0n895_348344_c1_10_801 263
101 3300050515 nmdc:mga0a205_48625_c1 nmdc:mga0a205_48625_c1_2259_3050 263
102 3300050515 nmdc:mga0a205_8896_c1 nmdc:mga0a205_8896_c1_6031_6822 263
103 3300059424 Ga0590075_000949 Ga0590075_000949_2059_2850 263
104 3300059426 Ga0590077_002784 Ga0590077_002784_1443_2234 263
105 3300059426 Ga0590077_008914 Ga0590077_008914_713_1504 263
106 3300005471 Ga0070698_100002373 Ga0070698_10000237315 264
107 3300005518 Ga0070699_100001411 Ga0070699_1000014115 264
108 3300005546 Ga0070696_100002025 Ga0070696_1000020256 264
109 3300006852 Ga0075433_10021911 Ga0075433_100219115 264
110 3300006880 Ga0075429_100526398 Ga0075429_1005263982 264
111 3300009147 Ga0114129_10005185 Ga0114129_100051853 264
112 3300014326 Ga0157380_10163445 Ga0157380_101634452 264
113 3300046537 Ga0495598_0004303 Ga0495598_0004303_859_1653 264
114 3300046664 Ga0495659_0006010 Ga0495659_0006010_810_1604 264
115 3300046691 Ga0495670_0058597 Ga0495670_0058597_1101_1895 264
116 3300050507 nmdc:mga05p37_7441_c1 nmdc:mga05p37_7441_c1_3661_4455 264
117 3300050512 nmdc:mga0n895_98706_c1 nmdc:mga0n895_98706_c1_103_897 264
118 3300050515 nmdc:mga0a205_663_c1 nmdc:mga0a205_663_c1_23343_24137 264
119 3300005288 Ga0065714_10085730 Ga0065714_100857302 265
120 3300005290 Ga0065712_10067845 Ga0065712_1006784512 265
121 3300005295 Ga0065707_10098440 Ga0065707_100984402 265
122 3300005295 Ga0065707_10315156 Ga0065707_103151561 265
123 3300005328 Ga0070676_10281937 Ga0070676_102819372 265
124 3300005330 Ga0070690_100039002 Ga0070690_1000390022 265
125 3300005331 Ga0070670_100063953 Ga0070670_1000639531 265
126 3300005333 Ga0070677_10054821 Ga0070677_100548212 265
127 3300005334 Ga0068869_100364433 Ga0068869_1003644332 265
128 3300005334 Ga0068869_100429028 Ga0068869_1004290282 265
129 3300005336 Ga0070680_100091660 Ga0070680_1000916602 265
130 3300005338 Ga0068868_100169667 Ga0068868_1001696672 265
131 3300005340 Ga0070689_100094527 Ga0070689_1000945272 265
132 3300005340 Ga0070689_100251710 Ga0070689_1002517102 265
133 3300005343 Ga0070687_100003395 Ga0070687_1000033956 265
134 3300005343 Ga0070687_100055176 Ga0070687_1000551762 265
135 3300005345 Ga0070692_10030212 Ga0070692_100302123 265
136 3300005347 Ga0070668_100780688 Ga0070668_1007806881 265
137 3300005353 Ga0070669_100118510 Ga0070669_1001185101 265
138 3300005354 Ga0070675_100000179 Ga0070675_10000017911 265
139 3300005354 Ga0070675_100006593 Ga0070675_1000065937 265
140 3300005354 Ga0070675_100071309 Ga0070675_1000713092 265
141 3300005364 Ga0070673_100134835 Ga0070673_1001348352 265
142 3300005364 Ga0070673_100150306 Ga0070673_1001503062 265
143 3300005364 Ga0070673_100291709 Ga0070673_1002917092 265
144 3300005364 Ga0070673_100598143 Ga0070673_1005981431 265
145 3300005365 Ga0070688_100009438 Ga0070688_1000094383 265
146 3300005365 Ga0070688_100047973 Ga0070688_1000479732 265
147 3300005367 Ga0070667_100003115 Ga0070667_1000031158 265
148 3300005438 Ga0070701_10008286 Ga0070701_100082862 265
149 3300005438 Ga0070701_10085993 Ga0070701_100859932 265
150 3300005455 Ga0070663_100549849 Ga0070663_1005498491 265
151 3300005457 Ga0070662_100484064 Ga0070662_1004840641 265
152 3300005458 Ga0070681_10702895 Ga0070681_107028951 265
153 3300005459 Ga0068867_100000594 Ga0068867_10000059418 265
154 3300005459 Ga0068867_100304923 Ga0068867_1003049233 265
155 3300005467 Ga0070706_100077239 Ga0070706_1000772392 265
156 3300005468 Ga0070707_100046186 Ga0070707_1000461862 265
157 3300005468 Ga0070707_100056411 Ga0070707_1000564111 265
