F459238

General Info

Members Datasets Scaffolds Average Seq Length
525 248 1050 440

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100008412|Ga0070704_1000084127
Length 481
Sequence MDGGTSRFLRAPPLVRFADRRYAPANAEDAAAAAAPVNSRAVDQAWLDELFEFIRIPSVSADAERVEEVRRAGEWVCDFVRGAGGEAELRDWEGHPLALGEISASSGNGDTPTIICYGHFDVQPPAPLDLWDSDPFEPTLRDGRLYGRGVADDKGQLYMLLKAAAELRSRDALPVNLRICCDGEEETGGHSIVDFLSADERGGDACVIFDTAMLKRDVPLFNLSVRGLIYLHVRVRTGARDLHSGVFGGAALNALHALVQALDAVLARDGRLLEPLRAGIAPPTEEELAAWAELTPGAEELAGQGARPMDAKAAEEFYLRTFAEPALDVNGIEGGSPVLQKTVLPVEAHANVSIRLAPGQDPDQIADQAERLLSEAAPEGAELEINRLSQSPPGLVDPGSPAVQLGLDAFERALGTRPLLVRSGGTLPIVPALADKGIPTILTGFALPDSNIHSPNENLLADYLPLGVKAAAELFTEFAKL

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100008412 3300005549 Bacteria 6188
2 Ga0070658_10023494 3300005327 Bacteria 4947
3 Ga0070683_100003323 3300005329 Bacteria 13003
4 Ga0070683_100014849 3300005329 Bacteria 6827
5 Ga0070683_100055147 3300005329 Bacteria 3687
6 Ga0070683_100068956 3300005329 Bacteria 3295
7 Ga0070683_100220564 3300005329 Bacteria 1802
8 Ga0070680_100127366 3300005336 Bacteria 2128
9 Ga0068868_100091309 3300005338 Bacteria 2454
10 Ga0070660_100005228 3300005339 Bacteria 8977
11 Ga0070660_100007503 3300005339 Bacteria 7604
12 Ga0070660_100015795 3300005339 Bacteria 5462
13 Ga0070660_100073282 3300005339 Bacteria 2677
14 Ga0070689_100003533 3300005340 Bacteria 10402
15 Ga0070691_10012693 3300005341 Bacteria 3859
16 Ga0070692_10058825 3300005345 Bacteria 2019
17 Ga0070668_100043289 3300005347 Bacteria 3453
18 Ga0070669_100036019 3300005353 Bacteria 3585
19 Ga0070675_100104917 3300005354 Bacteria 2385
20 Ga0070674_100033340 3300005356 Bacteria 3427
21 Ga0070674_100100101 3300005356 Bacteria 2110
22 Ga0070688_100002547 3300005365 Bacteria 9227
23 Ga0070703_10001473 3300005406 Bacteria 7070
24 Ga0070709_10013246 3300005434 Bacteria 4629
25 Ga0070709_10105655 3300005434 Bacteria 1884
26 Ga0070709_10123638 3300005434 Bacteria 1758
27 Ga0070714_100014050 3300005435 Bacteria 6424
28 Ga0070713_100050667 3300005436 Bacteria 3430
29 Ga0070713_100099944 3300005436 Bacteria 2510
30 Ga0070710_10021004 3300005437 Bacteria 3396
31 Ga0070711_100003067 3300005439 Bacteria 9658
32 Ga0070705_100076578 3300005440 Bacteria 2040
33 Ga0070700_100039104 3300005441 Bacteria 2895
34 Ga0070708_100053206 3300005445 Bacteria 3591
35 Ga0070708_100089324 3300005445 Bacteria 2803
36 Ga0070681_10006989 3300005458 Bacteria 10987
37 Ga0070681_10084144 3300005458 Bacteria 3134
38 Ga0068867_100001938 3300005459 Bacteria 14414
39 Ga0070706_100005877 3300005467 Bacteria 11636
40 Ga0070706_100042995 3300005467 Bacteria 4174
41 Ga0070706_100046468 3300005467 Bacteria 4008
42 Ga0070707_100001539 3300005468 Bacteria 22418
43 Ga0070707_100002301 3300005468 Bacteria 18249
44 Ga0070707_100046225 3300005468 Bacteria 4166
45 Ga0070707_100052843 3300005468 Bacteria 3895
46 Ga0070698_100022548 3300005471 Bacteria 6585
47 Ga0070698_100031166 3300005471 Bacteria 5528
48 Ga0070698_100048535 3300005471 Bacteria 4338
49 Ga0070699_100005200 3300005518 Bacteria 11442
50 Ga0070699_100150976 3300005518 Bacteria 2055
51 Ga0070699_100244686 3300005518 Unclassified 1602
52 Ga0070679_100001973 3300005530 Bacteria 18408
53 Ga0070679_100102120 3300005530 Bacteria 2854
54 Ga0070684_100000226 3300005535 Bacteria 39137
55 Ga0070684_100000919 3300005535 Bacteria 20910
56 Ga0070684_100011385 3300005535 Bacteria 7087
57 Ga0070684_100037514 3300005535 Bacteria 4158
58 Ga0070684_100173844 3300005535 Bacteria 1957
59 Ga0070684_100209747 3300005535 Bacteria 1775
60 Ga0070672_100006102 3300005543 Bacteria 8060
61 Ga0070686_100003874 3300005544 Bacteria 8229
62 Ga0070686_100041022 3300005544 Bacteria 2890
63 Ga0070696_100009176 3300005546 Bacteria 6621
64 Ga0070696_100012094 3300005546 Bacteria 5783
65 Ga0070693_100005053 3300005547 Bacteria 6303
66 Ga0070693_100051003 3300005547 Bacteria 2368
67 Ga0070665_100040958 3300005548 Bacteria 4655
68 Ga0070704_100012076 3300005549 Bacteria 5325
69 Ga0070704_100044868 3300005549 Bacteria 3074
70 Ga0070664_100160427 3300005564 Bacteria 1989
71 Ga0068857_100023101 3300005577 Bacteria 5469
72 Ga0068856_100013469 3300005614 Bacteria 7914
73 Ga0068856_100036894 3300005614 Bacteria 4794
74 Ga0068856_100192417 3300005614 Bacteria 2054
75 Ga0070702_100011632 3300005615 Bacteria 4382
76 Ga0068859_100058410 3300005617 Bacteria 3886
77 Ga0068870_10095906 3300005840 Bacteria 1667
78 Ga0068863_100141097 3300005841 Bacteria 2303
79 Ga0068860_100026439 3300005843 Bacteria 5594
80 Ga0081455_10040349 3300005937 Bacteria 4117
81 Ga0081455_10046385 3300005937 Bacteria 3771
82 Ga0081455_10052165 3300005937 Bacteria 3503
83 Ga0081455_10077385 3300005937 Bacteria 2737
84 Ga0081455_10094107 3300005937 Bacteria 2421
85 Ga0081538_10077151 3300005981 Bacteria 1796
86 Ga0081540_1022644 3300005983 Bacteria 3706
87 Ga0081539_10004710 3300005985 Bacteria 14785
88 Ga0081539_10027103 3300005985 Bacteria 3637
