F459259

General Info

Members Datasets Scaffolds Average Seq Length
525 360 1050 362

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10004570|Ga0105243_100045703
Length 397
Sequence MGVLVIDSMNQIIEIQNFPYEHALPRLRRMTLAAPTPAPFTLEAMLRAIPKVELHCHLFGTVRHDTFRQLNRRAGAPLADAEIDGFYTRGEKPVGVLRVLRALDAQLVRSADDLYQLTLEYLQDAASHEVRYAEFFWNPTGTVHGSGIAYPLAQGAIVRAIHDAQQAFGITGRLIAAIDREASAEAAVEMVEWVKSHRCDEVIGIGIDYRENDRPPELFARAYAEAKKAGLKTTAHAGEFGMPWTNVRTALELLQVDRIDHGYTVVDQPDFARQCAERGVIFTVVPTNSYYLRTLPPERWALDHPIRRMPGLGLRIHPNTDDPTLHQVTPTGAWLMMVRDFGFGLDDLRGFMHNGLAGAWIDDTQRRQWRAEWSADFDALRARLPCEPTPSATPFPG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
254 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
255 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
260 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
267 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
268 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
271 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
272 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
273 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
274 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
275 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
276 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
277 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
278 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
279 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
280 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
281 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
282 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
283 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
284 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
285 2643221658 Variovorax sp. Root411 Isolate Unclassified
286 2643221672 Variovorax sp. Root434 Isolate Unclassified
287 2643221683 Variovorax sp. Root473 Isolate Unclassified
288 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
289 2738541277 Variovorax sp. GV051 Isolate Unclassified
290 2738541307 Variovorax sp. GV008 Isolate Unclassified
291 2738543012 Acidovorax sp. CF301 Isolate Unclassified
292 2738543013 Variovorax sp. BT01 Isolate Unclassified
293 2738543019 Variovorax sp. GV040 Isolate Unclassified
294 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
295 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
296 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
297 2816332133 Acidovorax radicis 2721A Isolate Unclassified
298 2818991436 Collimonas arenae 515 Isolate Unclassified
299 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
300 2818991446 Variovorax sp. 1180 Isolate Unclassified
301 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
302 2818991452 Burkholderia cepacia 561 Isolate Unclassified
303 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
304 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
305 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
306 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
307 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
308 2842677519 Variovorax sp. R-72495 Isolate Unclassified
309 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
310 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
311 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
312 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
313 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
314 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
315 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
316 2885198086 Variovorax sp. 679 Isolate Unclassified
317 2885211737 Variovorax sp. 553 Isolate Unclassified
318 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
319 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
320 2899924645 Variovorax sp. 369 Isolate Unclassified
321 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
322 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
323 2904456579 Variovorax sp. 2002 Isolate Unclassified
324 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
325 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
326 2904564687 Burkholderia sp. 571 Isolate Unclassified
327 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
328 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
329 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
330 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
331 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
332 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
333 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
334 2928037797 Variovorax sp. 1126 Isolate Unclassified
335 2928044640 Variovorax sp. 1128 Isolate Unclassified
336 2928051484 Variovorax sp. 1133 Isolate Unclassified
337 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
338 2928070936 Variovorax gossypii 1167 Isolate Unclassified
339 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
340 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
341 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
342 2928163908 Burkholderia sp. 567 Isolate Unclassified
343 2928170801 Burkholderia sp. 572 Isolate Unclassified
344 2928536128 Burkholderia sola 565 Isolate Unclassified
345 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
346 2929520902 Variovorax beijingensis 502 Isolate Unclassified
347 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
348 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