158 3300005518 Ga0070699_100000753 Ga0070699_1000007534 265
159 3300005535 Ga0070684_100177056 Ga0070684_1001770562 265
160 3300005543 Ga0070672_100196376 Ga0070672_1001963762 265
161 3300005543 Ga0070672_100228457 Ga0070672_1002284572 265
162 3300005543 Ga0070672_100308847 Ga0070672_1003088472 265
163 3300005544 Ga0070686_100100327 Ga0070686_1001003271 265
164 3300005546 Ga0070696_100111560 Ga0070696_1001115602 265
165 3300005549 Ga0070704_100002640 Ga0070704_1000026403 265
166 3300005578 Ga0068854_100085197 Ga0068854_1000851972 265
167 3300005617 Ga0068859_100006905 Ga0068859_1000069057 265
168 3300005617 Ga0068859_100012855 Ga0068859_1000128554 265
169 3300005617 Ga0068859_100520456 Ga0068859_1005204563 265
170 3300005618 Ga0068864_100062807 Ga0068864_1000628072 265
171 3300005719 Ga0068861_100030480 Ga0068861_1000304802 265
172 3300005719 Ga0068861_100139517 Ga0068861_1001395172 265
173 3300005840 Ga0068870_10009526 Ga0068870_100095262 265
174 3300005841 Ga0068863_100006722 Ga0068863_1000067227 265
175 3300005841 Ga0068863_100556210 Ga0068863_1005562102 265
176 3300005842 Ga0068858_100016744 Ga0068858_1000167442 265
177 3300005842 Ga0068858_100136441 Ga0068858_1001364412 265
178 3300005843 Ga0068860_100013745 Ga0068860_1000137456 265
179 3300005843 Ga0068860_100242929 Ga0068860_1002429293 265
180 3300005844 Ga0068862_100000554 Ga0068862_10000055437 265
181 3300005844 Ga0068862_100010498 Ga0068862_1000104983 265
182 3300006195 Ga0075366_10075968 Ga0075366_100759682 265
183 3300006237 Ga0097621_100083241 Ga0097621_1000832412 265
184 3300006237 Ga0097621_100384733 Ga0097621_1003847332 265
185 3300006358 Ga0068871_100456636 Ga0068871_1004566362 265
186 3300006844 Ga0075428_100004797 Ga0075428_10000479712 265
187 3300006844 Ga0075428_100083210 Ga0075428_1000832103 265
188 3300006844 Ga0075428_100114242 Ga0075428_1001142422 265
189 3300006846 Ga0075430_100221724 Ga0075430_1002217242 265
190 3300006847 Ga0075431_100555562 Ga0075431_1005555621 265
191 3300006852 Ga0075433_10000108 Ga0075433_100001089 265
192 3300006852 Ga0075433_10097770 Ga0075433_100977702 265
193 3300006871 Ga0075434_100004749 Ga0075434_1000047496 265
194 3300006871 Ga0075434_100011544 Ga0075434_1000115449 265
195 3300006871 Ga0075434_100051020 Ga0075434_1000510203 265
196 3300006871 Ga0075434_100092236 Ga0075434_1000922362 265
197 3300006880 Ga0075429_100040041 Ga0075429_1000400412 265
198 3300006880 Ga0075429_100470933 Ga0075429_1004709331 265
199 3300006914 Ga0075436_100124226 Ga0075436_1001242261 265
200 3300006931 Ga0097620_100006905 Ga0097620_1000069057 265
201 3300006931 Ga0097620_100012855 Ga0097620_1000128554 265
202 3300006931 Ga0097620_100520471 Ga0097620_1005204711 265
203 3300007076 Ga0075435_100056313 Ga0075435_1000563133 265
204 3300007076 Ga0075435_100074012 Ga0075435_1000740122 265
205 3300007076 Ga0075435_100156707 Ga0075435_1001567072 265
206 3300009094 Ga0111539_10000057 Ga0111539_1000005760 265
207 3300009094 Ga0111539_10039744 Ga0111539_100397445 265
208 3300009094 Ga0111539_10051926 Ga0111539_100519263 265
209 3300009094 Ga0111539_10115757 Ga0111539_101157573 265
210 3300009094 Ga0111539_10364443 Ga0111539_103644432 265
211 3300009147 Ga0114129_10000428 Ga0114129_1000042849 265
212 3300009147 Ga0114129_10091866 Ga0114129_100918662 265
213 3300009147 Ga0114129_10134143 Ga0114129_101341433 265
214 3300009147 Ga0114129_10153920 Ga0114129_101539203 265
215 3300009147 Ga0114129_10164284 Ga0114129_101642842 265
