F459229

General Info

Members Datasets Scaffolds Average Seq Length
525 282 1050 89

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101669285|Ga0070671_1016692851
Length 92
Sequence MAVTVKIPAQLRPVVDNQATVSIESSGTVSEVLDALYGQFPDLKDRISENGELRRFVNVYVADEDIRFGDGLDTAVADGTEVTILPAVAGGC

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 4.38
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_101669285 3300005355 Unclassified 565
2 Ga0070676_10632334 3300005328 Bacteria 775
3 Ga0070690_100466471 3300005330 Bacteria 939
4 Ga0068869_100016248 3300005334 Bacteria 5013
5 Ga0070680_101648323 3300005336 Bacteria 556
6 Ga0068868_100156823 3300005338 Bacteria 1878
7 Ga0068868_100207217 3300005338 Bacteria 1637
8 Ga0068868_100249763 3300005338 Bacteria 1493
9 Ga0068868_101879083 3300005338 Bacteria 567
10 Ga0070660_100492278 3300005339 Bacteria 1020
11 Ga0070689_100492660 3300005340 Bacteria 1049
12 Ga0070668_100780332 3300005347 Bacteria 848
13 Ga0070669_101848627 3300005353 Bacteria 527
14 Ga0070675_101385748 3300005354 Unclassified 648
15 Ga0070688_100060226 3300005365 Bacteria 2397
16 Ga0070659_100043079 3300005366 Bacteria 3530
17 Ga0070659_100801761 3300005366 Bacteria 819
18 Ga0070709_10413687 3300005434 Bacteria 1009
19 Ga0070714_100190995 3300005435 Bacteria 1869
20 Ga0070714_101243077 3300005435 Bacteria 727
21 Ga0070714_102192452 3300005435 Bacteria 538
22 Ga0070713_102134649 3300005436 Bacteria 543
23 Ga0070701_10303728 3300005438 Bacteria 982
24 Ga0070705_100069239 3300005440 Bacteria 2127
25 Ga0070705_100830191 3300005440 Bacteria 738
26 Ga0070700_100277944 3300005441 Bacteria 1213
27 Ga0070700_100350585 3300005441 Bacteria 1094
28 Ga0070700_101729516 3300005441 Bacteria 537
29 Ga0070694_100982257 3300005444 Bacteria 700
30 Ga0070708_100086113 3300005445 Bacteria 2853
31 Ga0070663_100616882 3300005455 Bacteria 914
32 Ga0070662_100033306 3300005457 Bacteria 3627
33 Ga0070681_10019419 3300005458 Bacteria 6802
34 Ga0070706_100025420 3300005467 Bacteria 5450
35 Ga0070706_101611196 3300005467 Bacteria 592
36 Ga0070707_100126791 3300005468 Bacteria 2480
37 Ga0070707_100804624 3300005468 Bacteria 904
38 Ga0070698_100104165 3300005471 Bacteria 2807
39 Ga0070698_100585627 3300005471 Bacteria 1056
40 Ga0070698_100595321 3300005471 Bacteria 1046
41 Ga0070698_100794974 3300005471 Unclassified 890
42 Ga0070699_100102743 3300005518 Bacteria 2506
43 Ga0070699_100535527 3300005518 Bacteria 1065
44 Ga0070684_101258371 3300005535 Bacteria 696
45 Ga0070684_101558282 3300005535 Bacteria 623
46 Ga0070697_100029940 3300005536 Bacteria 4370
47 Ga0070697_101038774 3300005536 Bacteria 729
48 Ga0070697_102137438 3300005536 Unclassified 501
49 Ga0070686_100161843 3300005544 Bacteria 1577
50 Ga0070686_100289594 3300005544 Bacteria 1211
51 Ga0070686_100652454 3300005544 Bacteria 834
52 Ga0070696_100135543 3300005546 Bacteria 1795
53 Ga0070696_100582641 3300005546 Bacteria 900
54 Ga0070696_101270756 3300005546 Bacteria 624
55 Ga0070693_100077507 3300005547 Bacteria 1973
56 Ga0070693_100793821 3300005547 Bacteria 701
57 Ga0070693_101311755 3300005547 Bacteria 560
58 Ga0070665_101140236 3300005548 Bacteria 791
59 Ga0070665_101879055 3300005548 Bacteria 605
60 Ga0070704_100374669 3300005549 Bacteria 1208
61 Ga0070704_100383448 3300005549 Bacteria 1195
62 Ga0070704_101873103 3300005549 Bacteria 556
63 Ga0068855_100099090 3300005563 Bacteria 3357
64 Ga0070664_101616142 3300005564 Unclassified 614
65 Ga0068857_101338637 3300005577 Bacteria 696
66 Ga0068854_101317112 3300005578 Bacteria 651
67 Ga0070702_100660797 3300005615 Bacteria 792
68 Ga0070702_100920429 3300005615 Bacteria 686
69 Ga0068852_100819260 3300005616 Bacteria 946
70 Ga0068859_100827370 3300005617 Bacteria 1013
71 Ga0068859_100836696 3300005617 Bacteria 1007
72 Ga0068859_101242736 3300005617 Bacteria 821
73 Ga0068859_101610831 3300005617 Bacteria 717
74 Ga0068864_101170094 3300005618 Bacteria 767
75 Ga0068864_102643002 3300005618 Bacteria 508
76 Ga0068866_10010974 3300005718 Bacteria 3902
77 Ga0068861_100037237 3300005719 Bacteria 3616
78 Ga0068861_101065812 3300005719 Bacteria 775
79 Ga0068858_100792041 3300005842 Bacteria 925
80 Ga0068858_100858191 3300005842 Bacteria 887
81 Ga0068858_101151486 3300005842 Bacteria 762
82 Ga0068858_101456856 3300005842 Bacteria 675
83 Ga0068860_102051724 3300005843 Bacteria 593
84 Ga0068862_100428590 3300005844 Bacteria 1243
85 Ga0068862_100975705 3300005844 Bacteria 837
86 Ga0081455_10101768 3300005937 Bacteria 2305
87 Ga0081455_10820728 3300005937 Unclassified 582
88 Ga0075363_100469526 3300006048 Bacteria 745
89 Ga0070712_100436743 3300006175 Bacteria 1088
90 Ga0075428_100019844 3300006844 Bacteria 7440
91 Ga0075428_100231528 3300006844 Bacteria 1994
92 Ga0075430_100001313 3300006846 Bacteria 20062
93 Ga0075430_100145080 3300006846 Bacteria 1977