349 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
350 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
351 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
352 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
353 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
354 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
355 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
356 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
357 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
358 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
359 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
360 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.67
Metatranscriptomes 0.19
Isolates 17.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.19
Nodule 1.33
Rhizoplane 3.62
Rhizosphere 45.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10004570 3300009148 Bacteria 10923
2 JGI24740J21852_10005833 3300001979 Bacteria 5166
3 JGI24739J22299_10011382 3300001989 Bacteria 3286
4 JGI24739J22299_10018561 3300001989 Bacteria 2498
5 JGI25155J39150_1000030 3300002704 Bacteria 114492
6 JGI25155J39150_1000203 3300002704 Bacteria 24470
7 JGI25156J39149_1000059 3300002705 Bacteria 86130
8 JGI25162J39368_1005172 3300002737 Bacteria 2674
9 JGI25154J39366_1000056 3300002738 Bacteria 114494
10 JGI25154J39366_1000273 3300002738 Bacteria 31922
11 JGI25157J39369_1000615 3300002741 Bacteria 20275
12 JGI25152J39213_1003511 3300002773 Bacteria 5315
13 JGI25150J39212_1001615 3300002774 Bacteria 6140
14 JGI25151J46595_10001428 3300003187 Bacteria 16264
15 JGI25153J46596_10007572 3300003215 Bacteria 5315
16 rootH1_10123316 3300003316 Bacteria 1647
17 rootH2_10221804 3300003320 Bacteria 1580
18 rootH1_10019511 3300003323 Bacteria 1636
19 JGI25160J50197_1000554 3300003354 Bacteria 21181
20 JGI25160J50197_1012213 3300003354 Bacteria 2997
21 JGI25161J50226_1003431 3300003374 Bacteria 3625
22 Ga0006562J51391_1102716 3300003578 Bacteria 3320
23 Ga0055538_1000002 3300003751 Bacteria 999437
24 Ga0055539_1000002 3300003752 Bacteria 999437
25 Ga0055533_1000004 3300003756 Bacteria 999437
26 Ga0055532_1000059 3300003758 Bacteria 152948
27 Ga0055532_1000199 3300003758 Bacteria 49349
28 Ga0055532_1000717 3300003758 Bacteria 12333
29 Ga0055525_1000002 3300003759 Bacteria 999437
30 Ga0055527_1000810 3300003760 Bacteria 8427
31 Ga0055535_1000535 3300003761 Bacteria 32872
32 Ga0055535_1000948 3300003761 Bacteria 19240
33 Ga0055542_1000560 3300003762 Bacteria 32881
34 Ga0055542_1000806 3300003762 Bacteria 23135
35 Ga0055529_1000801 3300003763 Bacteria 19258
36 Ga0055526_1000577 3300003771 Bacteria 28807
37 Ga0055537_1000394 3300003773 Bacteria 29381
38 Ga0055537_1000411 3300003773 Bacteria 28094
39 Ga0055524_1000537 3300003775 Bacteria 28807
40 Ga0055524_1002376 3300003775 Bacteria 9764
41 Ga0055536_1001872 3300003781 Bacteria 12264
42 Ga0055536_1006150 3300003781 Bacteria 5676
43 Ga0055536_1010039 3300003781 Bacteria 3822
44 Ga0055534_1000131 3300003784 Bacteria 56581
45 Ga0055534_1001204 3300003784 Bacteria 10879
46 Ga0055528_1000568 3300003790 Bacteria 28094
47 Ga0055528_1000629 3300003790 Bacteria 26158
48 Ga0055528_1015616 3300003790 Bacteria 2733
49 Ga0055530_10004520 3300003791 Bacteria 7120
50 Ga0055540_1000555 3300003792 Bacteria 27644
51 Ga0055540_1007122 3300003792 Bacteria 4285
52 Ga0055540_1007985 3300003792 Bacteria 3884
53 Ga0055540_1012938 3300003792 Bacteria 2583
54 Ga0055540_1016168 3300003792 Bacteria 2136
55 Ga0055531_10011417 3300003794 Bacteria 4285
56 Ga0055541_1000002 3300003841 Bacteria 896405
57 Ga0055543_1000371 3300004625 Bacteria 29718
58 Ga0055543_1007531 3300004625 Bacteria 2502
59 Ga0065165_1023435 3300005262 Bacteria 2093
60 Ga0065714_10068637 3300005288 Bacteria 4614
61 Ga0065704_10077202 3300005289 Bacteria 4821
62 Ga0070660_100000642 3300005339 Bacteria 23150
63 Ga0070674_100171240 3300005356 Bacteria 1656
64 Ga0070673_100135399 3300005364 Bacteria 2073
65 Ga0070659_100000301 3300005366 Bacteria 38549
66 Ga0070667_100153461 3300005367 Bacteria 2025
67 Ga0070714_100063727 3300005435 Bacteria 3170
68 Ga0070663_100000215 3300005455 Bacteria 28937
69 Ga0070662_100009397 3300005457 Bacteria 6390
70 Ga0070697_100054420 3300005536 Bacteria 3252
71 Ga0068853_100030422 3300005539 Bacteria 4560
72 Ga0070672_100304384 3300005543 Bacteria 1352
73 Ga0070686_100125377 3300005544 Bacteria 1769
74 Ga0070695_100009985 3300005545 Bacteria 5662
75 Ga0070696_100005600 3300005546 Bacteria 8384
76 Ga0068855_100105073 3300005563 Bacteria 3247
77 Ga0068855_100254800 3300005563 Bacteria 1957
78 Ga0070664_100062883 3300005564 Bacteria 3165
79 Ga0068854_100009221 3300005578 Bacteria 6368
80 Ga0068856_100061126 3300005614 Bacteria 3721
81 Ga0068856_100183666 3300005614 Bacteria 2105
82 Ga0068852_100001123 3300005616 Bacteria 17688
83 Ga0068852_100005851 3300005616 Bacteria 8833
84 Ga0068852_100161316 3300005616 Bacteria 2094
85 Ga0068851_10016681 3300005834 Bacteria 3519
86 Ga0081539_10000539 3300005985 Bacteria 78266
87 Ga0075365_10074298 3300006038 Bacteria 2292
88 Ga0075365_10133302 3300006038 Bacteria 1720
89 Ga0075362_10009225 3300006177 Bacteria 3806
90 Ga0075366_10015640 3300006195 Bacteria 4353
91 Ga0075366_10040157 3300006195 Bacteria 2767
92 Ga0075370_10009646 3300006353 Bacteria 5023
93 Ga0075370_10026273 3300006353 Bacteria 3224
94 Ga0075370_10127177 3300006353 Bacteria 1486
95 Ga0075436_100004775 3300006914 Bacteria 9306
96 Ga0075436_100037117 3300006914 Bacteria 3365