216 3300009176 Ga0105242_10300379 Ga0105242_103003792 265
217 3300009177 Ga0105248_10033477 Ga0105248_100334774 265
218 3300009553 Ga0105249_10101243 Ga0105249_101012432 265
219 3300009553 Ga0105249_10313914 Ga0105249_103139143 265
220 3300013297 Ga0157378_10077551 Ga0157378_100775512 265
221 3300013297 Ga0157378_10123113 Ga0157378_101231132 265
222 3300013306 Ga0163162_10017343 Ga0163162_100173436 265
223 3300013306 Ga0163162_10121440 Ga0163162_101214403 265
224 3300013308 Ga0157375_10158639 Ga0157375_101586392 265
225 3300013308 Ga0157375_10294390 Ga0157375_102943902 265
226 3300014745 Ga0157377_10046673 Ga0157377_100466732 265
227 3300014745 Ga0157377_10205412 Ga0157377_102054122 265
228 3300014968 Ga0157379_10108098 Ga0157379_101080982 265
229 3300014968 Ga0157379_10157195 Ga0157379_101571952 265
230 3300025893 Ga0207682_10046596 Ga0207682_100465961 265
231 3300025893 Ga0207682_10059512 Ga0207682_100595122 265
232 3300025903 Ga0207680_10174669 Ga0207680_101746692 265
233 3300025907 Ga0207645_10058343 Ga0207645_100583432 265
234 3300025908 Ga0207643_10003032 Ga0207643_100030327 265
235 3300025908 Ga0207643_10003777 Ga0207643_100037777 265
236 3300025910 Ga0207684_10101552 Ga0207684_101015522 265
237 3300025918 Ga0207662_10019120 Ga0207662_100191203 265
238 3300025918 Ga0207662_10104972 Ga0207662_101049722 265
239 3300025922 Ga0207646_10040848 Ga0207646_100408482 265
240 3300025922 Ga0207646_10129171 Ga0207646_101291713 265
241 3300025925 Ga0207650_10040396 Ga0207650_100403961 265
242 3300025926 Ga0207659_10000228 Ga0207659_100002286 265
243 3300025926 Ga0207659_10007986 Ga0207659_100079863 265
244 3300025926 Ga0207659_10551922 Ga0207659_105519222 265
245 3300025931 Ga0207644_10026302 Ga0207644_100263024 265
246 3300025933 Ga0207706_10085680 Ga0207706_100856803 265
247 3300025933 Ga0207706_10092710 Ga0207706_100927102 265
248 3300025936 Ga0207670_10002302 Ga0207670_100023027 265
249 3300025938 Ga0207704_10227723 Ga0207704_102277232 265
250 3300025938 Ga0207704_10286166 Ga0207704_102861662 265
251 3300025940 Ga0207691_10041837 Ga0207691_100418373 265
252 3300025940 Ga0207691_10314266 Ga0207691_103142662 265
253 3300025940 Ga0207691_10500017 Ga0207691_105000172 265
254 3300025941 Ga0207711_10013029 Ga0207711_100130293 265
255 3300025942 Ga0207689_10034373 Ga0207689_100343732 265
256 3300025942 Ga0207689_10147641 Ga0207689_101476412 265
257 3300025942 Ga0207689_10230799 Ga0207689_102307992 265
258 3300025945 Ga0207679_10193457 Ga0207679_101934572 265
259 3300025945 Ga0207679_10434786 Ga0207679_104347861 265
260 3300025960 Ga0207651_10105240 Ga0207651_101052402 265
261 3300025960 Ga0207651_10150080 Ga0207651_101500802 265
262 3300025961 Ga0207712_10011132 Ga0207712_100111322 265
263 3300025972 Ga0207668_10540422 Ga0207668_105404221 265
264 3300025986 Ga0207658_10078610 Ga0207658_100786102 265
265 3300025986 Ga0207658_10146400 Ga0207658_101464002 265
266 3300026035 Ga0207703_10004495 Ga0207703_100044956 265
267 3300026088 Ga0207641_10004085 Ga0207641_1000408511 265
268 3300026088 Ga0207641_10146165 Ga0207641_101461652 265
269 3300026088 Ga0207641_10420163 Ga0207641_104201632 265
270 3300026089 Ga0207648_10000600 Ga0207648_1000060026 265
271 3300026089 Ga0207648_10160643 Ga0207648_101606432 265
272 3300026095 Ga0207676_10118475 Ga0207676_101184752 265
273 3300026116 Ga0207674_10022060 Ga0207674_100220602 265
274 3300026116 Ga0207674_10073523 Ga0207674_100735233 265
275 3300026118 Ga0207675_100006784 Ga0207675_1000067842 265
276 3300026118 Ga0207675_100134754 Ga0207675_1001347542 265