94 Ga0075430_100174260 3300006846 Bacteria 1790
95 Ga0075430_100211478 3300006846 Bacteria 1609
96 Ga0075430_100255299 3300006846 Bacteria 1452
97 Ga0075430_100564753 3300006846 Bacteria 938
98 Ga0075430_101451976 3300006846 Bacteria 564
99 Ga0075431_100000292 3300006847 Bacteria 39252
100 Ga0075431_100046754 3300006847 Bacteria 4463
101 Ga0075431_100081645 3300006847 Bacteria 3338
102 Ga0075431_100976711 3300006847 Bacteria 814
103 Ga0075433_10010629 3300006852 Bacteria 7400
104 Ga0075434_100071049 3300006871 Bacteria 3472
105 Ga0075434_100609105 3300006871 Bacteria 1111
106 Ga0075434_100924641 3300006871 Bacteria 887
107 Ga0075429_100031022 3300006880 Bacteria 4645
108 Ga0075429_100033614 3300006880 Bacteria 4457
109 Ga0068865_100371838 3300006881 Bacteria 1163
110 Ga0068865_101537970 3300006881 Unclassified 597
111 Ga0068865_101916592 3300006881 Bacteria 537
112 Ga0075436_100011964 3300006914 Bacteria 5951
113 Ga0075436_100855563 3300006914 Bacteria 679
114 Ga0097620_100827311 3300006931 Bacteria 1013
115 Ga0097620_100836811 3300006931 Bacteria 1007
116 Ga0097620_101242678 3300006931 Bacteria 821
117 Ga0097620_101611216 3300006931 Bacteria 717
118 Ga0075435_100009800 3300007076 Bacteria 6971
119 Ga0075435_100025127 3300007076 Bacteria 4633
120 Ga0075435_100313442 3300007076 Bacteria 1343
121 Ga0099795_10127219 3300007788 Bacteria 1024
122 Ga0105251_10494774 3300009011 Unclassified 571
123 Ga0111539_10218631 3300009094 Bacteria 2219
124 Ga0111539_10328066 3300009094 Bacteria 1781
125 Ga0111539_10328196 3300009094 Bacteria 1781
126 Ga0111539_10865125 3300009094 Bacteria 1052
127 Ga0105245_10000588 3300009098 Bacteria 32943
128 Ga0105245_10033497 3300009098 Bacteria 4555
129 Ga0105245_10131870 3300009098 Bacteria 2345
130 Ga0105245_10172997 3300009098 Bacteria 2057
131 Ga0105245_11099771 3300009098 Bacteria 841
132 Ga0105245_12158500 3300009098 Bacteria 611
133 Ga0105247_11053884 3300009101 Bacteria 638
134 Ga0105247_11308888 3300009101 Bacteria 582
135 Ga0114129_10289888 3300009147 Bacteria 2184
136 Ga0114129_10336370 3300009147 Bacteria 2004
137 Ga0114129_10406354 3300009147 Bacteria 1794
138 Ga0114129_10589446 3300009147 Bacteria 1442
139 Ga0114129_11258647 3300009147 Bacteria 919
140 Ga0114129_11633847 3300009147 Bacteria 788
141 Ga0105243_10393002 3300009148 Bacteria 1286
142 Ga0105243_10744546 3300009148 Bacteria 960
143 Ga0105243_12282607 3300009148 Bacteria 578
144 Ga0105243_12617916 3300009148 Bacteria 544
145 Ga0105242_10082683 3300009176 Bacteria 2688
146 Ga0105242_10087866 3300009176 Bacteria 2610
147 Ga0105242_10695362 3300009176 Bacteria 994
148 Ga0105242_11319993 3300009176 Bacteria 746
149 Ga0105242_13209766 3300009176 Bacteria 508
150 Ga0105242_13233545 3300009176 Bacteria 506
151 Ga0105248_10580762 3300009177 Bacteria 1264
152 Ga0105237_10600201 3300009545 Bacteria 1108
153 Ga0105238_11344413 3300009551 Bacteria 741
154 Ga0105238_12739122 3300009551 Unclassified 529
155 Ga0105249_10026792 3300009553 Bacteria 5198
156 Ga0105249_10040084 3300009553 Bacteria 4254
157 Ga0105249_11901301 3300009553 Bacteria 668
158 Ga0105249_11988500 3300009553 Bacteria 654
159 Ga0105239_10344355 3300010375 Bacteria 1682
160 Ga0105239_10387945 3300010375 Bacteria 1580
161 Ga0105246_10285336 3300011119 Bacteria 1326
162 Ga0105246_10432962 3300011119 Bacteria 1101
163 Ga0105246_11565353 3300011119 Unclassified 621
164 Ga0105246_11682540 3300011119 Bacteria 602
165 Ga0157373_10314182 3300013100 Bacteria 1114
166 Ga0157370_12134188 3300013104 Bacteria 502
167 Ga0157369_10287272 3300013105 Bacteria 1713
168 Ga0157369_11382868 3300013105 Bacteria 717
169 Ga0157369_12557716 3300013105 Bacteria 516
170 Ga0157374_10688563 3300013296 Bacteria 1035
171 Ga0157378_11030299 3300013297 Bacteria 858
172 Ga0157378_13117359 3300013297 Unclassified 515
173 Ga0163162_10304871 3300013306 Bacteria 1725
174 Ga0163162_10872510 3300013306 Bacteria 1014
175 Ga0163162_12474765 3300013306 Bacteria 597
176 Ga0163162_13092178 3300013306 Bacteria 534
177 Ga0163162_13217361 3300013306 Bacteria 524
178 Ga0157372_11318986 3300013307 Bacteria 833
179 Ga0157375_10097048 3300013308 Bacteria 3021
180 Ga0157375_10661478 3300013308 Bacteria 1200
181 Ga0157375_11031363 3300013308 Bacteria 961
182 Ga0157375_12101718 3300013308 Bacteria 672
183 Ga0163163_10703311 3300014325 Bacteria 1074
184 Ga0163163_11197473 3300014325 Bacteria 822
185 Ga0163163_12389445 3300014325 Bacteria 587
186 Ga0157380_10170525 3300014326 Bacteria 1901
187 Ga0157380_10318156 3300014326 Bacteria 1441
188 Ga0157380_11296782 3300014326 Bacteria 775
189 Ga0157380_13526169 3300014326 Bacteria 501
190 Ga0157379_10295301 3300014968 Bacteria 1476
191 Ga0157379_10522483 3300014968 Bacteria 1102
192 Ga0157379_11558188 3300014968 Bacteria 644
193 Ga0157379_12483856 3300014968 Bacteria 518
194 Ga0157376_10356784 3300014969 Bacteria 1401