89 Ga0070717_10013484 3300006028 Bacteria 6265
90 Ga0070717_10039001 3300006028 Bacteria 3863
91 Ga0070717_10084528 3300006028 Bacteria 2669
92 Ga0070717_10107304 3300006028 Bacteria 2378
93 Ga0075432_10022224 3300006058 Bacteria 2169
94 Ga0070712_100008166 3300006175 Bacteria 6571
95 Ga0070712_100008761 3300006175 Bacteria 6368
96 Ga0070712_100009878 3300006175 Bacteria 6016
97 Ga0068871_100082119 3300006358 Bacteria 2672
98 Ga0075428_100064804 3300006844 Bacteria 4002
99 Ga0075428_100093526 3300006844 Bacteria 3278
100 Ga0075430_100039598 3300006846 Bacteria 3990
101 Ga0075433_10000133 3300006852 Bacteria 38500
102 Ga0075433_10003025 3300006852 Bacteria 12918
103 Ga0075433_10230738 3300006852 Bacteria 1644
104 Ga0075434_100001531 3300006871 Bacteria 19549
105 Ga0075434_100186790 3300006871 Bacteria 2093
106 Ga0068865_100013525 3300006881 Bacteria 5159
107 Ga0075436_100012600 3300006914 Bacteria 5793
108 Ga0075436_100025997 3300006914 Bacteria 4030
109 Ga0075436_100030852 3300006914 Bacteria 3689
110 Ga0097620_100058409 3300006931 Bacteria 3886
111 Ga0075435_100008079 3300007076 Bacteria 7533
112 Ga0075435_100020534 3300007076 Bacteria 5064
113 Ga0075435_100090589 3300007076 Bacteria 2523
114 Ga0105240_10137719 3300009093 Bacteria 2921
115 Ga0111539_10014294 3300009094 Bacteria 9915
116 Ga0111539_10034004 3300009094 Bacteria 6184
117 Ga0111539_10204876 3300009094 Bacteria 2299
118 Ga0111539_10376176 3300009094 Bacteria 1654
119 Ga0105245_10006227 3300009098 Bacteria 10493
120 Ga0105245_10132355 3300009098 Bacteria 2340
121 Ga0105245_10142682 3300009098 Bacteria 2257
122 Ga0105245_10207042 3300009098 Bacteria 1886
123 Ga0114129_10014074 3300009147 Bacteria 11397
124 Ga0114129_10024503 3300009147 Bacteria 8550
125 Ga0114129_10030517 3300009147 Bacteria 7627
126 Ga0114129_10103760 3300009147 Bacteria 3930
127 Ga0114129_10290154 3300009147 Bacteria 2183
128 Ga0105243_10001070 3300009148 Bacteria 25043
129 Ga0105243_10014598 3300009148 Bacteria 5943
130 Ga0105243_10089148 3300009148 Bacteria 2535
131 Ga0105243_10104236 3300009148 Bacteria 2361
132 Ga0105243_10106113 3300009148 Bacteria 2341
133 Ga0105241_10224186 3300009174 Bacteria 1582
134 Ga0105248_10041704 3300009177 Bacteria 5146
135 Ga0105249_10000462 3300009553 Bacteria 37859
136 Ga0105239_10002935 3300010375 Bacteria 21282
137 Ga0105239_10304625 3300010375 Bacteria 1795
138 Ga0105239_10324110 3300010375 Bacteria 1737
139 Ga0157373_10091923 3300013100 Unclassified 2137
140 Ga0157369_10001705 3300013105 Bacteria 26767
141 Ga0157369_10099659 3300013105 Bacteria 3097
142 Ga0157369_10307695 3300013105 Bacteria 1648
143 Ga0163162_10001817 3300013306 Bacteria 20057
144 Ga0163162_10041911 3300013306 Bacteria 4581
145 Ga0157372_10374401 3300013307 Bacteria 1659
146 Ga0157380_10197817 3300014326 Bacteria 1781
147 Ga0157377_10003375 3300014745 Bacteria 7222
148 Ga0163161_10097467 3300017792 Bacteria 2184
149 Ga0206356_11611016 3300020070 Bacteria 2457
150 Ga0206353_10817938 3300020082 Bacteria 2289
151 Ga0213874_10002278 3300021377 Bacteria 4101
152 Ga0213874_10016596 3300021377 Bacteria 1963
153 Ga0213876_10030740 3300021384 Bacteria 2833
154 Ga0213876_10034545 3300021384 Bacteria 2666
155 Ga0213876_10039148 3300021384 Bacteria 2504
156 Ga0213875_10012097 3300021388 Bacteria 4270
157 Ga0207692_10003881 3300025898 Bacteria 5871
158 Ga0207642_10009834 3300025899 Bacteria 3343
159 Ga0207688_10008041 3300025901 Bacteria 5740
160 Ga0207688_10030653 3300025901 Bacteria 2967
161 Ga0207680_10081217 3300025903 Bacteria 2037
162 Ga0207647_10080562 3300025904 Bacteria 1952
163 Ga0207699_10006353 3300025906 Bacteria 5714
164 Ga0207699_10067566 3300025906 Bacteria 2173
165 Ga0207643_10079828 3300025908 Bacteria 1894
166 Ga0207643_10088286 3300025908 Bacteria 1804
167 Ga0207684_10048924 3300025910 Bacteria 3587
168 Ga0207684_10098354 3300025910 Bacteria 2499
169 Ga0207707_10022565 3300025912 Bacteria 5501
170 Ga0207693_10000175 3300025915 Bacteria 58611
171 Ga0207693_10003543 3300025915 Bacteria 13334
172 Ga0207693_10013611 3300025915 Bacteria 6556
173 Ga0207693_10016502 3300025915 Bacteria 5900
174 Ga0207693_10084700 3300025915 Bacteria 2484
175 Ga0207660_10004793 3300025917 Bacteria 8799
176 Ga0207657_10022819 3300025919 Bacteria 5843
177 Ga0207657_10054152 3300025919 Bacteria 3471
178 Ga0207652_10005412 3300025921 Bacteria 10355
179 Ga0207652_10198723 3300025921 Bacteria 1804
180 Ga0207646_10007082 3300025922 Bacteria 11469
181 Ga0207646_10012792 3300025922 Bacteria 8047
182 Ga0207646_10038973 3300025922 Bacteria 4277
183 Ga0207646_10162347 3300025922 Bacteria 2016
184 Ga0207646_10286244 3300025922 Bacteria 1489
185 Ga0207659_10044599 3300025926 Bacteria 3121
186 Ga0207687_10008646 3300025927 Bacteria 6655
187 Ga0207687_10073384 3300025927 Bacteria 2450
188 Ga0207700_10000002 3300025928 Bacteria 775978
189 Ga0207664_10000964 3300025929 Bacteria 19413