277 3300026121 Ga0207683_10188639 Ga0207683_101886391 265
278 3300027866 Ga0209813_10085713 Ga0209813_100857131 265
279 3300027907 Ga0207428_10000520 Ga0207428_1000052021 265
280 3300027907 Ga0207428_10001137 Ga0207428_100011378 265
281 3300027907 Ga0207428_10034163 Ga0207428_100341634 265
282 3300027907 Ga0207428_10222166 Ga0207428_102221661 265
283 3300028380 Ga0268265_10000625 Ga0268265_100006254 265
284 3300028380 Ga0268265_10080446 Ga0268265_100804464 265
285 3300028380 Ga0268265_10217202 Ga0268265_102172021 265
286 3300031852 Ga0307410_10023683 Ga0307410_100236832 265
287 3300031903 Ga0307407_10016554 Ga0307407_100165542 265
288 3300031995 Ga0307409_100050991 Ga0307409_1000509912 265
289 3300032004 Ga0307414_10070249 Ga0307414_100702492 265
290 3300035241 Ga0373961_0031697 Ga0373961_0031697_663_1460 265
291 3300035241 Ga0373961_0040809 Ga0373961_0040809_205_1002 265
292 3300035410 Ga0373924_0108737 Ga0373924_0108737_285_1082 265
293 3300045051 Ga0451576_0039905 Ga0451576_0039905_2781_3578 265
294 3300045051 Ga0451576_0898351 Ga0451576_0898351_110_907 265
295 3300046499 Ga0495594_0031947 Ga0495594_0031947_1386_2183 265
296 3300046538 Ga0495609_0146421 Ga0495609_0146421_147_944 265
297 3300046539 Ga0495621_0005012 Ga0495621_0005012_2268_3065 265
298 3300046539 Ga0495621_0059996 Ga0495621_0059996_172_969 265
299 3300046664 Ga0495659_0006678 Ga0495659_0006678_1248_2045 265
300 3300046664 Ga0495659_0031667 Ga0495659_0031667_946_1743 265
301 3300046664 Ga0495659_0040473 Ga0495659_0040473_322_1119 265
302 3300046674 Ga0495588_0055134 Ga0495588_0055134_570_1367 265
303 3300046684 Ga0495669_0011309 Ga0495669_0011309_790_1587 265
304 3300046684 Ga0495669_0020113 Ga0495669_0020113_640_1437 265
305 3300047315 Ga0495581_0271130 Ga0495581_0271130_164_961 265
306 3300047318 Ga0495636_0072440 Ga0495636_0072440_428_1225 265
307 3300047320 Ga0495672_0047596 Ga0495672_0047596_67_891 265
308 3300047445 Ga0495677_0093182 Ga0495677_0093182_270_1067 265
309 3300049568 Ga0501031_0064864 Ga0501031_0064864_417_1214 265
310 3300049576 Ga0501040_0057652 Ga0501040_0057652_1016_1813 265
311 3300049577 Ga0501041_0043877 Ga0501041_0043877_1417_2214 265
312 3300049578 Ga0501042_0018949 Ga0501042_0018949_2536_3333 265
313 3300049587 Ga0501071_0062459 Ga0501071_0062459_943_1740 265
314 3300049588 Ga0501072_0275560 Ga0501072_0275560_474_1271 265
315 3300049591 Ga0501075_0189088 Ga0501075_0189088_575_1372 265
316 3300049741 Ga0501079_0073562 Ga0501079_0073562_100_897 265
317 3300049743 Ga0501081_0024651 Ga0501081_0024651_1539_2336 265
318 3300049824 Ga0501045_0068727 Ga0501045_0068727_1418_2215 265
319 3300049824 Ga0501045_0446195 Ga0501045_0446195_28_825 265
320 3300050491 nmdc:mga00v17_49896_c1 nmdc:mga00v17_49896_c1_620_1438 265
321 3300050493 nmdc:mga0k408_36773_c1 nmdc:mga0k408_36773_c1_1235_2053 265
322 3300050494 nmdc:mga06z11_7846_c1 nmdc:mga06z11_7846_c1_400_1218 265
323 3300050495 nmdc:mga04h51_121478_c1 nmdc:mga04h51_121478_c1_71_889 265
324 3300050507 nmdc:mga05p37_18629_c1 nmdc:mga05p37_18629_c1_3833_4630 265
325 3300050507 nmdc:mga05p37_25324_c1 nmdc:mga05p37_25324_c1_219_1016 265
326 3300050508 nmdc:mga09592_114052_c1 nmdc:mga09592_114052_c1_557_1354 265
327 3300050508 nmdc:mga09592_149037_c1 nmdc:mga09592_149037_c1_182_979 265
328 3300050508 nmdc:mga09592_266639_c1 nmdc:mga09592_266639_c1_630_1427 265
329 3300050508 nmdc:mga09592_512614_c1 nmdc:mga09592_512614_c1_15_812 265
330 3300050509 nmdc:mga0qj67_60928_c1 nmdc:mga0qj67_60928_c1_240_1037 265