195 Ga0157376_12337801 3300014969 Bacteria 574
196 Ga0163161_10862453 3300017792 Bacteria 765
197 Ga0163161_10871464 3300017792 Bacteria 761
198 Ga0206349_1090305 3300020075 Bacteria 651
199 Ga0206353_10276651 3300020082 Bacteria 522
200 Ga0213872_10101509 3300021361 Bacteria 1283
201 Ga0213876_10018029 3300021384 Bacteria 3725
202 Ga0213876_10211787 3300021384 Bacteria 1030
203 Ga0213876_10240922 3300021384 Bacteria 961
204 Ga0213871_10158208 3300021441 Bacteria 692
205 Ga0224712_10383941 3300022467 Bacteria 668
206 Ga0207710_10512145 3300025900 Bacteria 623
207 Ga0207688_10025101 3300025901 Bacteria 3271
208 Ga0207688_11079937 3300025901 Bacteria 506
209 Ga0207680_11262444 3300025903 Bacteria 526
210 Ga0207699_10955431 3300025906 Bacteria 633
211 Ga0207699_11463046 3300025906 Bacteria 505
212 Ga0207645_10132534 3300025907 Bacteria 1622
213 Ga0207645_10771720 3300025907 Bacteria 654
214 Ga0207684_10158450 3300025910 Bacteria 1949
215 Ga0207707_10020609 3300025912 Bacteria 5759
216 Ga0207707_10067526 3300025912 Bacteria 3115
217 Ga0207707_10361957 3300025912 Bacteria 1249
218 Ga0207693_10413186 3300025915 Bacteria 1055
219 Ga0207662_10001752 3300025918 Bacteria 10652
220 Ga0207657_10094254 3300025919 Bacteria 2493
221 Ga0207649_10737243 3300025920 Bacteria 766
222 Ga0207652_10169647 3300025921 Bacteria 1958
223 Ga0207646_10032306 3300025922 Bacteria 4737
224 Ga0207659_11364967 3300025926 Unclassified 608
225 Ga0207687_10000461 3300025927 Bacteria 27698
226 Ga0207687_10560162 3300025927 Bacteria 960
227 Ga0207687_10602787 3300025927 Bacteria 926
228 Ga0207687_10764459 3300025927 Bacteria 823
229 Ga0207700_10066899 3300025928 Bacteria 2748
230 Ga0207664_10376313 3300025929 Bacteria 1260
231 Ga0207690_10012386 3300025932 Bacteria 5100
232 Ga0207690_10678390 3300025932 Bacteria 846
233 Ga0207706_10017872 3300025933 Bacteria 6385
234 Ga0207686_10182314 3300025934 Bacteria 1490
235 Ga0207686_10504394 3300025934 Bacteria 939
236 Ga0207670_10553209 3300025936 Bacteria 940
237 Ga0207669_11420279 3300025937 Bacteria 591
238 Ga0207704_10216005 3300025938 Bacteria 1415
239 Ga0207704_11617145 3300025938 Unclassified 557
240 Ga0207665_10365504 3300025939 Bacteria 1092
241 Ga0207691_10836950 3300025940 Bacteria 772
242 Ga0207711_10966066 3300025941 Bacteria 791
243 Ga0207689_10031077 3300025942 Bacteria 4448
244 Ga0207661_11467390 3300025944 Bacteria 625
245 Ga0207661_11997281 3300025944 Bacteria 526
246 Ga0207679_11043147 3300025945 Bacteria 750
247 Ga0207712_10119936 3300025961 Bacteria 1988
248 Ga0207712_10185181 3300025961 Bacteria 1639
249 Ga0207712_11016684 3300025961 Bacteria 736
250 Ga0207712_11941412 3300025961 Bacteria 527
251 Ga0207640_11832900 3300025981 Bacteria 549
252 Ga0207658_10538638 3300025986 Bacteria 1044
253 Ga0207658_11161749 3300025986 Bacteria 706
254 Ga0207677_10060281 3300026023 Bacteria 2622
255 Ga0207677_10082808 3300026023 Bacteria 2307
256 Ga0207677_10322796 3300026023 Bacteria 1284
257 Ga0207703_10100532 3300026035 Bacteria 2450
258 Ga0207703_10835799 3300026035 Bacteria 880
259 Ga0207703_11306578 3300026035 Bacteria 698
260 Ga0207639_11895029 3300026041 Bacteria 557
261 Ga0207708_10198868 3300026075 Bacteria 1598
262 Ga0207708_10843797 3300026075 Bacteria 791
263 Ga0207708_11027201 3300026075 Bacteria 717
264 Ga0207648_10066506 3300026089 Bacteria 3143
265 Ga0207648_11488443 3300026089 Bacteria 636
266 Ga0207676_12337763 3300026095 Bacteria 532
267 Ga0207675_100052810 3300026118 Bacteria 3792
268 Ga0207675_100919222 3300026118 Unclassified 892
269 Ga0207675_100937724 3300026118 Bacteria 883
270 Ga0207698_11170070 3300026142 Bacteria 783
271 Ga0207428_10165139 3300027907 Bacteria 1679
272 Ga0207428_10364238 3300027907 Bacteria 1062
273 Ga0268265_10517407 3300028380 Bacteria 1127
274 Ga0268265_10824649 3300028380 Bacteria 906
275 Ga0268264_10566242 3300028381 Bacteria 1116
276 Ga0268264_11265263 3300028381 Bacteria 748
277 Ga0265326_10191226 3300028558 Bacteria 587
278 Ga0265334_10001794 3300028573 Bacteria 10246
279 Ga0265338_10000435 3300028800 Bacteria 75064
280 Ga0265338_10609663 3300028800 Unclassified 760
281 Ga0265762_1044981 3300030760 Bacteria 873
282 Ga0265325_10000685 3300031241 Bacteria 24690
283 Ga0265340_10149531 3300031247 Bacteria 1065
284 Ga0265339_10006969 3300031249 Bacteria 7347
285 Ga0265327_10072375 3300031251 Bacteria 1721
286 Ga0265316_10143077 3300031344 Bacteria 1795
287 Ga0265313_10043999 3300031595 Bacteria 2182
288 Ga0265313_10294774 3300031595 Bacteria 653
289 Ga0310107_139004 3300031615 Bacteria 506
290 Ga0265314_10164116 3300031711 Bacteria 1348
291 Ga0265314_10477567 3300031711 Bacteria 660
292 Ga0307406_11317430 3300031901 Bacteria 631
293 Ga0307407_10478078 3300031903 Bacteria 909
294 Ga0307407_10614620 3300031903 Bacteria 811
295 Ga0307409_100157637 3300031995 Bacteria 1981