97 Ga0099826_10018596 3300006948 Bacteria 5241
98 Ga0105251_10037674 3300009011 Bacteria 2371
99 Ga0105250_10022688 3300009092 Bacteria 2529
100 Ga0105240_10000787 3300009093 Bacteria 57466
101 Ga0105240_10003701 3300009093 Bacteria 23628
102 Ga0105240_10007279 3300009093 Bacteria 16110
103 Ga0105240_10121567 3300009093 Bacteria 3143
104 Ga0105240_10123993 3300009093 Bacteria 3107
105 Ga0105240_10310942 3300009093 Bacteria 1799
106 Ga0114129_10152988 3300009147 Bacteria 3156
107 Ga0105243_10181848 3300009148 Bacteria 1829
108 Ga0105237_10015344 3300009545 Bacteria 7978
109 Ga0105238_10005545 3300009551 Bacteria 12464
110 Ga0105238_10023167 3300009551 Bacteria 6332
111 Ga0105239_10071083 3300010375 Bacteria 3823
112 Ga0105239_10306954 3300010375 Bacteria 1788
113 Ga0157373_10006492 3300013100 Bacteria 8728
114 Ga0157370_10008731 3300013104 Bacteria 10900
115 Ga0157369_10049761 3300013105 Bacteria 4541
116 Ga0157369_10055393 3300013105 Bacteria 4281
117 Ga0157369_10272837 3300013105 Bacteria 1762
118 Ga0163162_10042797 3300013306 Bacteria 4534
119 Ga0163162_10059083 3300013306 Bacteria 3866
120 Ga0157372_10266119 3300013307 Bacteria 1991
121 Ga0182008_10000139 3300014497 Bacteria 55735
122 Ga0182008_10000998 3300014497 Bacteria 19680
123 Ga0182008_10001824 3300014497 Bacteria 13887
124 Ga0182008_10005011 3300014497 Bacteria 7621
125 Ga0182008_10024549 3300014497 Bacteria 3068
126 Ga0182008_10093273 3300014497 Bacteria 1485
127 Ga0182006_1000010 3300015261 Bacteria 413414
128 Ga0182006_1008590 3300015261 Bacteria 4628
129 Ga0182006_1048993 3300015261 Bacteria 1632
130 Ga0182007_10000021 3300015262 Bacteria 193408
131 Ga0182007_10000383 3300015262 Bacteria 27816
132 Ga0182007_10005424 3300015262 Bacteria 5605
133 Ga0182007_10009478 3300015262 Bacteria 3919
134 Ga0182005_1000009 3300015265 Bacteria 455334
135 Ga0182005_1000361 3300015265 Bacteria 25411
136 Ga0183362_10003 3300015683 Bacteria 977584
137 Ga0163161_10011509 3300017792 Bacteria 6140
138 Ga0163161_10012165 3300017792 Bacteria 5968
139 Ga0163161_10016177 3300017792 Bacteria 5207
140 Ga0213872_10001060 3300021361 Bacteria 19085
141 Ga0209435_100032 3300025206 Bacteria 153068
142 Ga0209435_100111 3300025206 Bacteria 31379
143 Ga0209436_103849 3300025208 Bacteria 3839
144 Ga0209436_105762 3300025208 Bacteria 2803
145 Ga0209784_100002 3300025224 Bacteria 1753105
146 Ga0209566_100003 3300025225 Bacteria 1753105
147 Ga0209566_100503 3300025225 Bacteria 27100
148 Ga0209674_100004 3300025226 Bacteria 1753105
149 Ga0209672_100145 3300025228 Bacteria 66093
150 Ga0209672_103456 3300025228 Bacteria 3266
151 Ga0209147_100109 3300025229 Bacteria 153068
152 Ga0209147_100201 3300025229 Bacteria 65943
153 Ga0209147_100258 3300025229 Bacteria 49401
154 Ga0209147_101536 3300025229 Bacteria 7998
155 Ga0209563_100006 3300025230 Bacteria 1753105
156 Ga0209437_100261 3300025233 Bacteria 82127
157 Ga0209258_100190 3300025242 Bacteria 126878
158 Ga0209258_100350 3300025242 Bacteria 66093
159 Ga0209258_100556 3300025242 Bacteria 32949
160 Ga0207425_1000394 3300025245 Bacteria 29469
161 Ga0207425_1009497 3300025245 Bacteria 2414
162 Ga0209646_1000052 3300025246 Bacteria 286370
163 Ga0209646_1000113 3300025246 Bacteria 153068
164 Ga0209026_1000102 3300025250 Bacteria 153068
165 Ga0209026_1003192 3300025250 Bacteria 5550
166 Ga0209677_100003 3300025253 Bacteria 1753105
167 Ga0209148_1000327 3300025254 Bacteria 65997
168 Ga0209148_1000589 3300025254 Bacteria 33096
169 Ga0209759_1000104 3300025256 Bacteria 153068
170 Ga0209759_1000303 3300025256 Bacteria 67661
171 Ga0209129_1000033 3300025258 Bacteria 336894
172 Ga0209129_1006735 3300025258 Bacteria 3622
173 Ga0209565_1000164 3300025263 Bacteria 86911
174 Ga0209565_1000188 3300025263 Bacteria 75532
175 Ga0209565_1007477 3300025263 Bacteria 2944
176 Ga0209565_1007562 3300025263 Bacteria 2919
177 Ga0209455_1000248 3300025272 Bacteria 65943
178 Ga0209455_1005766 3300025272 Bacteria 3765
179 Ga0209673_1000057 3300025273 Bacteria 270150
180 Ga0209673_1000185 3300025273 Bacteria 125742
181 Ga0209673_1000344 3300025273 Bacteria 85344
182 Ga0209673_1000411 3300025273 Bacteria 75532
183 Ga0209673_1014114 3300025273 Bacteria 3109
184 Ga0209673_1017713 3300025273 Bacteria 2618
185 Ga0209130_1000402 3300025284 Bacteria 47370
186 Ga0209130_1000663 3300025284 Bacteria 31315
187 Ga0209130_1001742 3300025284 Bacteria 12970
188 Ga0209130_1014734 3300025284 Bacteria 1952
189 Ga0209675_1000172 3300025291 Bacteria 75532
190 Ga0209675_1004172 3300025291 Bacteria 6543
191 Ga0209675_1007309 3300025291 Bacteria 4261
192 Ga0209676_1000179 3300025292 Bacteria 150096
193 Ga0209676_1000505 3300025292 Bacteria 61665
194 Ga0209676_1009118 3300025292 Bacteria 4324
195 Ga0209676_1011844 3300025292 Bacteria 3479
196 Ga0209676_1013053 3300025292 Bacteria 3216
197 Ga0209676_1022540 3300025292 Bacteria 2084
198 Ga0209025_1000244 3300025294 Bacteria 127938
199 Ga0209025_1000541 3300025294 Bacteria 71090
200 Ga0209025_1001083 3300025294 Bacteria 39415
201 Ga0209025_1013087 3300025294 Bacteria 5243
202 Ga0209564_1000317 3300025295 Bacteria 93914
203 Ga0209564_1000538 3300025295 Bacteria 61260
204 Ga0209564_1008883 3300025295 Bacteria 4883
205 Ga0209758_1000027 3300025297 Bacteria 549650
206 Ga0209758_1009169 3300025297 Bacteria 6226
207 Ga0209758_1011168 3300025297 Bacteria 5243
208 Ga0209050_1000172 3300025298 Bacteria 150096
209 Ga0209050_1011068 3300025298 Bacteria 4337
210 Ga0209050_1018599 3300025298 Bacteria 2689