190 Ga0207664_10087437 3300025929 Bacteria 2548
191 Ga0207664_10100059 3300025929 Bacteria 2393
192 Ga0207686_10001250 3300025934 Bacteria 14696
193 Ga0207709_10001458 3300025935 Bacteria 16475
194 Ga0207669_10088709 3300025937 Bacteria 2006
195 Ga0207665_10091342 3300025939 Bacteria 2111
196 Ga0207691_10014845 3300025940 Bacteria 7423
197 Ga0207689_10202875 3300025942 Bacteria 1637
198 Ga0207661_10002792 3300025944 Bacteria 12043
199 Ga0207661_10052405 3300025944 Bacteria 3260
200 Ga0207661_10072824 3300025944 Bacteria 2812
201 Ga0207661_10205755 3300025944 Bacteria 1732
202 Ga0207661_10217881 3300025944 Bacteria 1686
203 Ga0207679_10073502 3300025945 Bacteria 2587
204 Ga0207651_10027340 3300025960 Bacteria 3582
205 Ga0207658_10028800 3300025986 Bacteria 3916
206 Ga0207677_10003673 3300026023 Bacteria 8146
207 Ga0207677_10054963 3300026023 Bacteria 2720
208 Ga0207703_10073014 3300026035 Bacteria 2837
209 Ga0207708_10006314 3300026075 Bacteria 8786
210 Ga0207708_10114992 3300026075 Bacteria 2092
211 Ga0207702_10006575 3300026078 Bacteria 9992
212 Ga0207702_10007114 3300026078 Bacteria 9573
213 Ga0207702_10053167 3300026078 Bacteria 3428
214 Ga0207648_10000312 3300026089 Bacteria 53245
215 Ga0207674_10003481 3300026116 Bacteria 19228
216 Ga0207675_100044541 3300026118 Bacteria 4147
217 Ga0207683_10000447 3300026121 Bacteria 38155
218 Ga0207683_10009933 3300026121 Bacteria 8117
219 Ga0207428_10003094 3300027907 Bacteria 16362
220 Ga0207428_10099813 3300027907 Bacteria 2244
221 Ga0268264_10036984 3300028381 Bacteria 4023
222 Ga0265319_1023935 3300028563 Bacteria 2206
223 Ga0265334_10008426 3300028573 Bacteria 4382
224 Ga0265318_10002084 3300028577 Bacteria 10944
225 Ga0265336_10001280 3300028666 Bacteria 11850
226 Ga0265338_10001704 3300028800 Bacteria 34899
227 Ga0265338_10010698 3300028800 Bacteria 10716
228 Ga0265338_10018327 3300028800 Bacteria 7499
229 Ga0265338_10040946 3300028800 Bacteria 4341
230 Ga0265330_10006709 3300031235 Bacteria 5677
231 Ga0265325_10017313 3300031241 Bacteria 4007
232 Ga0265340_10008842 3300031247 Bacteria 5425
233 Ga0265331_10013454 3300031250 Bacteria 4398
234 Ga0265327_10020741 3300031251 Bacteria 3992
235 Ga0265316_10073850 3300031344 Bacteria 2626
236 Ga0265313_10017445 3300031595 Bacteria 4079
237 Ga0265313_10024742 3300031595 Bacteria 3199
238 Ga0265313_10042770 3300031595 Bacteria 2222
239 Ga0307416_100066583 3300032002 Bacteria 2966
240 Ga0316583_10022588 3300032133 Unclassified 2252
241 Ga0373948_0001983 3300034817 Bacteria 2949
242 Ga0373958_0002978 3300034819 Bacteria 2420
243 Ga0373959_0001131 3300034820 Bacteria 4326
244 Ga0373949_0003494 3300035090 Bacteria 3724
245 Ga0373951_0002626 3300035091 Bacteria 4508
246 Ga0373952_0005698 3300035092 Bacteria 2282
247 Ga0373939_0002242 3300035114 Bacteria 4579
248 Ga0373961_0002224 3300035241 Bacteria 5124
249 Ga0373962_0002564 3300035242 Bacteria 4311
250 Ga0373925_0262413 3300037068 Bacteria 1388
251 Ga0395899_0002670 3300037312 Bacteria 14380
252 Ga0395899_0013058 3300037312 Bacteria 6353
253 Ga0395899_0014243 3300037312 Bacteria 6071
254 Ga0395899_0019730 3300037312 Bacteria 5118
255 Ga0395899_0037755 3300037312 Bacteria 3620
256 Ga0395899_0038220 3300037312 Bacteria 3596
257 Ga0395899_0044874 3300037312 Bacteria 3292
258 Ga0395899_0131037 3300037312 Unclassified 1790
259 Ga0395900_0002130 3300037418 Bacteria 22145
260 Ga0395900_0004868 3300037418 Bacteria 14150
261 Ga0395900_0005118 3300037418 Bacteria 13767
262 Ga0395900_0006188 3300037418 Bacteria 12504
263 Ga0395900_0011512 3300037418 Bacteria 9055
264 Ga0395900_0029323 3300037418 Bacteria 5645
265 Ga0395900_0037849 3300037418 Bacteria 4973
266 Ga0395900_0041003 3300037418 Bacteria 4773
267 Ga0395900_0042517 3300037418 Bacteria 4683
268 Ga0395900_0051438 3300037418 Bacteria 4243
269 Ga0395900_0060643 3300037418 Bacteria 3892
270 Ga0395900_0148609 3300037418 Bacteria 2395
271 Ga0395900_0244599 3300037418 Bacteria 1798
272 Ga0395898_0001816 3300037466 Bacteria 27562
273 Ga0395898_0004143 3300037466 Bacteria 15899
274 Ga0395898_0009890 3300037466 Bacteria 10000
275 Ga0395898_0010831 3300037466 Bacteria 9526
276 Ga0395898_0018593 3300037466 Bacteria 7085
277 Ga0395898_0027751 3300037466 Bacteria 5677
278 Ga0395898_0037285 3300037466 Bacteria 4824
279 Ga0395898_0038588 3300037466 Bacteria 4732
280 Ga0395898_0075221 3300037466 Bacteria 3262
281 Ga0395898_0110572 3300037466 Bacteria 2634
282 Ga0395898_0116582 3300037466 Bacteria 2559
283 Ga0395898_0117893 3300037466 Bacteria 2543
284 Ga0395898_0128714 3300037466 Bacteria 2425
285 Ga0395898_0196523 3300037466 Bacteria 1926
286 Ga0395905_0003766 3300037471 Bacteria 16061
287 Ga0395905_0006417 3300037471 Bacteria 11842
288 Ga0395905_0010708 3300037471 Bacteria 8893
289 Ga0395905_0018939 3300037471 Bacteria 6528
290 Ga0395905_0020430 3300037471 Bacteria 6274
291 Ga0395905_0032900 3300037471 Bacteria 4875
292 Ga0395905_0045198 3300037471 Bacteria 4131