296 Ga0307409_100778459 3300031995 Bacteria 963
297 Ga0307416_102896622 3300032002 Bacteria 574
298 Ga0307416_102959348 3300032002 Bacteria 568
299 Ga0307414_11688744 3300032004 Bacteria 591
300 Ga0307411_11470698 3300032005 Bacteria 625
301 Ga0307415_100587892 3300032126 Bacteria 989
302 Ga0307415_100963152 3300032126 Bacteria 791
303 Ga0373950_0018466 3300034818 Bacteria 1210
304 Ga0373944_0110849 3300035089 Bacteria 937
305 Ga0373951_0194095 3300035091 Bacteria 589
306 Ga0373923_0181129 3300035111 Bacteria 968
307 Ga0373941_0229136 3300035115 Bacteria 717
308 Ga0373943_0281668 3300035170 Bacteria 940
309 Ga0373943_0551422 3300035170 Bacteria 676
310 Ga0373961_0257020 3300035241 Bacteria 634
311 Ga0373931_0274609 3300035691 Bacteria 1033
312 Ga0373935_0133728 3300035692 Bacteria 1669
313 Ga0373935_1437513 3300035692 Bacteria 516
314 Ga0373927_0251171 3300035695 Bacteria 1163
315 Ga0373933_0251140 3300035724 Bacteria 1139
316 Ga0373933_0567989 3300035724 Bacteria 744
317 Ga0373933_1132022 3300035724 Bacteria 516
318 Ga0373947_0047356 3300035725 Bacteria 2576
319 Ga0373937_0317434 3300036401 Bacteria 1474
320 Ga0373937_1138142 3300036401 Bacteria 729
321 Ga0373937_1362991 3300036401 Bacteria 657
322 Ga0373925_0104018 3300037068 Bacteria 2186
323 Ga0373925_1429954 3300037068 Bacteria 566
324 Ga0242420_058527 3300038996 Bacteria 765
325 Ga0436365_0040103 3300039437 Bacteria 893
326 Ga0436365_0472547 3300039437 Bacteria 904
327 Ga0436365_0476327 3300039437 Bacteria 1647
328 Ga0436365_1154852 3300039437 Bacteria 931
329 Ga0436365_1326098 3300039437 Bacteria 4569
330 Ga0436360_0006190 3300039438 Unclassified 605
331 Ga0436360_0497291 3300039438 Bacteria 709
332 Ga0436361_0224802 3300039447 Archaea 597
333 Ga0436361_1099732 3300039447 Bacteria 3478
334 Ga0436362_0835055 3300039453 Bacteria 5779
335 Ga0436362_1079045 3300039453 Bacteria 8419
336 Ga0439431_0041387 3300041997 Bacteria 1175
337 Ga0439452_073492 3300042010 Bacteria 751
338 Ga0439462_0110425 3300042015 Bacteria 761
339 Ga0466966_0761137 3300044684 Bacteria 584
340 Ga0466961_0265802 3300044693 Bacteria 1051
341 Ga0466963_0609572 3300044694 Bacteria 771
342 Ga0466970_0053671 3300044765 Bacteria 2153
343 Ga0466960_0077818 3300044901 Bacteria 1664
344 Ga0466959_0078033 3300045049 Bacteria 2389
345 Ga0466958_0821234 3300045836 Bacteria 606
346 Ga0466967_0866375 3300045976 Bacteria 898
347 Ga0466967_0945523 3300045976 Bacteria 857
348 Ga0495592_0083285 3300046454 Bacteria 2310
349 Ga0495592_0583317 3300046454 Bacteria 684
350 Ga0495603_0177552 3300046455 Bacteria 1233
351 Ga0495629_0301507 3300046459 Bacteria 1097
352 Ga0495651_0739342 3300046462 Bacteria 611
353 Ga0495651_1002933 3300046462 Bacteria 507
354 Ga0495653_0032572 3300046463 Bacteria 4136
355 Ga0495653_0253509 3300046463 Bacteria 1167
356 Ga0495582_0152746 3300046473 Bacteria 1311
357 Ga0495582_0728482 3300046473 Unclassified 574
358 Ga0495662_0035781 3300046476 Bacteria 2397
359 Ga0495662_0489128 3300046476 Bacteria 603
360 Ga0495664_0195623 3300046477 Bacteria 1226
361 Ga0495594_0832215 3300046499 Bacteria 520
362 Ga0495596_0006799 3300046500 Bacteria 5222
363 Ga0495596_0194881 3300046500 Bacteria 787
364 Ga0495608_0028631 3300046511 Bacteria 3786
365 Ga0495608_0137279 3300046511 Bacteria 1562
366 Ga0495608_0179081 3300046511 Bacteria 1342
367 Ga0495616_0361196 3300046513 Bacteria 603
368 Ga0495618_0130215 3300046514 Bacteria 1610
369 Ga0495618_0235156 3300046514 Bacteria 1153
370 Ga0495620_0020462 3300046515 Bacteria 3231
371 Ga0495628_0019984 3300046516 Bacteria 5531
372 Ga0495628_0033357 3300046516 Bacteria 4150
373 Ga0495628_0829686 3300046516 Bacteria 645
374 Ga0495628_0973544 3300046516 Bacteria 585
375 Ga0495630_0029077 3300046517 Bacteria 4108
376 Ga0495630_0043923 3300046517 Bacteria 3339
377 Ga0495630_0103942 3300046517 Bacteria 2149
378 Ga0495630_0255021 3300046517 Bacteria 1340
379 Ga0495630_0469012 3300046517 Bacteria 965
380 Ga0495630_0547644 3300046517 Bacteria 887
381 Ga0495630_0665843 3300046517 Bacteria 797
382 Ga0495631_0334367 3300046518 Bacteria 645
383 Ga0495644_0007102 3300046523 Bacteria 4332
384 Ga0495666_0211226 3300046526 Bacteria 890
385 Ga0495652_0905285 3300046529 Unclassified 582
386 Ga0495654_0368602 3300046530 Bacteria 575
387 Ga0495665_0060393 3300046531 Bacteria 2002
388 Ga0495640_0012999 3300046533 Bacteria 6341
389 Ga0495640_0326976 3300046533 Bacteria 949
390 Ga0495640_0824200 3300046533 Unclassified 552
391 Ga0495586_0131149 3300046535 Bacteria 1403
392 Ga0495587_0318858 3300046536 Bacteria 868
393 Ga0495598_0125524 3300046537 Bacteria 874
394 Ga0495598_0441650 3300046537 Bacteria 514
395 Ga0495645_0162332 3300046543 Bacteria 1544
396 Ga0495656_0002455 3300046615 Bacteria 6166
397 Ga0495634_0138961 3300046642 Bacteria 1544
398 Ga0495634_0319435 3300046642 Bacteria 935
399 Ga0495634_0401882 3300046642 Bacteria 814