211 Ga0209256_1000069 3300025299 Bacteria 245640
212 Ga0209256_1000261 3300025299 Bacteria 93914
213 Ga0209256_1016965 3300025299 Bacteria 2449
214 Ga0207426_1000027 3300025302 Bacteria 513176
215 Ga0207426_1000115 3300025302 Bacteria 227423
216 Ga0209051_1000025 3300025303 Bacteria 415397
217 Ga0209051_1000046 3300025303 Bacteria 296424
218 Ga0209051_1000183 3300025303 Bacteria 113192
219 Ga0209051_1000240 3300025303 Bacteria 92221
220 Ga0209051_1000331 3300025303 Bacteria 71198
221 Ga0209051_1010425 3300025303 Bacteria 4694
222 Ga0209051_1013459 3300025303 Bacteria 3893
223 Ga0209257_1000039 3300025304 Bacteria 591694
224 Ga0209257_1000410 3300025304 Bacteria 83167
225 Ga0209257_1000716 3300025304 Bacteria 50931
226 Ga0209257_1008249 3300025304 Bacteria 5992
227 Ga0209257_1010840 3300025304 Bacteria 4516
228 Ga0207656_10013906 3300025321 Bacteria 3088
229 Ga0207696_1033864 3300025711 Bacteria 1529
230 Ga0207655_1003427 3300025728 Bacteria 11812
231 Ga0207680_10086556 3300025903 Bacteria 1982
232 Ga0207647_10121018 3300025904 Bacteria 1543
233 Ga0207695_10000377 3300025913 Bacteria 101452
234 Ga0207695_10001940 3300025913 Bacteria 32143
235 Ga0207695_10003192 3300025913 Bacteria 23356
236 Ga0207695_10020180 3300025913 Bacteria 7640
237 Ga0207671_10034267 3300025914 Bacteria 3773
238 Ga0207671_10244871 3300025914 Bacteria 1409
239 Ga0207657_10000003 3300025919 Bacteria 263148
240 Ga0207681_10262386 3300025923 Bacteria 1353
241 Ga0207694_10033054 3300025924 Bacteria 3962
242 Ga0207694_10041863 3300025924 Bacteria 3531
243 Ga0207694_10105507 3300025924 Bacteria 2237
244 Ga0207687_10272316 3300025927 Bacteria 1354
245 Ga0207690_10000007 3300025932 Bacteria 388533
246 Ga0207706_10015133 3300025933 Bacteria 6981
247 Ga0207709_10000341 3300025935 Bacteria 48317
248 Ga0207709_10000705 3300025935 Bacteria 26910
249 Ga0207679_10000531 3300025945 Bacteria 25768
250 Ga0207667_10011408 3300025949 Bacteria 10328
251 Ga0207667_10015142 3300025949 Bacteria 8770
252 Ga0207667_10024478 3300025949 Bacteria 6629
253 Ga0207651_10107598 3300025960 Bacteria 2085
254 Ga0207658_10088057 3300025986 Bacteria 2399
255 Ga0207639_10054651 3300026041 Bacteria 3053
256 Ga0207678_10000792 3300026067 Bacteria 28960
257 Ga0207648_10198784 3300026089 Bacteria 1778
258 Ga0207683_10026080 3300026121 Bacteria 5046
259 Ga0207698_10001463 3300026142 Bacteria 13735
260 Ga0207698_10006782 3300026142 Bacteria 7158
261 Ga0209371_1000292 3300027312 Bacteria 57076
262 Ga0209282_1005897 3300027666 Bacteria 7575
263 Ga0268265_10090411 3300028380 Bacteria 2445
264 Ga0265319_1045668 3300028563 Bacteria 1463
265 Ga0307515_10000026 3300028794 Bacteria 382411
266 Ga0307515_10000132 3300028794 Bacteria 176547
267 Ga0307515_10003144 3300028794 Bacteria 34920
268 Ga0307515_10036691 3300028794 Bacteria 7919
269 Ga0307515_10145233 3300028794 Bacteria 2517
270 Ga0268256_1000255 3300030500 Bacteria 56398
271 Ga0316179_1091897 3300030734 Bacteria 3151
272 Ga0316183_1009761 3300030742 Bacteria 5399
273 Ga0307513_10016875 3300031456 Bacteria 8782
274 Ga0307408_100005473 3300031548 Bacteria 8493
275 Ga0307408_100156926 3300031548 Bacteria 1803
276 Ga0307514_10021962 3300031649 Bacteria 5196
277 Ga0307405_10048682 3300031731 Bacteria 2615
278 Ga0307405_10275199 3300031731 Bacteria 1264
279 Ga0307406_10000563 3300031901 Bacteria 21360
280 Ga0307412_10063494 3300031911 Bacteria 2491
281 Ga0307412_10131144 3300031911 Bacteria 1820
282 Ga0307414_10059682 3300032004 Bacteria 2694
283 Ga0307414_10190040 3300032004 Bacteria 1660
284 Ga0395899_0007757 3300037312 Bacteria 8276
285 Ga0395899_0046541 3300037312 Bacteria 3231
286 Ga0395899_0060359 3300037312 Bacteria 2794
287 Ga0395900_0007104 3300037418 Bacteria 11599
288 Ga0395900_0033785 3300037418 Bacteria 5263
289 Ga0395898_0005632 3300037466 Bacteria 13499
290 Ga0395898_0041621 3300037466 Bacteria 4537
291 Ga0395905_0189170 3300037471 Bacteria 1931
292 Ga0395901_0016202 3300038443 Bacteria 7594
293 Ga0395901_0027852 3300038443 Bacteria 5810
294 Ga0395901_0063807 3300038443 Bacteria 3834
295 Ga0395901_0309931 3300038443 Bacteria 1635
296 Ga0395901_0587631 3300038443 Bacteria 1124
297 Ga0436360_0945601 3300039438 Bacteria 1608
298 Ga0436361_0443921 3300039447 Bacteria 5573
299 Ga0439436_0012107 3300041404 Bacteria 2618
300 Ga0439465_0032357 3300041413 Bacteria 1670
301 Ga0439431_0006257 3300041997 Bacteria 2628
302 Ga0439433_0004365 3300041999 Bacteria 3049
303 Ga0439449_0002195 3300042007 Bacteria 7684
304 Ga0439452_014481 3300042010 Bacteria 2189
305 Ga0439462_0001878 3300042015 Bacteria 4771
306 Ga0450894_001918 3300042131 Bacteria 2874
307 Ga0450898_006192 3300042134 Bacteria 1830
308 Ga0439434_0002314 3300042435 Bacteria 5539
309 Ga0450918_002432 3300042531 Bacteria 3520
310 Ga0466965_0012361 3300044683 Bacteria 4013
311 Ga0466963_0016130 3300044694 Bacteria 4641
312 Ga0451576_0305095 3300045051 Bacteria 1665
313 Ga0495627_000342 3300046453 Bacteria 43925
314 Ga0495627_015031 3300046453 Bacteria 2681
315 Ga0495638_0008651 3300046460 Bacteria 7200
316 Ga0495651_0006540 3300046462 Bacteria 8901
317 Ga0495651_0077466 3300046462 Bacteria 2517
318 Ga0495650_0001133 3300046471 Bacteria 28973
319 Ga0495580_0004320 3300046472 Bacteria 11941
320 Ga0495607_0012464 3300046501 Bacteria 5612
321 Ga0495616_0000607 3300046513 Bacteria 27000
322 Ga0495631_0000086 3300046518 Bacteria 59927
323 Ga0495637_0043703 3300046520 Bacteria 1911
324 Ga0495643_0031117 3300046522 Bacteria 2973
325 Ga0495652_0105157 3300046529 Bacteria 2281