293 Ga0395905_0114518 3300037471 Bacteria 2533
294 Ga0395905_0149539 3300037471 Bacteria 2197
295 Ga0395905_0239233 3300037471 Bacteria 1697
296 Ga0436364_0376890 3300037853 Bacteria 32731
297 Ga0436364_0821342 3300037853 Bacteria 4957
298 Ga0436364_1031907 3300037853 Bacteria 102112
299 Ga0436364_1063997 3300037853 Unclassified 2092
300 Ga0395901_0001175 3300038443 Bacteria 27810
301 Ga0395901_0005645 3300038443 Bacteria 12663
302 Ga0395901_0008378 3300038443 Bacteria 10454
303 Ga0395901_0011969 3300038443 Bacteria 8798
304 Ga0395901_0014896 3300038443 Bacteria 7901
305 Ga0395901_0026085 3300038443 Bacteria 6000
306 Ga0395901_0039091 3300038443 Bacteria 4909
307 Ga0395901_0045173 3300038443 Bacteria 4570
308 Ga0395901_0051512 3300038443 Bacteria 4280
309 Ga0395901_0066511 3300038443 Bacteria 3754
310 Ga0395901_0100070 3300038443 Bacteria 3040
311 Ga0395901_0114319 3300038443 Bacteria 2835
312 Ga0395901_0143144 3300038443 Bacteria 2513
313 Ga0436365_0036386 3300039437 Bacteria 9504
314 Ga0436365_1404752 3300039437 Bacteria 6760
315 Ga0436365_1681277 3300039437 Bacteria 6430
316 Ga0436363_0008127 3300039450 Bacteria 4600
317 Ga0436363_0109681 3300039450 Bacteria 3506
318 Ga0436363_0285596 3300039450 Bacteria 2198
319 Ga0436363_0875286 3300039450 Bacteria 5399
320 Ga0436363_1045012 3300039450 Bacteria 2928
321 Ga0436362_0350106 3300039453 Bacteria 2911
322 Ga0436362_0623705 3300039453 Bacteria 1671
323 Ga0439439_0003958 3300041406 Bacteria 3302
324 Ga0439461_0002553 3300041410 Bacteria 2923
325 Ga0439461_0003448 3300041410 Bacteria 2602
326 Ga0451853_0045019 3300041512 Bacteria 2733
327 Ga0451853_0735613 3300041512 Unclassified 2544
328 Ga0439433_0000509 3300041999 Bacteria 7280
329 Ga0439457_015180 3300042014 Bacteria 1722
330 Ga0439446_0003905 3300042156 Bacteria 3743
331 Ga0439446_0010839 3300042156 Bacteria 2462
332 Ga0439446_0011390 3300042156 Bacteria 2414
333 Ga0439434_0004367 3300042435 Bacteria 4134
334 Ga0439434_0011817 3300042435 Bacteria 2582
335 Ga0451577_0316502 3300042876 Bacteria 1415
336 Ga0466969_0020284 3300044656 Bacteria 3444
337 Ga0466966_0056045 3300044684 Bacteria 2494
338 Ga0466963_0004725 3300044694 Bacteria 7953
339 Ga0466963_0045236 3300044694 Bacteria 2899
340 Ga0466963_0045895 3300044694 Bacteria 2879
341 Ga0466963_0164996 3300044694 Bacteria 1543
342 Ga0466964_0000430 3300044706 Bacteria 12749
343 Ga0466960_0063331 3300044901 Bacteria 1820
344 Ga0466959_0003109 3300045049 Bacteria 10762
345 Ga0466959_0082626 3300045049 Bacteria 2314
346 Ga0451576_0090810 3300045051 Bacteria 3177
347 Ga0466958_0005859 3300045836 Bacteria 6652
348 Ga0466958_0092128 3300045836 Bacteria 1876
349 Ga0466967_0001126 3300045976 Bacteria 14868
350 Ga0466967_0001502 3300045976 Bacteria 13619
351 Ga0466967_0077891 3300045976 Bacteria 2985
352 Ga0466967_0081199 3300045976 Bacteria 2928
353 Ga0466967_0083772 3300045976 Bacteria 2884
354 Ga0466967_0094609 3300045976 Bacteria 2721
355 Ga0466967_0200042 3300045976 Bacteria 1892
356 Ga0495603_0050951 3300046455 Bacteria 2460
357 Ga0495641_0025902 3300046461 Bacteria 2872
358 Ga0495653_0065989 3300046463 Bacteria 2723
359 Ga0495582_0008884 3300046473 Bacteria 5543
360 Ga0495639_0069171 3300046475 Bacteria 1628
361 Ga0495664_0030397 3300046477 Bacteria 3164
362 Ga0495584_0030605 3300046491 Bacteria 2725
363 Ga0495584_0043493 3300046491 Bacteria 2267
364 Ga0495584_0091180 3300046491 Bacteria 1537
365 Ga0495642_0012296 3300046528 Bacteria 3299
366 Ga0495652_0070747 3300046529 Bacteria 2915
367 Ga0495665_0040153 3300046531 Bacteria 2492
368 Ga0495586_0024289 3300046535 Bacteria 3239
369 Ga0495667_0032516 3300046559 Bacteria 3496
370 Ga0495635_0039079 3300046663 Bacteria 3285
371 Ga0495635_0043926 3300046663 Bacteria 3083
372 Ga0495659_0031779 3300046664 Bacteria 1844
373 Ga0495588_0091257 3300046674 Bacteria 1596
374 Ga0495657_0033952 3300046675 Bacteria 3547
375 Ga0495657_0078487 3300046675 Bacteria 2140
376 Ga0495647_0015874 3300046681 Bacteria 2644
377 Ga0495647_0036968 3300046681 Bacteria 1840
378 Ga0495658_0014321 3300046683 Bacteria 4051
379 Ga0495613_0129480 3300046689 Bacteria 1808
380 Ga0495624_0055502 3300046690 Bacteria 2495
381 Ga0495581_0004317 3300047315 Bacteria 8203
382 Ga0495581_0007471 3300047315 Bacteria 6322
383 Ga0495674_0103621 3300047319 Bacteria 2419
384 Ga0495676_0006533 3300047321 Bacteria 10744
385 Ga0495676_0052336 3300047321 Bacteria 3260
386 Ga0495677_0034956 3300047445 Bacteria 1834
387 Ga0496100_0016868 3300048903 Bacteria 4297
388 Ga0496100_0096288 3300048903 Bacteria 2030
389 Ga0496101_0007298 3300048904 Bacteria 7152
390 Ga0496101_0034580 3300048904 Bacteria 3570
391 Ga0496101_0053993 3300048904 Bacteria 2901
392 Ga0496102_0005503 3300048905 Bacteria 10751
393 Ga0496102_0021840 3300048905 Bacteria 5664
394 Ga0496102_0108712 3300048905 Bacteria 2583
395 Ga0496103_0023239 3300048906 Bacteria 3737
396 Ga0496104_0000444 3300048907 Bacteria 35985