331 3300050511 nmdc:mga08y16_139614_c1 nmdc:mga08y16_139614_c1_1574_2371 265
332 3300050511 nmdc:mga08y16_23882_c1 nmdc:mga08y16_23882_c1_129_926 265
333 3300050511 nmdc:mga08y16_497_c1 nmdc:mga08y16_497_c1_17834_18631 265
334 3300050511 nmdc:mga08y16_5024_c1 nmdc:mga08y16_5024_c1_8845_9642 265
335 3300050511 nmdc:mga08y16_9827_c1 nmdc:mga08y16_9827_c1_3990_4787 265
336 3300050512 nmdc:mga0n895_2029_c1 nmdc:mga0n895_2029_c1_12019_12819 265
337 3300050512 nmdc:mga0n895_67400_c1 nmdc:mga0n895_67400_c1_954_1751 265
338 3300050512 nmdc:mga0n895_7121_c1 nmdc:mga0n895_7121_c1_911_1708 265
339 3300050513 nmdc:mga0rr50_380943_c1 nmdc:mga0rr50_380943_c1_207_1004 265
340 3300050515 nmdc:mga0a205_163529_c1 nmdc:mga0a205_163529_c1_535_1332 265
341 3300050515 nmdc:mga0a205_2134_c1 nmdc:mga0a205_2134_c1_6247_7047 265
342 3300053139 Ga0500568_0007187 Ga0500568_0007187_743_1567 265
343 3300060353 Ga0501082_0025685 Ga0501082_0025685_1778_2575 265
344 3300005330 Ga0070690_100092726 Ga0070690_1000927262 266
345 3300005338 Ga0068868_100058567 Ga0068868_1000585672 266
346 3300005338 Ga0068868_100203706 Ga0068868_1002037062 266
347 3300005341 Ga0070691_10004293 Ga0070691_100042934 266
348 3300005353 Ga0070669_100158676 Ga0070669_1001586762 266
349 3300005354 Ga0070675_100034264 Ga0070675_1000342644 266
350 3300005356 Ga0070674_100001365 Ga0070674_1000013652 266
351 3300005440 Ga0070705_100003426 Ga0070705_1000034267 266
352 3300005441 Ga0070700_100123902 Ga0070700_1001239022 266
353 3300005444 Ga0070694_100061506 Ga0070694_1000615062 266
354 3300005444 Ga0070694_100136978 Ga0070694_1001369781 266
355 3300005459 Ga0068867_100395087 Ga0068867_1003950872 266
356 3300005468 Ga0070707_100038969 Ga0070707_1000389695 266
357 3300005468 Ga0070707_100540911 Ga0070707_1005409112 266
358 3300005535 Ga0070684_100372915 Ga0070684_1003729152 266
359 3300005546 Ga0070696_100002689 Ga0070696_1000026899 266
360 3300005548 Ga0070665_100003704 Ga0070665_1000037048 266
361 3300005549 Ga0070704_100004329 Ga0070704_1000043293 266
362 3300005578 Ga0068854_100041462 Ga0068854_1000414622 266
363 3300005615 Ga0070702_100008666 Ga0070702_1000086662 266
364 3300005718 Ga0068866_10133736 Ga0068866_101337361 266
365 3300005719 Ga0068861_100001719 Ga0068861_1000017193 266
366 3300005842 Ga0068858_100001376 Ga0068858_10000137611 266
367 3300005843 Ga0068860_100069683 Ga0068860_1000696833 266
368 3300005985 Ga0081539_10003673 Ga0081539_100036737 266
369 3300006237 Ga0097621_100137992 Ga0097621_1001379923 266
370 3300006358 Ga0068871_100002872 Ga0068871_1000028725 266
371 3300006358 Ga0068871_100314801 Ga0068871_1003148012 266
372 3300006846 Ga0075430_100531520 Ga0075430_1005315201 266
373 3300006871 Ga0075434_100002237 Ga0075434_1000022376 266
374 3300006881 Ga0068865_100083606 Ga0068865_1000836062 266
375 3300006914 Ga0075436_100001777 Ga0075436_1000017776 266
376 3300007076 Ga0075435_100000001 Ga0075435_10000000179 266
377 3300009093 Ga0105240_10717267 Ga0105240_107172672 266
378 3300009094 Ga0111539_10005632 Ga0111539_100056325 266
379 3300009098 Ga0105245_10026541 Ga0105245_100265414 266
380 3300009098 Ga0105245_10041928 Ga0105245_100419284 266
381 3300009147 Ga0114129_10423349 Ga0114129_104233492 266
382 3300009148 Ga0105243_10009456 Ga0105243_100094563 266
383 3300009176 Ga0105242_10008576 Ga0105242_100085764 266
384 3300009176 Ga0105242_10012513 Ga0105242_100125133 266
385 3300009553 Ga0105249_10089591 Ga0105249_100895912 266