326 Ga0495654_0007379 3300046530 Bacteria 6143
327 Ga0495654_0057108 3300046530 Bacteria 1886
328 Ga0495654_0061431 3300046530 Bacteria 1804
329 Ga0495622_0015332 3300046557 Bacteria 3563
330 Ga0495633_0000751 3300046558 Bacteria 29251
331 Ga0495667_0097340 3300046559 Bacteria 1905
332 Ga0495668_0008641 3300046616 Bacteria 6332
333 Ga0495611_0041359 3300046648 Bacteria 2056
334 Ga0495625_0000416 3300046660 Bacteria 64225
335 Ga0495625_0000606 3300046660 Bacteria 52107
336 Ga0495625_0021343 3300046660 Bacteria 4988
337 Ga0495661_0074891 3300046665 Bacteria 1969
338 Ga0495588_0018285 3300046674 Bacteria 3415
339 Ga0495657_0190417 3300046675 Bacteria 1254
340 Ga0495669_0024465 3300046684 Bacteria 2630
341 Ga0495624_0033244 3300046690 Bacteria 3340
342 Ga0495671_0009027 3300046692 Bacteria 5595
343 Ga0495600_0122886 3300046809 Bacteria 1688
344 Ga0495660_0097066 3300046810 Bacteria 1522
345 Ga0495604_0012892 3300047317 Bacteria 6659
346 Ga0495672_0018732 3300047320 Bacteria 4585
347 Ga0495681_0000061 3300047470 Bacteria 99933
348 Ga0495686_0000044 3300047472 Bacteria 288079
349 Ga0495602_0025261 3300048088 Bacteria 5750
350 Ga0495602_0111793 3300048088 Bacteria 2218
351 Ga0495614_0020553 3300048089 Bacteria 2853
352 Ga0496101_0023970 3300048904 Bacteria 4220
353 Ga0496101_0120836 3300048904 Bacteria 1980
354 Ga0496102_0112308 3300048905 Bacteria 2541
355 Ga0496104_0110326 3300048907 Bacteria 2637
356 Ga0496105_0007279 3300048908 Bacteria 8550
357 Ga0496108_0119180 3300048911 Bacteria 2263
358 Ga0496110_0408691 3300048913 Bacteria 1237
359 Ga0496111_0102790 3300048914 Bacteria 2101
360 Ga0496111_0151420 3300048914 Bacteria 1720
361 Ga0496112_0000069 3300048915 Bacteria 68177
362 Ga0496114_0201424 3300048917 Bacteria 1743
363 Ga0496116_0003223 3300048919 Bacteria 16271
364 Ga0496116_0034141 3300048919 Bacteria 3595
365 Ga0496116_0038279 3300048919 Bacteria 3332
366 Ga0496116_0104016 3300048919 Bacteria 1688
367 Ga0496117_0000010 3300048920 Bacteria 611954
368 Ga0496118_0000009 3300048921 Bacteria 611954
369 Ga0496118_0026347 3300048921 Bacteria 4956
370 Ga0496119_0047083 3300048922 Bacteria 2686
371 Ga0496121_0002276 3300048924 Bacteria 29886
372 Ga0496121_0020373 3300048924 Bacteria 6571
373 Ga0496121_0022092 3300048924 Bacteria 6193
374 Ga0496121_0194880 3300048924 Bacteria 1449
375 Ga0496122_0000225 3300048925 Bacteria 126304
376 Ga0496122_0000890 3300048925 Bacteria 55628
377 Ga0496123_0000192 3300048926 Bacteria 124096
378 Ga0496123_0001424 3300048926 Bacteria 33453
379 Ga0496124_0047616 3300048927 Bacteria 3667
380 Ga0496125_0001640 3300048928 Bacteria 31557
381 Ga0496125_0008898 3300048928 Bacteria 10428
382 Ga0496125_0050396 3300048928 Bacteria 3447
383 Ga0496125_0052377 3300048928 Bacteria 3356
384 Ga0496126_0018925 3300048929 Bacteria 6803
385 Ga0501034_0155478 3300049571 Bacteria 2261
386 Ga0501042_0102889 3300049578 Bacteria 2055
387 Ga0501043_0000053 3300049579 Bacteria 106085
388 Ga0501046_0001410 3300049580 Bacteria 23115
389 Ga0501047_0000020 3300049581 Bacteria 259377
390 Ga0501048_0000933 3300049582 Bacteria 21585
391 Ga0501072_0132554 3300049588 Bacteria 1987
392 Ga0501249_001320 3300049679 Bacteria 5161
393 Ga0501225_0005261 3300049705 Bacteria 3809
394 Ga0501262_000730 3300049759 Bacteria 3798
395 Ga0501045_0003120 3300049824 Bacteria 11332
396 nmdc:mga03683_1238_c1 3300050489 Bacteria 7551
397 nmdc:mga03683_4945_c1 3300050489 Bacteria 4459
398 nmdc:mga00v17_4436_c1 3300050491 Bacteria 7304
399 nmdc:mga0yw44_146914_c1 3300050492 Bacteria 1536
400 nmdc:mga0k408_23251_c1 3300050493 Bacteria 3495
401 nmdc:mga07m45_10784_c1 3300050496 Bacteria 4785
402 nmdc:mga07m45_16430_c1 3300050496 Bacteria 3962
403 nmdc:mga07m45_445_c1 3300050496 Bacteria 17245
404 nmdc:mga05p37_464611_c1 3300050507 Bacteria 1461
405 nmdc:mga09592_158812_c1 3300050508 Bacteria 1952
406 nmdc:mga0n895_139830_c1 3300050512 Bacteria 2449
407 nmdc:mga08x19_48901_c1 3300050514 Bacteria 2710
408 Ga0500643_012974 3300053087 Bacteria 2964
409 Ga0500651_0000037 3300053093 Bacteria 103433
410 Ga0500566_0049319 3300053094 Bacteria 2412
411 Ga0500562_001112 3300053108 Bacteria 6609
412 Ga0500562_006225 3300053108 Bacteria 3011
413 Ga0500562_015316 3300053108 Bacteria 1966
414 Ga0500569_027490 3300053109 Bacteria 1568
415 Ga0500571_000011 3300053110 Bacteria 77816
416 Ga0500593_001317 3300053117 Bacteria 8953
417 Ga0500595_000811 3300053119 Bacteria 18044
418 Ga0500607_000595 3300053121 Bacteria 34809
419 Ga0500618_000308 3300053125 Bacteria 36190
420 Ga0500618_002059 3300053125 Bacteria 8104
421 Ga0500626_021641 3300053128 Bacteria 2869
422 Ga0500655_002414 3300053133 Bacteria 3417
423 Ga0500658_0000235 3300053134 Bacteria 25856
424 Ga0500658_0002728 3300053134 Bacteria 6790
425 Ga0500559_0007106 3300053136 Bacteria 4991
426 Ga0500568_0002005 3300053139 Bacteria 12398
427 Ga0500574_010678 3300053141 Bacteria 2045
428 Ga0500616_0094159 3300053153 Bacteria 1476
429 Ga0500627_0007511 3300053158 Bacteria 3803
430 Ga0500634_0020927 3300053161 Bacteria 3541
431 Ga0500634_0077580 3300053161 Bacteria 1721
432 Ga0500638_002028 3300053162 Bacteria 6830
433 Ga0500636_0061711 3300053177 Bacteria 2187
434 Ga0500570_000097 3300053724 Bacteria 24774
435 Ga0500645_031501 3300053730 Bacteria 1593
436 2511248226 2511231003 Bacteria 5606035
437 2511386285 2511231026 Bacteria 5225445
438 2513229986 2513020051 Bacteria 6053213
439 2553003434 2551306416 Bacteria 6152985
440 2599624350 2599185214 Bacteria 8209958