397 Ga0496104_0001256 3300048907 Bacteria 21870
398 Ga0496104_0016705 3300048907 Bacteria 6671
399 Ga0496104_0022859 3300048907 Bacteria 5744
400 Ga0496104_0113080 3300048907 Bacteria 2604
401 Ga0496104_0197860 3300048907 Bacteria 1922
402 Ga0496105_0000200 3300048908 Bacteria 39964
403 Ga0496105_0009175 3300048908 Bacteria 7720
404 Ga0496105_0019660 3300048908 Bacteria 5449
405 Ga0496106_0002259 3300048909 Bacteria 14365
406 Ga0496106_0015372 3300048909 Bacteria 5664
407 Ga0496106_0017830 3300048909 Bacteria 5250
408 Ga0496106_0025838 3300048909 Bacteria 4369
409 Ga0496106_0078407 3300048909 Bacteria 2535
410 Ga0496106_0083495 3300048909 Bacteria 2457
411 Ga0496107_0004523 3300048910 Bacteria 9421
412 Ga0496107_0016140 3300048910 Bacteria 5239
413 Ga0496107_0032287 3300048910 Bacteria 3742
414 Ga0496107_0032288 3300048910 Bacteria 3742
415 Ga0496107_0090984 3300048910 Bacteria 2229
416 Ga0496108_0009117 3300048911 Bacteria 8030
417 Ga0496108_0014468 3300048911 Bacteria 6442
418 Ga0496108_0023818 3300048911 Bacteria 5038
419 Ga0496108_0028810 3300048911 Bacteria 4595
420 Ga0496108_0054764 3300048911 Bacteria 3348
421 Ga0496108_0099342 3300048911 Bacteria 2481
422 Ga0496109_0002031 3300048912 Bacteria 16787
423 Ga0496109_0002306 3300048912 Bacteria 15879
424 Ga0496109_0035674 3300048912 Bacteria 4488
425 Ga0496109_0036855 3300048912 Bacteria 4416
426 Ga0496109_0078406 3300048912 Bacteria 3042
427 Ga0496109_0153756 3300048912 Bacteria 2155
428 Ga0496110_0003652 3300048913 Bacteria 11835
429 Ga0496110_0008876 3300048913 Bacteria 8103
430 Ga0496110_0021391 3300048913 Bacteria 5476
431 Ga0496110_0028334 3300048913 Bacteria 4810
432 Ga0496110_0032252 3300048913 Bacteria 4523
433 Ga0496110_0124683 3300048913 Bacteria 2323
434 Ga0496110_0147497 3300048913 Bacteria 2129
435 Ga0496110_0203035 3300048913 Bacteria 1801
436 Ga0496111_0000113 3300048914 Bacteria 35668
437 Ga0496111_0000237 3300048914 Bacteria 26447
438 Ga0496111_0001148 3300048914 Bacteria 14704
439 Ga0496111_0119766 3300048914 Bacteria 1944
440 Ga0496112_0001508 3300048915 Bacteria 17922
441 Ga0496112_0038309 3300048915 Bacteria 4681
442 Ga0496112_0043655 3300048915 Bacteria 4390
443 Ga0496112_0083230 3300048915 Bacteria 3164
444 Ga0496113_0001597 3300048916 Bacteria 12738
445 Ga0496113_0152834 3300048916 Bacteria 1822
446 Ga0496114_0002159 3300048917 Bacteria 14976
447 Ga0496114_0002970 3300048917 Bacteria 12998
448 Ga0496114_0019143 3300048917 Bacteria 5547
449 Ga0496114_0021995 3300048917 Bacteria 5192
450 Ga0501033_0097769 3300049570 Bacteria 2144
451 Ga0501036_0010909 3300049572 Bacteria 7512
452 Ga0501036_0104160 3300049572 Bacteria 2399
453 Ga0501037_0090390 3300049573 Bacteria 2215
454 Ga0501038_0008448 3300049574 Bacteria 9472
455 Ga0501038_0114158 3300049574 Bacteria 2234
456 Ga0501039_0021879 3300049575 Bacteria 4906
457 Ga0501040_0002230 3300049576 Bacteria 12482
458 Ga0501040_0087925 3300049576 Bacteria 2158
459 Ga0501041_0001334 3300049577 Bacteria 13579
460 Ga0501041_0056653 3300049577 Bacteria 2395
461 Ga0501041_0194435 3300049577 Bacteria 1271
462 Ga0501042_0002803 3300049578 Bacteria 10785
463 Ga0501042_0002973 3300049578 Bacteria 10545
464 Ga0501043_0095588 3300049579 Bacteria 2335
465 Ga0501046_0024109 3300049580 Bacteria 4996
466 Ga0501046_0057138 3300049580 Bacteria 3061
467 Ga0501047_0029384 3300049581 Bacteria 5301
468 Ga0501047_0260416 3300049581 Bacteria 1582
469 Ga0501048_0005846 3300049582 Bacteria 9359
470 Ga0501048_0040143 3300049582 Bacteria 3354
471 Ga0501068_0030295 3300049584 Bacteria 3209
472 Ga0501069_0003597 3300049585 Bacteria 7984
473 Ga0501069_0026279 3300049585 Bacteria 3188
474 Ga0501069_0062398 3300049585 Bacteria 2081
475 Ga0501069_0081259 3300049585 Bacteria 1826
476 Ga0501070_0000778 3300049586 Bacteria 28986
477 Ga0501070_0069523 3300049586 Bacteria 2915
478 Ga0501071_0000047 3300049587 Bacteria 42225
479 Ga0501072_0004977 3300049588 Bacteria 10107
480 Ga0501072_0071936 3300049588 Bacteria 2732
481 Ga0501073_0040439 3300049589 Bacteria 3300
482 Ga0501074_0083752 3300049590 Bacteria 2286
483 Ga0501076_0018154 3300049592 Bacteria 5357
484 Ga0501077_0020450 3300049593 Bacteria 4190
485 Ga0501077_0213959 3300049593 Unclassified 1225
486 Ga0501079_0024065 3300049741 Bacteria 4672
487 Ga0501079_0027550 3300049741 Bacteria 4358
488 Ga0501079_0073086 3300049741 Unclassified 2651
489 Ga0501080_0013317 3300049742 Bacteria 7559
490 Ga0501080_0136199 3300049742 Bacteria 2273
491 Ga0501080_0148393 3300049742 Bacteria 2168
492 Ga0501081_0013472 3300049743 Bacteria 5375
493 Ga0501081_0027850 3300049743 Bacteria 3810
494 Ga0501081_0038237 3300049743 Bacteria 3277
495 Ga0501035_0171257 3300049822 Bacteria 1875
496 Ga0501044_0148210 3300049823 Bacteria 2330
497 Ga0501045_0001066 3300049824 Bacteria 18116
498 Ga0501045_0003340 3300049824 Bacteria 10978
499 nmdc:mga05p37_36453_c1 3300050507 Bacteria 6033
500 nmdc:mga05p37_7957_c1 3300050507 Bacteria 12512