386 3300010375 Ga0105239_10190646 Ga0105239_101906462 266
387 3300013296 Ga0157374_10048436 Ga0157374_100484363 266
388 3300013306 Ga0163162_10410988 Ga0163162_104109882 266
389 3300014326 Ga0157380_10370009 Ga0157380_103700092 266
390 3300014968 Ga0157379_10037275 Ga0157379_100372752 266
391 3300014969 Ga0157376_10035153 Ga0157376_100351533 266
392 3300014969 Ga0157376_10071558 Ga0157376_100715583 266
393 3300015262 Ga0182007_10047970 Ga0182007_100479701 266
394 3300025899 Ga0207642_10192949 Ga0207642_101929491 266
395 3300025901 Ga0207688_10198934 Ga0207688_101989342 266
396 3300025922 Ga0207646_10459631 Ga0207646_104596312 266
397 3300025923 Ga0207681_10073500 Ga0207681_100735002 266
398 3300025926 Ga0207659_10526184 Ga0207659_105261841 266
399 3300025933 Ga0207706_10100915 Ga0207706_101009152 266
400 3300025934 Ga0207686_10004308 Ga0207686_100043084 266
401 3300025934 Ga0207686_10048988 Ga0207686_100489882 266
402 3300025937 Ga0207669_10151967 Ga0207669_101519671 266
403 3300025938 Ga0207704_10066338 Ga0207704_100663382 266
404 3300025941 Ga0207711_10038837 Ga0207711_100388373 266
405 3300025961 Ga0207712_10086466 Ga0207712_100864661 266
406 3300025981 Ga0207640_10391353 Ga0207640_103913531 266
407 3300026023 Ga0207677_10176439 Ga0207677_101764392 266
408 3300026075 Ga0207708_10005596 Ga0207708_100055965 266
409 3300026075 Ga0207708_10069079 Ga0207708_100690792 266
410 3300026089 Ga0207648_10103151 Ga0207648_101031513 266
411 3300026118 Ga0207675_100000622 Ga0207675_10000062224 266
412 3300027907 Ga0207428_10210451 Ga0207428_102104512 266
413 3300028379 Ga0268266_10017934 Ga0268266_100179345 266
414 3300028380 Ga0268265_10015718 Ga0268265_100157181 266
415 3300031548 Ga0307408_100092559 Ga0307408_1000925592 266
416 3300031727 Ga0316576_10005089 Ga0316576_100050896 266
417 3300031728 Ga0316578_10107807 Ga0316578_101078071 266
418 3300031824 Ga0307413_10232295 Ga0307413_102322951 266
419 3300031852 Ga0307410_10086953 Ga0307410_100869532 266
420 3300031901 Ga0307406_10007779 Ga0307406_100077793 266
421 3300031903 Ga0307407_10106988 Ga0307407_101069882 266
422 3300031911 Ga0307412_10108622 Ga0307412_101086221 266
423 3300031995 Ga0307409_100043595 Ga0307409_1000435952 266
424 3300031995 Ga0307409_100165147 Ga0307409_1001651473 266
425 3300032002 Ga0307416_100083096 Ga0307416_1000830962 266
426 3300032005 Ga0307411_10130054 Ga0307411_101300542 266
427 3300035120 Ga0373957_0083148 Ga0373957_0083148_349_1149 266
428 3300035691 Ga0373931_0207263 Ga0373931_0207263_53_853 266
429 3300035692 Ga0373935_0371407 Ga0373935_0371407_184_984 266
430 3300036712 Ga0316584_0009181 Ga0316584_0009181_4569_5369 266
431 3300042436 Ga0439435_0054479 Ga0439435_0054479_37_840 266
432 3300046459 Ga0495629_0115366 Ga0495629_0115366_361_1161 266
433 3300046683 Ga0495658_0381104 Ga0495658_0381104_82_882 266
434 3300048907 Ga0496104_0118552 Ga0496104_0118552_1411_2211 266
435 3300048917 Ga0496114_0019072 Ga0496114_0019072_3547_4347 266
436 3300048918 Ga0496115_0021942 Ga0496115_0021942_1927_2727 266
437 3300049526 Ga0501303_004763 Ga0501303_004763_20_820 266
438 3300050511 nmdc:mga08y16_2693_c1 nmdc:mga08y16_2693_c1_13909_14718 266
439 3300050512 nmdc:mga0n895_23_c1 nmdc:mga0n895_23_c1_7569_8369 266
440 3300050513 nmdc:mga0rr50_11_c1 nmdc:mga0rr50_11_c1_109269_110069 266
441 3300050513 nmdc:mga0rr50_284899_c1 nmdc:mga0rr50_284899_c1_116_916 266
442 3300050514 nmdc:mga08x19_1418_c1 nmdc:mga08x19_1418_c1_8358_9158 266
443 3300053085 Ga0495619_0351826 Ga0495619_0351826_38_838 266