400 Ga0495635_0164270 3300046663 Bacteria 1511
401 Ga0495588_0103974 3300046674 Bacteria 1494
402 Ga0495657_0056429 3300046675 Bacteria 2615
403 Ga0495657_0096128 3300046675 Bacteria 1893
404 Ga0495657_0309610 3300046675 Bacteria 940
405 Ga0495646_0629583 3300046680 Bacteria 543
406 Ga0495647_0043930 3300046681 Bacteria 1712
407 Ga0495647_0078890 3300046681 Bacteria 1332
408 Ga0495647_0640665 3300046681 Bacteria 500
409 Ga0495658_0076061 3300046683 Bacteria 1961
410 Ga0495658_0227017 3300046683 Bacteria 1170
411 Ga0495658_0808293 3300046683 Bacteria 600
412 Ga0495613_0073393 3300046689 Bacteria 2493
413 Ga0495613_0117296 3300046689 Bacteria 1914
414 Ga0495613_0217466 3300046689 Bacteria 1342
415 Ga0495613_0574644 3300046689 Bacteria 752
416 Ga0495624_0019280 3300046690 Bacteria 4556
417 Ga0495624_0481758 3300046690 Bacteria 743
418 Ga0495589_0387118 3300046794 Bacteria 642
419 Ga0495600_0158636 3300046809 Bacteria 1463
420 Ga0495604_0321535 3300047317 Bacteria 1034
421 Ga0495604_0648444 3300047317 Bacteria 674
422 Ga0495674_0066943 3300047319 Bacteria 3114
423 Ga0495674_0285133 3300047319 Bacteria 1352
424 Ga0495674_0425806 3300047319 Bacteria 1069
425 Ga0495676_0050363 3300047321 Bacteria 3341
426 Ga0495676_0497744 3300047321 Bacteria 800
427 Ga0495676_0744543 3300047321 Bacteria 633
428 Ga0495680_0056259 3300047322 Bacteria 3046
429 Ga0495680_0457410 3300047322 Bacteria 873
430 Ga0495680_0713480 3300047322 Bacteria 661
431 Ga0495680_0951580 3300047322 Bacteria 552
432 Ga0495675_0226100 3300047444 Bacteria 1130
433 Ga0495675_0338299 3300047444 Bacteria 887
434 Ga0495675_0384167 3300047444 Unclassified 821
435 Ga0495673_0034581 3300047469 Bacteria 2335
436 Ga0495681_0102664 3300047470 Bacteria 1248
437 Ga0495684_0039234 3300047471 Bacteria 3630
438 Ga0495684_0233698 3300047471 Bacteria 1344
439 Ga0495686_0000008 3300047472 Bacteria 727479
440 Ga0495686_0019654 3300047472 Bacteria 4512
441 Ga0495686_0234547 3300047472 Bacteria 1037
442 Ga0495614_0228773 3300048089 Bacteria 847
443 Ga0495614_0346204 3300048089 Bacteria 692
444 Ga0495615_0021570 3300048090 Bacteria 1455
445 Ga0496100_0818919 3300048903 Bacteria 730
446 Ga0496101_1289249 3300048904 Bacteria 571
447 Ga0496102_0356525 3300048905 Bacteria 1377
448 Ga0496104_1852952 3300048907 Bacteria 505
449 Ga0496106_0394868 3300048909 Bacteria 1112
450 Ga0496108_0147390 3300048911 Bacteria 2030
451 Ga0496108_0378258 3300048911 Bacteria 1236
452 Ga0496108_1011016 3300048911 Bacteria 710
453 Ga0496108_1633717 3300048911 Bacteria 532
454 Ga0496109_0094116 3300048912 Bacteria 2773
455 Ga0496109_0127763 3300048912 Bacteria 2371
456 Ga0496109_1079271 3300048912 Bacteria 740
457 Ga0496110_0262583 3300048913 Bacteria 1572
458 Ga0496110_1396865 3300048913 Bacteria 610
459 Ga0496111_0503491 3300048914 Bacteria 891
460 Ga0496112_0022126 3300048915 Bacteria 6056
461 Ga0496112_0653002 3300048915 Bacteria 981
462 Ga0496112_1173882 3300048915 Bacteria 685
463 Ga0496113_0471195 3300048916 Bacteria 1009
464 Ga0496113_0695339 3300048916 Bacteria 812
465 Ga0496113_0778471 3300048916 Bacteria 761
466 Ga0496114_1388890 3300048917 Unclassified 590
467 Ga0496115_1245446 3300048918 Bacteria 557
468 Ga0501036_1010525 3300049572 Bacteria 681
469 Ga0501039_0151354 3300049575 Bacteria 1823
470 Ga0501040_0265694 3300049576 Bacteria 1225
471 Ga0501042_0749200 3300049578 Bacteria 710
472 Ga0501043_0559577 3300049579 Bacteria 849
473 Ga0501067_0189407 3300049583 Bacteria 1146
474 Ga0501068_1084610 3300049584 Bacteria 529
475 Ga0501069_0129125 3300049585 Bacteria 1447
476 Ga0501071_1548478 3300049587 Bacteria 512
477 Ga0501072_0802879 3300049588 Bacteria 737
478 Ga0501075_0381184 3300049591 Bacteria 1075
479 Ga0501077_1009639 3300049593 Bacteria 535
480 Ga0501079_0603562 3300049741 Bacteria 864
481 Ga0501079_0743674 3300049741 Bacteria 772
482 Ga0501045_0907081 3300049824 Bacteria 647
483 nmdc:mga03n38_402507_c1 3300050490 Bacteria 754
484 nmdc:mga05p37_1060496_c1 3300050507 Bacteria 854
485 nmdc:mga05p37_1066472_c1 3300050507 Bacteria 850
486 nmdc:mga05p37_181592_c1 3300050507 Bacteria 2559
487 nmdc:mga05p37_438472_c1 3300050507 Bacteria 1515
488 nmdc:mga05p37_636891_c1 3300050507 Bacteria 1197
489 nmdc:mga09592_15403_c1 3300050508 Bacteria 6246
490 nmdc:mga09592_24285_c1 3300050508 Bacteria 5012
491 nmdc:mga0qj67_130950_c1 3300050509 Bacteria 2032
492 nmdc:mga0qj67_222763_c1 3300050509 Bacteria 1531
493 nmdc:mga0qj67_29894_c1 3300050509 Bacteria 4235
494 nmdc:mga0qj67_403777_c1 3300050509 Bacteria 1103
495 nmdc:mga0qj67_87707_c1 3300050509 Bacteria 2498
496 nmdc:mga06r32_1510343_c1 3300050510 Bacteria 612
497 nmdc:mga06r32_1598_c1 3300050510 Bacteria 20412
498 nmdc:mga06r32_57064_c1 3300050510 Bacteria 3750
499 nmdc:mga08y16_353905_c1 3300050511 Bacteria 1508
500 nmdc:mga0n895_17286_c1 3300050512 Bacteria 6646