501 nmdc:mga0qj67_25600_c1 3300050509 Bacteria 4559
502 nmdc:mga06r32_119036_c1 3300050510 Bacteria 2604
503 nmdc:mga06r32_38019_c1 3300050510 Bacteria 4556
504 nmdc:mga06r32_67730_c1 3300050510 Bacteria 3447
505 nmdc:mga08y16_110816_c1 3300050511 Bacteria 2858
506 nmdc:mga08y16_13639_c1 3300050511 Bacteria 8555
507 nmdc:mga08y16_74276_c1 3300050511 Bacteria 3542
508 nmdc:mga08y16_89392_c1 3300050511 Bacteria 3210
509 nmdc:mga0n895_199617_c1 3300050512 Bacteria 2032
510 nmdc:mga0n895_22888_c1 3300050512 Bacteria 5862
511 nmdc:mga0n895_322248_c1 3300050512 Bacteria 1566
512 nmdc:mga0n895_55180_c1 3300050512 Bacteria 3910
513 nmdc:mga0rr50_1472_c1 3300050513 Bacteria 12948
514 nmdc:mga08x19_174617_c1 3300050514 Bacteria 1465
515 nmdc:mga08x19_31263_c1 3300050514 Bacteria 3348
516 nmdc:mga08x19_8789_c1 3300050514 Bacteria 6027
517 nmdc:mga0a205_1546_c1 3300050515 Bacteria 19689
518 nmdc:mga0a205_177321_c1 3300050515 Bacteria 2026
519 nmdc:mga0a205_92535_c1 3300050515 Bacteria 2922
520 Ga0495601_0062471 3300053077 Bacteria 2366
521 Ga0501084_0000362 3300054114 Bacteria 34708
522 Ga0590075_005198 3300059424 Bacteria 3074
523 Ga0501082_0004845 3300060353 Bacteria 11736
524 Ga0501082_0018178 3300060353 Bacteria 6053
525 Ga0530510_0015570 3300061734 Bacteria 5376
526 Ga0070704_100008412
527 Ga0070658_10023494
528 Ga0070683_100003323
529 Ga0070683_100014849
530 Ga0070683_100055147
531 Ga0070683_100068956
532 Ga0070683_100220564
533 Ga0070680_100127366
534 Ga0068868_100091309
535 Ga0070660_100005228
536 Ga0070660_100007503
537 Ga0070660_100015795
538 Ga0070660_100073282
539 Ga0070689_100003533
540 Ga0070691_10012693
541 Ga0070692_10058825
542 Ga0070668_100043289
543 Ga0070669_100036019
544 Ga0070675_100104917
545 Ga0070674_100033340
546 Ga0070674_100100101
547 Ga0070688_100002547
548 Ga0070703_10001473
549 Ga0070709_10013246
550 Ga0070709_10105655
551 Ga0070709_10123638
552 Ga0070714_100014050
553 Ga0070713_100050667
554 Ga0070713_100099944
555 Ga0070710_10021004
556 Ga0070711_100003067
557 Ga0070705_100076578
558 Ga0070700_100039104
559 Ga0070708_100053206
560 Ga0070708_100089324
561 Ga0070681_10006989
562 Ga0070681_10084144
563 Ga0068867_100001938
564 Ga0070706_100005877
565 Ga0070706_100042995
566 Ga0070706_100046468
567 Ga0070707_100001539
568 Ga0070707_100002301
569 Ga0070707_100046225
570 Ga0070707_100052843
571 Ga0070698_100022548
572 Ga0070698_100031166
573 Ga0070698_100048535
574 Ga0070699_100005200
575 Ga0070699_100150976
576 Ga0070699_100244686
577 Ga0070679_100001973
578 Ga0070679_100102120
579 Ga0070684_100000226
580 Ga0070684_100000919
581 Ga0070684_100011385
582 Ga0070684_100037514
583 Ga0070684_100173844
584 Ga0070684_100209747
585 Ga0070672_100006102
586 Ga0070686_100003874
587 Ga0070686_100041022
588 Ga0070696_100009176
589 Ga0070696_100012094
590 Ga0070693_100005053
591 Ga0070693_100051003
592 Ga0070665_100040958
593 Ga0070704_100012076
594 Ga0070704_100044868
595 Ga0070664_100160427
596 Ga0068857_100023101
597 Ga0068856_100013469
598 Ga0068856_100036894
599 Ga0068856_100192417
600 Ga0070702_100011632
601 Ga0068859_100058410
602 Ga0068870_10095906
603 Ga0068863_100141097
604 Ga0068860_100026439
605 Ga0081455_10040349
606 Ga0081455_10046385
607 Ga0081455_10052165
608 Ga0081455_10077385
609 Ga0081455_10094107
610 Ga0081538_10077151
611 Ga0081540_1022644
612 Ga0081539_10004710
613 Ga0081539_10027103
614 Ga0070717_10013484
615 Ga0070717_10039001
616 Ga0070717_10084528
617 Ga0070717_10107304
618 Ga0075432_10022224
619 Ga0070712_100008166
620 Ga0070712_100008761
621 Ga0070712_100009878
622 Ga0068871_100082119
623 Ga0075428_100064804
624 Ga0075428_100093526
625 Ga0075430_100039598
626 Ga0075433_10000133
627 Ga0075433_10003025
628 Ga0075433_10230738
629 Ga0075434_100001531
630 Ga0075434_100186790
631 Ga0068865_100013525
632 Ga0075436_100012600
633 Ga0075436_100025997
634 Ga0075436_100030852
635 Ga0097620_100058409
636 Ga0075435_100008079
637 Ga0075435_100020534
638 Ga0075435_100090589
639 Ga0105240_10137719
640 Ga0111539_10014294
641 Ga0111539_10034004
642 Ga0111539_10204876
643 Ga0111539_10376176
644 Ga0105245_10006227
645 Ga0105245_10132355
646 Ga0105245_10142682
647 Ga0105245_10207042
648 Ga0114129_10014074
649 Ga0114129_10024503
650 Ga0114129_10030517
651 Ga0114129_10103760
652 Ga0114129_10290154
653 Ga0105243_10001070
654 Ga0105243_10014598
655 Ga0105243_10089148
656 Ga0105243_10104236
657 Ga0105243_10106113
658 Ga0105241_10224186
659 Ga0105248_10041704
660 Ga0105249_10000462
661 Ga0105239_10002935
662 Ga0105239_10304625
663 Ga0105239_10324110
664 Ga0157373_10091923
665 Ga0157369_10001705
666 Ga0157369_10099659
667 Ga0157369_10307695
668 Ga0163162_10001817
669 Ga0163162_10041911
670 Ga0157372_10374401
671 Ga0157380_10197817
672 Ga0157377_10003375
673 Ga0163161_10097467
674 Ga0206356_11611016
675 Ga0206353_10817938
676 Ga0213874_10002278
677 Ga0213874_10016596
678 Ga0213876_10030740
679 Ga0213876_10034545