444 3300059421 Ga0590071_011264 Ga0590071_011264_990_1790 266
445 3300059426 Ga0590077_004270 Ga0590077_004270_747_1547 266
446 3300003203 JGI25406J46586_10006305 JGI25406J46586_100063052 267
447 3300005290 Ga0065712_10092521 Ga0065712_100925212 267
448 3300005293 Ga0065715_10115075 Ga0065715_101150752 267
449 3300005340 Ga0070689_100054379 Ga0070689_1000543792 267
450 3300005353 Ga0070669_100125095 Ga0070669_1001250951 267
451 3300005354 Ga0070675_100039245 Ga0070675_1000392452 267
452 3300005444 Ga0070694_100301039 Ga0070694_1003010392 267
453 3300005445 Ga0070708_100545999 Ga0070708_1005459991 267
454 3300005518 Ga0070699_100149510 Ga0070699_1001495102 267
455 3300005545 Ga0070695_100400251 Ga0070695_1004002511 267
456 3300005546 Ga0070696_100467734 Ga0070696_1004677342 267
457 3300005549 Ga0070704_100112961 Ga0070704_1001129612 267
458 3300005844 Ga0068862_100492929 Ga0068862_1004929292 267
459 3300005985 Ga0081539_10000535 Ga0081539_1000053575 267
460 3300005985 Ga0081539_10071960 Ga0081539_100719601 267
461 3300006194 Ga0075427_10022434 Ga0075427_100224342 267
462 3300006195 Ga0075366_10050057 Ga0075366_100500572 267
463 3300006844 Ga0075428_100043206 Ga0075428_1000432063 267
464 3300006844 Ga0075428_100055639 Ga0075428_1000556391 267
465 3300006844 Ga0075428_100078356 Ga0075428_1000783564 267
466 3300006844 Ga0075428_100150797 Ga0075428_1001507972 267
467 3300006846 Ga0075430_100035928 Ga0075430_1000359283 267
468 3300006846 Ga0075430_100112338 Ga0075430_1001123382 267
469 3300006847 Ga0075431_100013314 Ga0075431_1000133142 267
470 3300006847 Ga0075431_100022918 Ga0075431_1000229185 267
471 3300006852 Ga0075433_10025867 Ga0075433_100258677 267
472 3300006852 Ga0075433_10027375 Ga0075433_100273754 267
473 3300006852 Ga0075433_10048737 Ga0075433_100487372 267
474 3300006852 Ga0075433_10204864 Ga0075433_102048642 267
475 3300006852 Ga0075433_10406465 Ga0075433_104064652 267
476 3300006871 Ga0075434_100088906 Ga0075434_1000889062 267
477 3300006880 Ga0075429_100143830 Ga0075429_1001438302 267
478 3300009094 Ga0111539_10000716 Ga0111539_1000071611 267
479 3300009094 Ga0111539_10002028 Ga0111539_100020288 267
480 3300009094 Ga0111539_10488650 Ga0111539_104886502 267
481 3300009094 Ga0111539_10842732 Ga0111539_108427321 267
482 3300009147 Ga0114129_10024509 Ga0114129_100245094 267
483 3300009147 Ga0114129_10162336 Ga0114129_101623362 267
484 3300014326 Ga0157380_10101074 Ga0157380_101010743 267
485 3300014326 Ga0157380_10573331 Ga0157380_105733311 267
486 3300025922 Ga0207646_10105303 Ga0207646_101053032 267
487 3300026075 Ga0207708_10122048 Ga0207708_101220483 267
488 3300026118 Ga0207675_100020479 Ga0207675_1000204792 267
489 3300027907 Ga0207428_10000801 Ga0207428_100008015 267
490 3300027907 Ga0207428_10083185 Ga0207428_100831852 267
491 3300028380 Ga0268265_10042987 Ga0268265_100429872 267
492 3300031911 Ga0307412_10021911 Ga0307412_100219112 267
493 3300031911 Ga0307412_10359839 Ga0307412_103598392 267
494 3300031995 Ga0307409_100011654 Ga0307409_1000116543 267
495 3300032126 Ga0307415_100367199 Ga0307415_1003671992 267
496 3300042437 Ga0439444_0018384 Ga0439444_0018384_253_1056 267
497 3300045051 Ga0451576_0486180 Ga0451576_0486180_73_876 267
498 3300049568 Ga0501031_0143748 Ga0501031_0143748_520_1323 267
499 3300049572 Ga0501036_0237783 Ga0501036_0237783_504_1307 267
500 3300049578 Ga0501042_0046405 Ga0501042_0046405_1029_1832 267
501 3300049588 Ga0501072_0013878 Ga0501072_0013878_4987_5790 267