441 2599672362 2599185226 Bacteria 8233575
442 2599681554 2599185227 Bacteria 8246414
443 2599693568 2599185229 Bacteria 8216126
444 2599740700 2599185239 Bacteria 8686614
445 2599748294 2599185240 Bacteria 7968121
446 2600210206 2599185355 Bacteria 7968906
447 2601666703 2600255292 Bacteria 6300551
448 2644160612 2643221628 Bacteria 5745828
449 2644328970 2643221658 Bacteria 6064537
450 2644397661 2643221672 Bacteria 6322190
451 2644468967 2643221683 Bacteria 5749203
452 2676745696 2675903129 Bacteria 7964495
453 2738719737 2738541277 Bacteria 7458140
454 2738879848 2738541307 Bacteria 8606193
455 2739240880 2738543012 Bacteria 7115078
456 2739249924 2738543013 Bacteria 5618633
457 2739278936 2738543019 Bacteria 7459457
458 2808967587 2808606384 Bacteria 8474373
459 2809002418 2808606390 Bacteria 8476311
460 2809009696 2808606391 Bacteria 8308166
461 2816472041 2816332133 Bacteria 7249298
462 2819541900 2818991436 Bacteria 5376622
463 2819594882 2818991445 Bacteria 4955017
464 2819596681 2818991446 Bacteria 7757362
465 2819614370 2818991449 Bacteria 5518009
466 2819636925 2818991452 Bacteria 8442785
467 2831267844 2831265667 Bacteria 7184833
468 2838060214 2838054893 Bacteria 7451788
469 2842327381 2842324504 Bacteria 9364110
470 2842352012 2842348783 Bacteria 9002918
471 2842458255 2842454564 Bacteria 8730687
472 2842677969 2842677519 Bacteria 5615038
473 2857548469 2857547612 Bacteria 6179999
474 2863427113 2863421361 Bacteria 7300805
475 2870073701 2870068957 Bacteria 8925310
476 2884811714 2884811622 Bacteria 5552861
477 2884838297 2884836552 Bacteria 5219991
478 2884854589 2884852848 Bacteria 5221161
479 2885084496 2885080285 Bacteria 6355622
480 2885199419 2885198086 Bacteria 7212419
481 2885213070 2885211737 Bacteria 7212420
482 2894772957 2894772417 Bacteria 5305674
483 2896156743 2896154374 Bacteria 5221518
484 2899931401 2899924645 Bacteria 7487985
485 2904445068 2904439833 Bacteria 5931679
486 2904450244 2904449895 Bacteria 6927402
487 2904456933 2904456579 Bacteria 6819253
488 2904534104 2904530477 Bacteria 5876334
489 2904544124 2904541872 Bacteria 8915136
490 2904571093 2904564687 Bacteria 7609577
491 2904578195 2904571731 Bacteria 7608790
492 2904589055 2904584206 Bacteria 6028872
493 2904590464 2904589729 Bacteria 6113573
494 2904603662 2904601388 Bacteria 5884906
495 2919046828 2919046199 Bacteria 5567169
496 2919080326 2919079590 Bacteria 5946433
497 2919463309 2919462493 Bacteria 5817112
498 2928037826 2928037797 Bacteria 7273642
499 2928046568 2928044640 Bacteria 7271509
500 2928054268 2928051484 Bacteria 7773759
501 2928066016 2928064002 Bacteria 7419480
502 2928076957 2928070936 Bacteria 8062541
503 2928087941 2928084124 Bacteria 7159212
504 2928119303 2928115317 Bacteria 6477646
505 2928158233 2928157003 Bacteria 7522202
506 2928167545 2928163908 Bacteria 7561269
507 2928177867 2928170801 Bacteria 8785406
508 2928542875 2928536128 Bacteria 7657547
509 2929162313 2929160207 Bacteria 9075316
510 2929520935 2929520902 Bacteria 6765052
511 2932413062 2932410948 Bacteria 6312192
512 2932420577 2932416698 Bacteria 6315112
513 2939632710 2939631187 Bacteria 6118131
514 2945913356 2945909444 Bacteria 7065066
515 2945948906 2945945610 Bacteria 5951079
516 2945973021 2945972063 Bacteria 6086495
517 2945974174 2945972063 Bacteria 6086495
518 2945984414 2945984333 Bacteria 7358892
519 2954773035 2954767861 Bacteria 5535784
520 2981996628 2981990288 Bacteria 7590678
521 642418493 641736154 Bacteria 7689995
522 8018850025 8018845410 Bacteria 8933938
523 8020942465 8020938398 Bacteria 7472757
524 8020954624 8020953355 Bacteria 7439080
525 8021123715 8021120328 Bacteria 8782274
526 Ga0105243_10004570
527 JGI24740J21852_10005833
528 JGI24739J22299_10011382
529 JGI24739J22299_10018561
530 JGI25155J39150_1000030
531 JGI25155J39150_1000203
532 JGI25156J39149_1000059
533 JGI25162J39368_1005172
534 JGI25154J39366_1000056
535 JGI25154J39366_1000273
536 JGI25157J39369_1000615
537 JGI25152J39213_1003511
538 JGI25150J39212_1001615
539 JGI25151J46595_10001428
540 JGI25153J46596_10007572
541 rootH1_10123316
542 rootH2_10221804
543 rootH1_10019511
544 JGI25160J50197_1000554
545 JGI25160J50197_1012213
546 JGI25161J50226_1003431
547 Ga0006562J51391_1102716
548 Ga0055538_1000002
549 Ga0055539_1000002
550 Ga0055533_1000004
551 Ga0055532_1000059
552 Ga0055532_1000199
553 Ga0055532_1000717
554 Ga0055525_1000002
555 Ga0055527_1000810
556 Ga0055535_1000535
557 Ga0055535_1000948
558 Ga0055542_1000560
559 Ga0055542_1000806
560 Ga0055529_1000801
561 Ga0055526_1000577
562 Ga0055537_1000394
563 Ga0055537_1000411
564 Ga0055524_1000537
565 Ga0055524_1002376
566 Ga0055536_1001872
567 Ga0055536_1006150
568 Ga0055536_1010039
569 Ga0055534_1000131
570 Ga0055534_1001204
571 Ga0055528_1000568
572 Ga0055528_1000629
573 Ga0055528_1015616
574 Ga0055530_10004520
575 Ga0055540_1000555
576 Ga0055540_1007122
577 Ga0055540_1007985
578 Ga0055540_1012938
579 Ga0055540_1016168
580 Ga0055531_10011417
581 Ga0055541_1000002
582 Ga0055543_1000371
583 Ga0055543_1007531
584 Ga0065165_1023435
585 Ga0065714_10068637
586 Ga0065704_10077202
587 Ga0070660_100000642
588 Ga0070674_100171240
589 Ga0070673_100135399
590 Ga0070659_100000301
591 Ga0070667_100153461
592 Ga0070714_100063727
593 Ga0070663_100000215
594 Ga0070662_100009397
595 Ga0070697_100054420
596 Ga0068853_100030422
597 Ga0070672_100304384
598 Ga0070686_100125377
599 Ga0070695_100009985
600 Ga0070696_100005600
601 Ga0068855_100105073