680 Ga0213876_10039148
681 Ga0213875_10012097
682 Ga0207692_10003881
683 Ga0207642_10009834
684 Ga0207688_10008041
685 Ga0207688_10030653
686 Ga0207680_10081217
687 Ga0207647_10080562
688 Ga0207699_10006353
689 Ga0207699_10067566
690 Ga0207643_10079828
691 Ga0207643_10088286
692 Ga0207684_10048924
693 Ga0207684_10098354
694 Ga0207707_10022565
695 Ga0207693_10000175
696 Ga0207693_10003543
697 Ga0207693_10013611
698 Ga0207693_10016502
699 Ga0207693_10084700
700 Ga0207660_10004793
701 Ga0207657_10022819
702 Ga0207657_10054152
703 Ga0207652_10005412
704 Ga0207652_10198723
705 Ga0207646_10007082
706 Ga0207646_10012792
707 Ga0207646_10038973
708 Ga0207646_10162347
709 Ga0207646_10286244
710 Ga0207659_10044599
711 Ga0207687_10008646
712 Ga0207687_10073384
713 Ga0207700_10000002
714 Ga0207664_10000964
715 Ga0207664_10087437
716 Ga0207664_10100059
717 Ga0207686_10001250
718 Ga0207709_10001458
719 Ga0207669_10088709
720 Ga0207665_10091342
721 Ga0207691_10014845
722 Ga0207689_10202875
723 Ga0207661_10002792
724 Ga0207661_10052405
725 Ga0207661_10072824
726 Ga0207661_10205755
727 Ga0207661_10217881
728 Ga0207679_10073502
729 Ga0207651_10027340
730 Ga0207658_10028800
731 Ga0207677_10003673
732 Ga0207677_10054963
733 Ga0207703_10073014
734 Ga0207708_10006314
735 Ga0207708_10114992
736 Ga0207702_10006575
737 Ga0207702_10007114
738 Ga0207702_10053167
739 Ga0207648_10000312
740 Ga0207674_10003481
741 Ga0207675_100044541
742 Ga0207683_10000447
743 Ga0207683_10009933
744 Ga0207428_10003094
745 Ga0207428_10099813
746 Ga0268264_10036984
747 Ga0265319_1023935
748 Ga0265334_10008426
749 Ga0265318_10002084
750 Ga0265336_10001280
751 Ga0265338_10001704
752 Ga0265338_10010698
753 Ga0265338_10018327
754 Ga0265338_10040946
755 Ga0265330_10006709
756 Ga0265325_10017313
757 Ga0265340_10008842
758 Ga0265331_10013454
759 Ga0265327_10020741
760 Ga0265316_10073850
761 Ga0265313_10017445
762 Ga0265313_10024742
763 Ga0265313_10042770
764 Ga0307416_100066583
765 Ga0316583_10022588
766 Ga0373948_0001983
767 Ga0373958_0002978
768 Ga0373959_0001131
769 Ga0373949_0003494
770 Ga0373951_0002626
771 Ga0373952_0005698
772 Ga0373939_0002242
773 Ga0373961_0002224
774 Ga0373962_0002564
775 Ga0373925_0262413
776 Ga0395899_0002670
777 Ga0395899_0013058
778 Ga0395899_0014243
779 Ga0395899_0019730
780 Ga0395899_0037755
781 Ga0395899_0038220
782 Ga0395899_0044874
783 Ga0395899_0131037
784 Ga0395900_0002130
785 Ga0395900_0004868
786 Ga0395900_0005118
787 Ga0395900_0006188
788 Ga0395900_0011512
789 Ga0395900_0029323
790 Ga0395900_0037849
791 Ga0395900_0041003
792 Ga0395900_0042517
793 Ga0395900_0051438
794 Ga0395900_0060643
795 Ga0395900_0148609
796 Ga0395900_0244599
797 Ga0395898_0001816
798 Ga0395898_0004143
799 Ga0395898_0009890
800 Ga0395898_0010831
801 Ga0395898_0018593
802 Ga0395898_0027751
803 Ga0395898_0037285
804 Ga0395898_0038588
805 Ga0395898_0075221
806 Ga0395898_0110572
807 Ga0395898_0116582
808 Ga0395898_0117893
809 Ga0395898_0128714
810 Ga0395898_0196523
811 Ga0395905_0003766
812 Ga0395905_0006417
813 Ga0395905_0010708
814 Ga0395905_0018939
815 Ga0395905_0020430
816 Ga0395905_0032900
817 Ga0395905_0045198
818 Ga0395905_0114518
819 Ga0395905_0149539
820 Ga0395905_0239233
821 Ga0436364_0376890
822 Ga0436364_0821342
823 Ga0436364_1031907
824 Ga0436364_1063997
825 Ga0395901_0001175
826 Ga0395901_0005645
827 Ga0395901_0008378
828 Ga0395901_0011969
829 Ga0395901_0014896
830 Ga0395901_0026085
831 Ga0395901_0039091
832 Ga0395901_0045173
833 Ga0395901_0051512
834 Ga0395901_0066511
835 Ga0395901_0100070
836 Ga0395901_0114319
837 Ga0395901_0143144
838 Ga0436365_0036386
839 Ga0436365_1404752
840 Ga0436365_1681277
841 Ga0436363_0008127
842 Ga0436363_0109681
843 Ga0436363_0285596
844 Ga0436363_0875286
845 Ga0436363_1045012
846 Ga0436362_0350106
847 Ga0436362_0623705
848 Ga0439439_0003958
849 Ga0439461_0002553
850 Ga0439461_0003448
851 Ga0451853_0045019
852 Ga0451853_0735613
853 Ga0439433_0000509
854 Ga0439457_015180
855 Ga0439446_0003905
856 Ga0439446_0010839
857 Ga0439446_0011390
858 Ga0439434_0004367
859 Ga0439434_0011817
860 Ga0451577_0316502
861 Ga0466969_0020284
862 Ga0466966_0056045
863 Ga0466963_0004725
864 Ga0466963_0045236
865 Ga0466963_0045895
866 Ga0466963_0164996
867 Ga0466964_0000430
868 Ga0466960_0063331
869 Ga0466959_0003109
870 Ga0466959_0082626
871 Ga0451576_0090810
872 Ga0466958_0005859
873 Ga0466958_0092128
874 Ga0466967_0001126
875 Ga0466967_0001502
876 Ga0466967_0077891
877 Ga0466967_0081199
878 Ga0466967_0083772
879 Ga0466967_0094609
880 Ga0466967_0200042
881 Ga0495603_0050951
882 Ga0495641_0025902
883 Ga0495653_0065989
884 Ga0495582_0008884
885 Ga0495639_0069171
886 Ga0495664_0030397
887 Ga0495584_0030605
888 Ga0495584_0043493
889 Ga0495584_0091180
890 Ga0495642_0012296
891 Ga0495652_0070747
892 Ga0495665_0040153
893 Ga0495586_0024289
894 Ga0495667_0032516
895 Ga0495635_0039079
896 Ga0495635_0043926
897 Ga0495659_0031779
898 Ga0495588_0091257