502 3300049591 Ga0501075_0015935 Ga0501075_0015935_3660_4463 267
503 3300049592 Ga0501076_0061474 Ga0501076_0061474_413_1216 267
504 3300049741 Ga0501079_0029263 Ga0501079_0029263_695_1498 267
505 3300050493 nmdc:mga0k408_118633_c1 nmdc:mga0k408_118633_c1_106_936 267
506 3300050507 nmdc:mga05p37_209343_c1 nmdc:mga05p37_209343_c1_1075_1878 267
507 3300050507 nmdc:mga05p37_687_c1 nmdc:mga05p37_687_c1_34558_35361 267
508 3300050508 nmdc:mga09592_104349_c1 nmdc:mga09592_104349_c1_588_1391 267
509 3300050508 nmdc:mga09592_131377_c1 nmdc:mga09592_131377_c1_62_865 267
510 3300050508 nmdc:mga09592_51094_c1 nmdc:mga09592_51094_c1_2590_3396 267
511 3300050509 nmdc:mga0qj67_181255_c1 nmdc:mga0qj67_181255_c1_324_1127 267
512 3300050509 nmdc:mga0qj67_46942_c1 nmdc:mga0qj67_46942_c1_1450_2256 267
513 3300050510 nmdc:mga06r32_131091_c1 nmdc:mga06r32_131091_c1_1553_2356 267
514 3300050511 nmdc:mga08y16_13137_c1 nmdc:mga08y16_13137_c1_1926_2732 267
515 3300050511 nmdc:mga08y16_52876_c1 nmdc:mga08y16_52876_c1_3213_4016 267
516 3300050512 nmdc:mga0n895_179855_c1 nmdc:mga0n895_179855_c1_446_1249 267
517 3300050512 nmdc:mga0n895_31680_c1 nmdc:mga0n895_31680_c1_56_859 267
518 3300050513 nmdc:mga0rr50_442199_c1 nmdc:mga0rr50_442199_c1_14_817 267
519 3300050513 nmdc:mga0rr50_60996_c1 nmdc:mga0rr50_60996_c1_109_912 267
520 3300050515 nmdc:mga0a205_160243_c1 nmdc:mga0a205_160243_c1_447_1259 267
521 3300050515 nmdc:mga0a205_397522_c1 nmdc:mga0a205_397522_c1_287_1093 267
522 3300050515 nmdc:mga0a205_40495_c1 nmdc:mga0a205_40495_c1_2817_3620 267
523 3300050515 nmdc:mga0a205_78372_c1 nmdc:mga0a205_78372_c1_883_1686 267
524 3300054114 Ga0501084_0335318 Ga0501084_0335318_46_852 267
525 3300061734 Ga0530510_0003289 Ga0530510_0003289_6089_6892 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

18

168

0.94

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

208

290

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bk9-assembly2.cif.gz_G h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris 0.8346 11 267
1yw0-assembly1.cif.gz_B crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. northeast structural genomics target xcr13. 0.8335 11 265
2nox-assembly4.cif.gz_O crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8329 11 267
2nox-assembly3.cif.gz_I crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8327 11 267
2nox-assembly4.cif.gz_M crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8317 11 267
ID Description Score Start End Superfamily
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8305 10 267 1.20.58.480
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8214 10 267 1.20.58.480
2nw9B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8014 5 267 1.20.58.480
3bk9C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.794 1 267 1.20.58.480
3bk9C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7912 1 267 1.20.58.480
ID Description Score Start End GO Terms
AF-A0A3D2J7U4-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9703 112 209 GO:0019441
GO:0020037
GO:0046872
GO:0051213
AF-A0A3D2J7U4-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9329 112 209 GO:0019441
GO:0020037
GO:0046872
GO:0051213
AF-A0A7C7K913-F1-model_v4 deleted 0.9244 54 267
AF-K1Y6N8-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9227 68 267 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A388P2M3-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9166 38 267 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.28 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map