602 Ga0068855_100254800
603 Ga0070664_100062883
604 Ga0068854_100009221
605 Ga0068856_100061126
606 Ga0068856_100183666
607 Ga0068852_100001123
608 Ga0068852_100005851
609 Ga0068852_100161316
610 Ga0068851_10016681
611 Ga0081539_10000539
612 Ga0075365_10074298
613 Ga0075365_10133302
614 Ga0075362_10009225
615 Ga0075366_10015640
616 Ga0075366_10040157
617 Ga0075370_10009646
618 Ga0075370_10026273
619 Ga0075370_10127177
620 Ga0075436_100004775
621 Ga0075436_100037117
622 Ga0099826_10018596
623 Ga0105251_10037674
624 Ga0105250_10022688
625 Ga0105240_10000787
626 Ga0105240_10003701
627 Ga0105240_10007279
628 Ga0105240_10121567
629 Ga0105240_10123993
630 Ga0105240_10310942
631 Ga0114129_10152988
632 Ga0105243_10181848
633 Ga0105237_10015344
634 Ga0105238_10005545
635 Ga0105238_10023167
636 Ga0105239_10071083
637 Ga0105239_10306954
638 Ga0157373_10006492
639 Ga0157370_10008731
640 Ga0157369_10049761
641 Ga0157369_10055393
642 Ga0157369_10272837
643 Ga0163162_10042797
644 Ga0163162_10059083
645 Ga0157372_10266119
646 Ga0182008_10000139
647 Ga0182008_10000998
648 Ga0182008_10001824
649 Ga0182008_10005011
650 Ga0182008_10024549
651 Ga0182008_10093273
652 Ga0182006_1000010
653 Ga0182006_1008590
654 Ga0182006_1048993
655 Ga0182007_10000021
656 Ga0182007_10000383
657 Ga0182007_10005424
658 Ga0182007_10009478
659 Ga0182005_1000009
660 Ga0182005_1000361
661 Ga0183362_10003
662 Ga0163161_10011509
663 Ga0163161_10012165
664 Ga0163161_10016177
665 Ga0213872_10001060
666 Ga0209435_100032
667 Ga0209435_100111
668 Ga0209436_103849
669 Ga0209436_105762
670 Ga0209784_100002
671 Ga0209566_100003
672 Ga0209566_100503
673 Ga0209674_100004
674 Ga0209672_100145
675 Ga0209672_103456
676 Ga0209147_100109
677 Ga0209147_100201
678 Ga0209147_100258
679 Ga0209147_101536
680 Ga0209563_100006
681 Ga0209437_100261
682 Ga0209258_100190
683 Ga0209258_100350
684 Ga0209258_100556
685 Ga0207425_1000394
686 Ga0207425_1009497
687 Ga0209646_1000052
688 Ga0209646_1000113
689 Ga0209026_1000102
690 Ga0209026_1003192
691 Ga0209677_100003
692 Ga0209148_1000327
693 Ga0209148_1000589
694 Ga0209759_1000104
695 Ga0209759_1000303
696 Ga0209129_1000033
697 Ga0209129_1006735
698 Ga0209565_1000164
699 Ga0209565_1000188
700 Ga0209565_1007477
701 Ga0209565_1007562
702 Ga0209455_1000248
703 Ga0209455_1005766
704 Ga0209673_1000057
705 Ga0209673_1000185
706 Ga0209673_1000344
707 Ga0209673_1000411
708 Ga0209673_1014114
709 Ga0209673_1017713
710 Ga0209130_1000402
711 Ga0209130_1000663
712 Ga0209130_1001742
713 Ga0209130_1014734
714 Ga0209675_1000172
715 Ga0209675_1004172
716 Ga0209675_1007309
717 Ga0209676_1000179
718 Ga0209676_1000505
719 Ga0209676_1009118
720 Ga0209676_1011844
721 Ga0209676_1013053
722 Ga0209676_1022540
723 Ga0209025_1000244
724 Ga0209025_1000541
725 Ga0209025_1001083
726 Ga0209025_1013087
727 Ga0209564_1000317
728 Ga0209564_1000538
729 Ga0209564_1008883
730 Ga0209758_1000027
731 Ga0209758_1009169
732 Ga0209758_1011168
733 Ga0209050_1000172
734 Ga0209050_1011068
735 Ga0209050_1018599
736 Ga0209256_1000069
737 Ga0209256_1000261
738 Ga0209256_1016965
739 Ga0207426_1000027
740 Ga0207426_1000115
741 Ga0209051_1000025
742 Ga0209051_1000046
743 Ga0209051_1000183
744 Ga0209051_1000240
745 Ga0209051_1000331
746 Ga0209051_1010425
747 Ga0209051_1013459
748 Ga0209257_1000039
749 Ga0209257_1000410
750 Ga0209257_1000716
751 Ga0209257_1008249
752 Ga0209257_1010840
753 Ga0207656_10013906
754 Ga0207696_1033864
755 Ga0207655_1003427
756 Ga0207680_10086556
757 Ga0207647_10121018
758 Ga0207695_10000377
759 Ga0207695_10001940
760 Ga0207695_10003192
761 Ga0207695_10020180
762 Ga0207671_10034267
763 Ga0207671_10244871
764 Ga0207657_10000003
765 Ga0207681_10262386
766 Ga0207694_10033054
767 Ga0207694_10041863
768 Ga0207694_10105507
769 Ga0207687_10272316
770 Ga0207690_10000007
771 Ga0207706_10015133
772 Ga0207709_10000341
773 Ga0207709_10000705
774 Ga0207679_10000531
775 Ga0207667_10011408
776 Ga0207667_10015142
777 Ga0207667_10024478
778 Ga0207651_10107598
779 Ga0207658_10088057
780 Ga0207639_10054651
781 Ga0207678_10000792
782 Ga0207648_10198784
783 Ga0207683_10026080
784 Ga0207698_10001463
785 Ga0207698_10006782
786 Ga0209371_1000292
787 Ga0209282_1005897
788 Ga0268265_10090411
789 Ga0265319_1045668
790 Ga0307515_10000026
791 Ga0307515_10000132
792 Ga0307515_10003144
793 Ga0307515_10036691
794 Ga0307515_10145233
795 Ga0268256_1000255
796 Ga0316179_1091897
797 Ga0316183_1009761
798 Ga0307513_10016875
799 Ga0307408_100005473
800 Ga0307408_100156926
801 Ga0307514_10021962
802 Ga0307405_10048682
803 Ga0307405_10275199
804 Ga0307406_10000563
805 Ga0307412_10063494
806 Ga0307412_10131144
807 Ga0307414_10059682
808 Ga0307414_10190040
809 Ga0395899_0007757
810 Ga0395899_0046541
811 Ga0395899_0060359
812 Ga0395900_0007104
813 Ga0395900_0033785
814 Ga0395898_0005632
815 Ga0395898_0041621
816 Ga0395905_0189170
817 Ga0395901_0016202
818 Ga0395901_0027852
819 Ga0395901_0063807
820 Ga0395901_0309931
821 Ga0395901_0587631
822 Ga0436360_0945601
823 Ga0436361_0443921
824 Ga0439436_0012107
825 Ga0439465_0032357
826 Ga0439431_0006257
827 Ga0439433_0004365
828 Ga0439449_0002195
829 Ga0439452_014481
830 Ga0439462_0001878
831 Ga0450894_001918
832 Ga0450898_006192
833 Ga0439434_0002314
834 Ga0450918_002432
835 Ga0466965_0012361
836 Ga0466963_0016130
837 Ga0451576_0305095
838 Ga0495627_000342
839 Ga0495627_015031
840 Ga0495638_0008651
841 Ga0495651_0006540
842 Ga0495651_0077466
843 Ga0495650_0001133
844 Ga0495580_0004320
845 Ga0495607_0012464
846 Ga0495616_0000607