501 nmdc:mga0n895_28721_c1 3300050512 Bacteria 5294
502 nmdc:mga0n895_406919_c1 3300050512 Bacteria 1376
503 nmdc:mga0n895_408421_c1 3300050512 Bacteria 1373
504 nmdc:mga0rr50_156621_c1 3300050513 Bacteria 1846
505 nmdc:mga0rr50_628579_c1 3300050513 Bacteria 916
506 nmdc:mga0rr50_83477_c1 3300050513 Bacteria 2470
507 nmdc:mga08x19_455753_c1 3300050514 Bacteria 900
508 nmdc:mga08x19_60411_c1 3300050514 Bacteria 2455
509 nmdc:mga0a205_1207_c1 3300050515 Bacteria 21618
510 nmdc:mga0a205_880564_c1 3300050515 Bacteria 742
511 nmdc:mga0sz30_297138_c1 3300050516 Bacteria 720
512 Ga0495601_0036955 3300053077 Bacteria 3052
513 Ga0495601_0227661 3300053077 Bacteria 1218
514 Ga0495612_0402113 3300053078 Bacteria 622
515 Ga0495595_0005874 3300053084 Bacteria 4976
516 Ga0495619_0002631 3300053085 Bacteria 11732
517 Ga0495619_0115504 3300053085 Bacteria 1837
518 Ga0495619_0180654 3300053085 Bacteria 1460
519 Ga0495619_0228806 3300053085 Bacteria 1288
520 Ga0500628_113401 3300053129 Bacteria 729
521 Ga0501084_0121615 3300054114 Bacteria 2195
522 Ga0501082_0108973 3300060353 Bacteria 2397
523 Ga0501082_0192042 3300060353 Bacteria 1776
524 Ga0501082_1304939 3300060353 Bacteria 634
525 Ga0530510_0020821 3300061734 Bacteria 4664
526 Ga0070671_101669285
527 Ga0070676_10632334
528 Ga0070690_100466471
529 Ga0068869_100016248
530 Ga0070680_101648323
531 Ga0068868_100156823
532 Ga0068868_100207217
533 Ga0068868_100249763
534 Ga0068868_101879083
535 Ga0070660_100492278
536 Ga0070689_100492660
537 Ga0070668_100780332
538 Ga0070669_101848627
539 Ga0070675_101385748
540 Ga0070688_100060226
541 Ga0070659_100043079
542 Ga0070659_100801761
543 Ga0070709_10413687
544 Ga0070714_100190995
545 Ga0070714_101243077
546 Ga0070714_102192452
547 Ga0070713_102134649
548 Ga0070701_10303728
549 Ga0070705_100069239
550 Ga0070705_100830191
551 Ga0070700_100277944
552 Ga0070700_100350585
553 Ga0070700_101729516
554 Ga0070694_100982257
555 Ga0070708_100086113
556 Ga0070663_100616882
557 Ga0070662_100033306
558 Ga0070681_10019419
559 Ga0070706_100025420
560 Ga0070706_101611196
561 Ga0070707_100126791
562 Ga0070707_100804624
563 Ga0070698_100104165
564 Ga0070698_100585627
565 Ga0070698_100595321
566 Ga0070698_100794974
567 Ga0070699_100102743
568 Ga0070699_100535527
569 Ga0070684_101258371
570 Ga0070684_101558282
571 Ga0070697_100029940
572 Ga0070697_101038774
573 Ga0070697_102137438
574 Ga0070686_100161843
575 Ga0070686_100289594
576 Ga0070686_100652454
577 Ga0070696_100135543
578 Ga0070696_100582641
579 Ga0070696_101270756
580 Ga0070693_100077507
581 Ga0070693_100793821
582 Ga0070693_101311755
583 Ga0070665_101140236
584 Ga0070665_101879055
585 Ga0070704_100374669
586 Ga0070704_100383448
587 Ga0070704_101873103
588 Ga0068855_100099090
589 Ga0070664_101616142
590 Ga0068857_101338637
591 Ga0068854_101317112
592 Ga0070702_100660797
593 Ga0070702_100920429
594 Ga0068852_100819260
595 Ga0068859_100827370
596 Ga0068859_100836696
597 Ga0068859_101242736
598 Ga0068859_101610831
599 Ga0068864_101170094
600 Ga0068864_102643002
601 Ga0068866_10010974
602 Ga0068861_100037237
603 Ga0068861_101065812
604 Ga0068858_100792041
605 Ga0068858_100858191
606 Ga0068858_101151486
607 Ga0068858_101456856
608 Ga0068860_102051724
609 Ga0068862_100428590
610 Ga0068862_100975705
611 Ga0081455_10101768
612 Ga0081455_10820728
613 Ga0075363_100469526
614 Ga0070712_100436743
615 Ga0075428_100019844
616 Ga0075428_100231528
617 Ga0075430_100001313
618 Ga0075430_100145080
619 Ga0075430_100174260
620 Ga0075430_100211478
621 Ga0075430_100255299
622 Ga0075430_100564753
623 Ga0075430_101451976
624 Ga0075431_100000292
625 Ga0075431_100046754
626 Ga0075431_100081645
627 Ga0075431_100976711
628 Ga0075433_10010629
629 Ga0075434_100071049
630 Ga0075434_100609105
631 Ga0075434_100924641
632 Ga0075429_100031022
633 Ga0075429_100033614
634 Ga0068865_100371838
635 Ga0068865_101537970
636 Ga0068865_101916592
637 Ga0075436_100011964
638 Ga0075436_100855563
639 Ga0097620_100827311
640 Ga0097620_100836811
641 Ga0097620_101242678
642 Ga0097620_101611216
643 Ga0075435_100009800
644 Ga0075435_100025127
645 Ga0075435_100313442
646 Ga0099795_10127219
647 Ga0105251_10494774
648 Ga0111539_10218631
649 Ga0111539_10328066
650 Ga0111539_10328196
651 Ga0111539_10865125
652 Ga0105245_10000588
653 Ga0105245_10033497
654 Ga0105245_10131870
655 Ga0105245_10172997
656 Ga0105245_11099771
657 Ga0105245_12158500
658 Ga0105247_11053884
659 Ga0105247_11308888
660 Ga0114129_10289888
661 Ga0114129_10336370
662 Ga0114129_10406354
663 Ga0114129_10589446
664 Ga0114129_11258647
665 Ga0114129_11633847
666 Ga0105243_10393002
667 Ga0105243_10744546
668 Ga0105243_12282607
669 Ga0105243_12617916
670 Ga0105242_10082683
671 Ga0105242_10087866
672 Ga0105242_10695362
673 Ga0105242_11319993
674 Ga0105242_13209766
675 Ga0105242_13233545
676 Ga0105248_10580762
677 Ga0105237_10600201