899 Ga0495657_0033952
900 Ga0495657_0078487
901 Ga0495647_0015874
902 Ga0495647_0036968
903 Ga0495658_0014321
904 Ga0495613_0129480
905 Ga0495624_0055502
906 Ga0495581_0004317
907 Ga0495581_0007471
908 Ga0495674_0103621
909 Ga0495676_0006533
910 Ga0495676_0052336
911 Ga0495677_0034956
912 Ga0496100_0016868
913 Ga0496100_0096288
914 Ga0496101_0007298
915 Ga0496101_0034580
916 Ga0496101_0053993
917 Ga0496102_0005503
918 Ga0496102_0021840
919 Ga0496102_0108712
920 Ga0496103_0023239
921 Ga0496104_0000444
922 Ga0496104_0001256
923 Ga0496104_0016705
924 Ga0496104_0022859
925 Ga0496104_0113080
926 Ga0496104_0197860
927 Ga0496105_0000200
928 Ga0496105_0009175
929 Ga0496105_0019660
930 Ga0496106_0002259
931 Ga0496106_0015372
932 Ga0496106_0017830
933 Ga0496106_0025838
934 Ga0496106_0078407
935 Ga0496106_0083495
936 Ga0496107_0004523
937 Ga0496107_0016140
938 Ga0496107_0032287
939 Ga0496107_0032288
940 Ga0496107_0090984
941 Ga0496108_0009117
942 Ga0496108_0014468
943 Ga0496108_0023818
944 Ga0496108_0028810
945 Ga0496108_0054764
946 Ga0496108_0099342
947 Ga0496109_0002031
948 Ga0496109_0002306
949 Ga0496109_0035674
950 Ga0496109_0036855
951 Ga0496109_0078406
952 Ga0496109_0153756
953 Ga0496110_0003652
954 Ga0496110_0008876
955 Ga0496110_0021391
956 Ga0496110_0028334
957 Ga0496110_0032252
958 Ga0496110_0124683
959 Ga0496110_0147497
960 Ga0496110_0203035
961 Ga0496111_0000113
962 Ga0496111_0000237
963 Ga0496111_0001148
964 Ga0496111_0119766
965 Ga0496112_0001508
966 Ga0496112_0038309
967 Ga0496112_0043655
968 Ga0496112_0083230
969 Ga0496113_0001597
970 Ga0496113_0152834
971 Ga0496114_0002159
972 Ga0496114_0002970
973 Ga0496114_0019143
974 Ga0496114_0021995
975 Ga0501033_0097769
976 Ga0501036_0010909
977 Ga0501036_0104160
978 Ga0501037_0090390
979 Ga0501038_0008448
980 Ga0501038_0114158
981 Ga0501039_0021879
982 Ga0501040_0002230
983 Ga0501040_0087925
984 Ga0501041_0001334
985 Ga0501041_0056653
986 Ga0501041_0194435
987 Ga0501042_0002803
988 Ga0501042_0002973
989 Ga0501043_0095588
990 Ga0501046_0024109
991 Ga0501046_0057138
992 Ga0501047_0029384
993 Ga0501047_0260416
994 Ga0501048_0005846
995 Ga0501048_0040143
996 Ga0501068_0030295
997 Ga0501069_0003597
998 Ga0501069_0026279
999 Ga0501069_0062398
1000 Ga0501069_0081259
1001 Ga0501070_0000778
1002 Ga0501070_0069523
1003 Ga0501071_0000047
1004 Ga0501072_0004977
1005 Ga0501072_0071936
1006 Ga0501073_0040439
1007 Ga0501074_0083752
1008 Ga0501076_0018154
1009 Ga0501077_0020450
1010 Ga0501077_0213959
1011 Ga0501079_0024065
1012 Ga0501079_0027550
1013 Ga0501079_0073086
1014 Ga0501080_0013317
1015 Ga0501080_0136199
1016 Ga0501080_0148393
1017 Ga0501081_0013472
1018 Ga0501081_0027850
1019 Ga0501081_0038237
1020 Ga0501035_0171257
1021 Ga0501044_0148210
1022 Ga0501045_0001066
1023 Ga0501045_0003340
1024 nmdc:mga05p37_36453_c1
1025 nmdc:mga05p37_7957_c1
1026 nmdc:mga0qj67_25600_c1
1027 nmdc:mga06r32_119036_c1
1028 nmdc:mga06r32_38019_c1
1029 nmdc:mga06r32_67730_c1
1030 nmdc:mga08y16_110816_c1
1031 nmdc:mga08y16_13639_c1
1032 nmdc:mga08y16_74276_c1
1033 nmdc:mga08y16_89392_c1
1034 nmdc:mga0n895_199617_c1
1035 nmdc:mga0n895_22888_c1
1036 nmdc:mga0n895_322248_c1
1037 nmdc:mga0n895_55180_c1
1038 nmdc:mga0rr50_1472_c1
1039 nmdc:mga08x19_174617_c1
1040 nmdc:mga08x19_31263_c1
1041 nmdc:mga08x19_8789_c1
1042 nmdc:mga0a205_1546_c1
1043 nmdc:mga0a205_177321_c1
1044 nmdc:mga0a205_92535_c1
1045 Ga0495601_0062471
1046 Ga0501084_0000362
1047 Ga0590075_005198
1048 Ga0501082_0004845
1049 Ga0501082_0018178
1050 Ga0530510_0015570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

223

381

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

115

477

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8775 1 441
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.8762 3 438
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8756 1 441
4mmo-assembly1.cif.gz_B the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8602 11 441
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.8596 3 438
ID Description Score Start End Superfamily
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8953 1 441 3.40.630.10
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8922 1 441 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8746 3 439 3.40.630.10
af_Q4DBK5_22_457_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8694 8 430 3.40.630.10
af_P65807_4_190_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8619 4 168 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7W0SXN2-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9655 1 180 GO:0016787
AF-A0A7V9CUL1-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9633 64 442 GO:0016787
AF-A0A6A7LVZ6-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9627 202 441 GO:0016787
AF-A0A7V9CUL1-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9559 64 442 GO:0016787
AF-A0A7W1SS61-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.946 4 157 GO:0016787

Map