847 Ga0495631_0000086
848 Ga0495637_0043703
849 Ga0495643_0031117
850 Ga0495652_0105157
851 Ga0495654_0007379
852 Ga0495654_0057108
853 Ga0495654_0061431
854 Ga0495622_0015332
855 Ga0495633_0000751
856 Ga0495667_0097340
857 Ga0495668_0008641
858 Ga0495611_0041359
859 Ga0495625_0000416
860 Ga0495625_0000606
861 Ga0495625_0021343
862 Ga0495661_0074891
863 Ga0495588_0018285
864 Ga0495657_0190417
865 Ga0495669_0024465
866 Ga0495624_0033244
867 Ga0495671_0009027
868 Ga0495600_0122886
869 Ga0495660_0097066
870 Ga0495604_0012892
871 Ga0495672_0018732
872 Ga0495681_0000061
873 Ga0495686_0000044
874 Ga0495602_0025261
875 Ga0495602_0111793
876 Ga0495614_0020553
877 Ga0496101_0023970
878 Ga0496101_0120836
879 Ga0496102_0112308
880 Ga0496104_0110326
881 Ga0496105_0007279
882 Ga0496108_0119180
883 Ga0496110_0408691
884 Ga0496111_0102790
885 Ga0496111_0151420
886 Ga0496112_0000069
887 Ga0496114_0201424
888 Ga0496116_0003223
889 Ga0496116_0034141
890 Ga0496116_0038279
891 Ga0496116_0104016
892 Ga0496117_0000010
893 Ga0496118_0000009
894 Ga0496118_0026347
895 Ga0496119_0047083
896 Ga0496121_0002276
897 Ga0496121_0020373
898 Ga0496121_0022092
899 Ga0496121_0194880
900 Ga0496122_0000225
901 Ga0496122_0000890
902 Ga0496123_0000192
903 Ga0496123_0001424
904 Ga0496124_0047616
905 Ga0496125_0001640
906 Ga0496125_0008898
907 Ga0496125_0050396
908 Ga0496125_0052377
909 Ga0496126_0018925
910 Ga0501034_0155478
911 Ga0501042_0102889
912 Ga0501043_0000053
913 Ga0501046_0001410
914 Ga0501047_0000020
915 Ga0501048_0000933
916 Ga0501072_0132554
917 Ga0501249_001320
918 Ga0501225_0005261
919 Ga0501262_000730
920 Ga0501045_0003120
921 nmdc:mga03683_1238_c1
922 nmdc:mga03683_4945_c1
923 nmdc:mga00v17_4436_c1
924 nmdc:mga0yw44_146914_c1
925 nmdc:mga0k408_23251_c1
926 nmdc:mga07m45_10784_c1
927 nmdc:mga07m45_16430_c1
928 nmdc:mga07m45_445_c1
929 nmdc:mga05p37_464611_c1
930 nmdc:mga09592_158812_c1
931 nmdc:mga0n895_139830_c1
932 nmdc:mga08x19_48901_c1
933 Ga0500643_012974
934 Ga0500651_0000037
935 Ga0500566_0049319
936 Ga0500562_001112
937 Ga0500562_006225
938 Ga0500562_015316
939 Ga0500569_027490
940 Ga0500571_000011
941 Ga0500593_001317
942 Ga0500595_000811
943 Ga0500607_000595
944 Ga0500618_000308
945 Ga0500618_002059
946 Ga0500626_021641
947 Ga0500655_002414
948 Ga0500658_0000235
949 Ga0500658_0002728
950 Ga0500559_0007106
951 Ga0500568_0002005
952 Ga0500574_010678
953 Ga0500616_0094159
954 Ga0500627_0007511
955 Ga0500634_0020927
956 Ga0500634_0077580
957 Ga0500638_002028
958 Ga0500636_0061711
959 Ga0500570_000097
960 Ga0500645_031501
961 2511248226
962 2511386285
963 2513229986
964 2553003434
965 2599624350
966 2599672362
967 2599681554
968 2599693568
969 2599740700
970 2599748294
971 2600210206
972 2601666703
973 2644160612
974 2644328970
975 2644397661
976 2644468967
977 2676745696
978 2738719737
979 2738879848
980 2739240880
981 2739249924
982 2739278936
983 2808967587
984 2809002418
985 2809009696
986 2816472041
987 2819541900
988 2819594882
989 2819596681
990 2819614370
991 2819636925
992 2831267844
993 2838060214
994 2842327381
995 2842352012
996 2842458255
997 2842677969
998 2857548469
999 2863427113
1000 2870073701
1001 2884811714
1002 2884838297
1003 2884854589
1004 2885084496
1005 2885199419
1006 2885213070
1007 2894772957
1008 2896156743
1009 2899931401
1010 2904445068
1011 2904450244
1012 2904456933
1013 2904534104
1014 2904544124
1015 2904571093
1016 2904578195
1017 2904589055
1018 2904590464
1019 2904603662
1020 2919046828
1021 2919080326
1022 2919463309
1023 2928037826
1024 2928046568
1025 2928054268
1026 2928066016
1027 2928076957
1028 2928087941
1029 2928119303
1030 2928158233
1031 2928167545
1032 2928177867
1033 2928542875
1034 2929162313
1035 2929520935
1036 2932413062
1037 2932420577
1038 2939632710
1039 2945913356
1040 2945948906
1041 2945973021
1042 2945974174
1043 2945984414
1044 2954773035
1045 2981996628
1046 642418493
1047 8018850025
1048 8020942465
1049 8020954624
1050 8021123715

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

50

374

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gxw-assembly2.cif.gz_B crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn 0.9791 12 357
4gxw-assembly2.cif.gz_B crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn 0.9285 12 357
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9204 21 334
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9201 23 353
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9147 23 353
ID Description Score Start End Superfamily
4gxwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9791 12 357 3.20.20.140
af_Q9P6J8_2_337_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9309 17 353 3.20.20.140
4gxwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9285 12 357 3.20.20.140
af_Q9P6J8_2_337_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9202 17 353 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9201 23 353 3.20.20.140
ID Description Score Start End GO Terms
AF-R7XG19-F1-model_v4 Adenosine deaminase 0.9943 165 345 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A6N9BHG0-F1-model_v4 Adenosine deaminase 0.9922 179 357 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A448YGW7-F1-model_v4 DEKNAAC101076 0.9912 17 352 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A645IIS5-F1-model_v4 Adenine deaminase (EC 3.5.4.2) 0.9895 231 357 GO:0000034
AF-R6A0M8-F1-model_v4 Putative adenosine deaminase 0.9891 82 359 GO:0000034
GO:0005829
GO:0006146
GO:0043103

Map