678 Ga0105238_11344413
679 Ga0105238_12739122
680 Ga0105249_10026792
681 Ga0105249_10040084
682 Ga0105249_11901301
683 Ga0105249_11988500
684 Ga0105239_10344355
685 Ga0105239_10387945
686 Ga0105246_10285336
687 Ga0105246_10432962
688 Ga0105246_11565353
689 Ga0105246_11682540
690 Ga0157373_10314182
691 Ga0157370_12134188
692 Ga0157369_10287272
693 Ga0157369_11382868
694 Ga0157369_12557716
695 Ga0157374_10688563
696 Ga0157378_11030299
697 Ga0157378_13117359
698 Ga0163162_10304871
699 Ga0163162_10872510
700 Ga0163162_12474765
701 Ga0163162_13092178
702 Ga0163162_13217361
703 Ga0157372_11318986
704 Ga0157375_10097048
705 Ga0157375_10661478
706 Ga0157375_11031363
707 Ga0157375_12101718
708 Ga0163163_10703311
709 Ga0163163_11197473
710 Ga0163163_12389445
711 Ga0157380_10170525
712 Ga0157380_10318156
713 Ga0157380_11296782
714 Ga0157380_13526169
715 Ga0157379_10295301
716 Ga0157379_10522483
717 Ga0157379_11558188
718 Ga0157379_12483856
719 Ga0157376_10356784
720 Ga0157376_12337801
721 Ga0163161_10862453
722 Ga0163161_10871464
723 Ga0206349_1090305
724 Ga0206353_10276651
725 Ga0213872_10101509
726 Ga0213876_10018029
727 Ga0213876_10211787
728 Ga0213876_10240922
729 Ga0213871_10158208
730 Ga0224712_10383941
731 Ga0207710_10512145
732 Ga0207688_10025101
733 Ga0207688_11079937
734 Ga0207680_11262444
735 Ga0207699_10955431
736 Ga0207699_11463046
737 Ga0207645_10132534
738 Ga0207645_10771720
739 Ga0207684_10158450
740 Ga0207707_10020609
741 Ga0207707_10067526
742 Ga0207707_10361957
743 Ga0207693_10413186
744 Ga0207662_10001752
745 Ga0207657_10094254
746 Ga0207649_10737243
747 Ga0207652_10169647
748 Ga0207646_10032306
749 Ga0207659_11364967
750 Ga0207687_10000461
751 Ga0207687_10560162
752 Ga0207687_10602787
753 Ga0207687_10764459
754 Ga0207700_10066899
755 Ga0207664_10376313
756 Ga0207690_10012386
757 Ga0207690_10678390
758 Ga0207706_10017872
759 Ga0207686_10182314
760 Ga0207686_10504394
761 Ga0207670_10553209
762 Ga0207669_11420279
763 Ga0207704_10216005
764 Ga0207704_11617145
765 Ga0207665_10365504
766 Ga0207691_10836950
767 Ga0207711_10966066
768 Ga0207689_10031077
769 Ga0207661_11467390
770 Ga0207661_11997281
771 Ga0207679_11043147
772 Ga0207712_10119936
773 Ga0207712_10185181
774 Ga0207712_11016684
775 Ga0207712_11941412
776 Ga0207640_11832900
777 Ga0207658_10538638
778 Ga0207658_11161749
779 Ga0207677_10060281
780 Ga0207677_10082808
781 Ga0207677_10322796
782 Ga0207703_10100532
783 Ga0207703_10835799
784 Ga0207703_11306578
785 Ga0207639_11895029
786 Ga0207708_10198868
787 Ga0207708_10843797
788 Ga0207708_11027201
789 Ga0207648_10066506
790 Ga0207648_11488443
791 Ga0207676_12337763
792 Ga0207675_100052810
793 Ga0207675_100919222
794 Ga0207675_100937724
795 Ga0207698_11170070
796 Ga0207428_10165139
797 Ga0207428_10364238
798 Ga0268265_10517407
799 Ga0268265_10824649
800 Ga0268264_10566242
801 Ga0268264_11265263
802 Ga0265326_10191226
803 Ga0265334_10001794
804 Ga0265338_10000435
805 Ga0265338_10609663
806 Ga0265762_1044981
807 Ga0265325_10000685
808 Ga0265340_10149531
809 Ga0265339_10006969
810 Ga0265327_10072375
811 Ga0265316_10143077
812 Ga0265313_10043999
813 Ga0265313_10294774
814 Ga0310107_139004
815 Ga0265314_10164116
816 Ga0265314_10477567
817 Ga0307406_11317430
818 Ga0307407_10478078
819 Ga0307407_10614620
820 Ga0307409_100157637
821 Ga0307409_100778459
822 Ga0307416_102896622
823 Ga0307416_102959348
824 Ga0307414_11688744
825 Ga0307411_11470698
826 Ga0307415_100587892
827 Ga0307415_100963152
828 Ga0373950_0018466
829 Ga0373944_0110849
830 Ga0373951_0194095
831 Ga0373923_0181129
832 Ga0373941_0229136
833 Ga0373943_0281668
834 Ga0373943_0551422
835 Ga0373961_0257020
836 Ga0373931_0274609
837 Ga0373935_0133728
838 Ga0373935_1437513
839 Ga0373927_0251171
840 Ga0373933_0251140
841 Ga0373933_0567989
842 Ga0373933_1132022
843 Ga0373947_0047356
844 Ga0373937_0317434
845 Ga0373937_1138142
846 Ga0373937_1362991
847 Ga0373925_0104018
848 Ga0373925_1429954
849 Ga0242420_058527
850 Ga0436365_0040103
851 Ga0436365_0472547
852 Ga0436365_0476327
853 Ga0436365_1154852
854 Ga0436365_1326098
855 Ga0436360_0006190
856 Ga0436360_0497291
857 Ga0436361_0224802
858 Ga0436361_1099732
859 Ga0436362_0835055
860 Ga0436362_1079045
861 Ga0439431_0041387
862 Ga0439452_073492
863 Ga0439462_0110425
864 Ga0466966_0761137
865 Ga0466961_0265802
866 Ga0466963_0609572
867 Ga0466970_0053671
868 Ga0466960_0077818
869 Ga0466959_0078033
870 Ga0466958_0821234
871 Ga0466967_0866375
872 Ga0466967_0945523
873 Ga0495592_0083285
874 Ga0495592_0583317
875 Ga0495603_0177552
876 Ga0495629_0301507
877 Ga0495651_0739342
878 Ga0495651_1002933
879 Ga0495653_0032572
880 Ga0495653_0253509
881 Ga0495582_0152746
882 Ga0495582_0728482
883 Ga0495662_0035781
884 Ga0495662_0489128
885 Ga0495664_0195623
886 Ga0495594_0832215
887 Ga0495596_0006799
888 Ga0495596_0194881
889 Ga0495608_0028631
890 Ga0495608_0137279
891 Ga0495608_0179081
892 Ga0495616_0361196
893 Ga0495618_0130215
894 Ga0495618_0235156
895 Ga0495620_0020462
896 Ga0495628_0019984
897 Ga0495628_0033357
898 Ga0495628_0829686
899 Ga0495628_0973544
900 Ga0495630_0029077
901 Ga0495630_0043923
902 Ga0495630_0103942
903 Ga0495630_0255021
904 Ga0495630_0469012
905 Ga0495630_0547644
906 Ga0495630_0665843
907 Ga0495631_0334367
908 Ga0495644_0007102
909 Ga0495666_0211226
910 Ga0495652_0905285
911 Ga0495654_0368602
912 Ga0495665_0060393
913 Ga0495640_0012999
914 Ga0495640_0326976
915 Ga0495640_0824200
916 Ga0495586_0131149
917 Ga0495587_0318858
918 Ga0495598_0125524
919 Ga0495598_0441650
920 Ga0495645_0162332
921 Ga0495656_0002455
922 Ga0495634_0138961
923 Ga0495634_0319435
924 Ga0495634_0401882
925 Ga0495635_0164270
926 Ga0495588_0103974
927 Ga0495657_0056429
928 Ga0495657_0096128
929 Ga0495657_0309610
930 Ga0495646_0629583
931 Ga0495647_0043930
932 Ga0495647_0078890
933 Ga0495647_0640665
934 Ga0495658_0076061
935 Ga0495658_0227017
936 Ga0495658_0808293
937 Ga0495613_0073393
938 Ga0495613_0117296
939 Ga0495613_0217466
940 Ga0495613_0574644
941 Ga0495624_0019280
942 Ga0495624_0481758
943 Ga0495589_0387118
944 Ga0495600_0158636
945 Ga0495604_0321535
946 Ga0495604_0648444
947 Ga0495674_0066943
948 Ga0495674_0285133
949 Ga0495674_0425806
950 Ga0495676_0050363
951 Ga0495676_0497744
952 Ga0495676_0744543
953 Ga0495680_0056259
954 Ga0495680_0457410
955 Ga0495680_0713480
956 Ga0495680_0951580
957 Ga0495675_0226100
958 Ga0495675_0338299
959 Ga0495675_0384167
960 Ga0495673_0034581
961 Ga0495681_0102664
962 Ga0495684_0039234
963 Ga0495684_0233698
964 Ga0495686_0000008
965 Ga0495686_0019654
966 Ga0495686_0234547
967 Ga0495614_0228773
968 Ga0495614_0346204
969 Ga0495615_0021570
970 Ga0496100_0818919
971 Ga0496101_1289249
972 Ga0496102_0356525
973 Ga0496104_1852952
974 Ga0496106_0394868
975 Ga0496108_0147390
976 Ga0496108_0378258
977 Ga0496108_1011016
978 Ga0496108_1633717
979 Ga0496109_0094116
980 Ga0496109_0127763
981 Ga0496109_1079271
982 Ga0496110_0262583
983 Ga0496110_1396865
984 Ga0496111_0503491
985 Ga0496112_0022126
986 Ga0496112_0653002
987 Ga0496112_1173882
988 Ga0496113_0471195
989 Ga0496113_0695339
990 Ga0496113_0778471
991 Ga0496114_1388890
992 Ga0496115_1245446
993 Ga0501036_1010525
994 Ga0501039_0151354
995 Ga0501040_0265694
996 Ga0501042_0749200
997 Ga0501043_0559577
998 Ga0501067_0189407
999 Ga0501068_1084610
1000 Ga0501069_0129125
1001 Ga0501071_1548478
1002 Ga0501072_0802879
1003 Ga0501075_0381184
1004 Ga0501077_1009639
1005 Ga0501079_0603562
1006 Ga0501079_0743674
1007 Ga0501045_0907081
1008 nmdc:mga03n38_402507_c1
1009 nmdc:mga05p37_1060496_c1
1010 nmdc:mga05p37_1066472_c1
1011 nmdc:mga05p37_181592_c1
1012 nmdc:mga05p37_438472_c1
1013 nmdc:mga05p37_636891_c1
1014 nmdc:mga09592_15403_c1
1015 nmdc:mga09592_24285_c1
1016 nmdc:mga0qj67_130950_c1
1017 nmdc:mga0qj67_222763_c1
1018 nmdc:mga0qj67_29894_c1
1019 nmdc:mga0qj67_403777_c1
1020 nmdc:mga0qj67_87707_c1
1021 nmdc:mga06r32_1510343_c1
1022 nmdc:mga06r32_1598_c1
1023 nmdc:mga06r32_57064_c1
1024 nmdc:mga08y16_353905_c1
1025 nmdc:mga0n895_17286_c1
1026 nmdc:mga0n895_28721_c1
1027 nmdc:mga0n895_406919_c1
1028 nmdc:mga0n895_408421_c1
1029 nmdc:mga0rr50_156621_c1
1030 nmdc:mga0rr50_628579_c1
1031 nmdc:mga0rr50_83477_c1
1032 nmdc:mga08x19_455753_c1
1033 nmdc:mga08x19_60411_c1
1034 nmdc:mga0a205_1207_c1
1035 nmdc:mga0a205_880564_c1
1036 nmdc:mga0sz30_297138_c1
1037 Ga0495601_0036955
1038 Ga0495601_0227661
1039 Ga0495612_0402113
1040 Ga0495595_0005874
1041 Ga0495619_0002631
1042 Ga0495619_0115504
1043 Ga0495619_0180654
1044 Ga0495619_0228806
1045 Ga0500628_113401
1046 Ga0501084_0121615
1047 Ga0501082_0108973
1048 Ga0501082_0192042
1049 Ga0501082_1304939
1050 Ga0530510_0020821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

5

91

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9531 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9515 3 91
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9311 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9144 4 91
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9123 3 88
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9515 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9311 3 91 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9019 4 86 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9003 2 88 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8721 4 86 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A536BD79-F1-model_v4 MoaD/ThiS family protein 0.9928 1 77
AF-A0A1Q7B304-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9921 3 87
AF-A0A2E8LAV3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9872 3 91
AF-A0A535N387-F1-model_v4 MoaD/ThiS family protein 0.9864 1 91
AF-A0A1Q7QFQ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9856 1 90

Map