F459262

General Info

Members Datasets Scaffolds Average Seq Length
525 266 1050 416

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10124436|Ga0105242_101244362
Length 453
Sequence VQVLNFALALAKSSCCFVFKIDLFNPGHKNNMKASTRGRVKIKRFFSILGPGLVTGASDDDPSGIATYSQAGAQFGIATLWTALITFPLMAAVQEMCARIGIVTSQGLTSTIRNNYPRPVLYIIIALTFPAVILNIGADIAGMGAVANLIFPAVHPIFFTVAFTFILMVLIIYLPYQKIAAILKYLCIFLLLYLVVPFLSKQDWLDILKHTFVPTVHLNKAFIGILVAILGTTISPYLFFWQATMEAEDQQHKKRKLVVNKRIIHKMDLDVDFGMLFSNIVMFFIILTAGTVLHNSGIRQIDTVEQAAKALEPVAGKLAYQLFAIGVLGTGLLAIPVLSGSLSYMLSDTFGWGGNLDKKYYEAKPFYWVIIISLIIGLGINYLGISPIQALIYTSILYGITSPVLIAVILHVSNNKKIMGGFTNGKWSNILGCITLVLMTAAACTLLYFQFKG

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
94 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
158 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
259 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
260 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
261 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
262 2914759650 Rhizosphaericola mali Isolate Rhizosphere
263 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
264 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
265 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
266 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 0.57
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10124436 3300009176 Bacteria 2218
2 JGI24740J21852_10005045 3300001979 Bacteria 5607
3 JGI25162J39368_1000046 3300002737 Bacteria 169695
4 JGI25154J39366_1000016 3300002738 Bacteria 255057
5 rootH1_10036836 3300003316 Unclassified 2998
6 rootH1_10052212 3300003316 Bacteria 9725
7 rootH1_10160141 3300003316 Bacteria 2246
8 rootH2_10005192 3300003320 Bacteria 30420
9 rootH2_10133397 3300003320 Unclassified 2993
10 rootL2_10024198 3300003322 Bacteria 3542
11 rootL2_10124837 3300003322 Bacteria 2638
12 rootH1_10011789 3300003323 Bacteria 124621
13 rootH1_10025617 3300003323 Bacteria 4977
14 rootH1_10071014 3300003323 Bacteria 6457
15 rootH1_10122889 3300003323 Bacteria 6771
16 rootH1_10289623 3300003323 Bacteria 2353
17 JGI25160J50197_1004864 3300003354 Bacteria 5720
18 Ga0055535_1002736 3300003761 Bacteria 5679
19 Ga0065712_10000853 3300005290 Bacteria 8590
20 Ga0070658_10012491 3300005327 Bacteria 6814
21 Ga0070658_10124481 3300005327 Bacteria 2145
22 Ga0070683_100085077 3300005329 Bacteria 2964
23 Ga0070690_100017902 3300005330 Bacteria 4271
24 Ga0070670_100081108 3300005331 Unclassified 2788
25 Ga0070670_100203315 3300005331 Bacteria 1721
26 Ga0070670_100230979 3300005331 Bacteria 1610
27 Ga0068869_100004103 3300005334 Bacteria 9024
28 Ga0068869_100040291 3300005334 Bacteria 3340
29 Ga0070666_10006658 3300005335 Bacteria 7104
30 Ga0070666_10016644 3300005335 Unclassified 4705
31 Ga0070666_10147434 3300005335 Bacteria 1641
32 Ga0070680_100005777 3300005336 Bacteria 9391
33 Ga0070680_100188428 3300005336 Bacteria 1738
34 Ga0070682_100000044 3300005337 Bacteria 133653
35 Ga0070682_100055890 3300005337 Bacteria 2481
36 Ga0068868_100004562 3300005338 Bacteria 9723
37 Ga0068868_100037277 3300005338 Bacteria 3768
38 Ga0068868_100065260 3300005338 Bacteria 2892
39 Ga0068868_100193686 3300005338 Bacteria 1691
40 Ga0070689_100024974 3300005340 Bacteria 4485
41 Ga0070661_100069081 3300005344 Bacteria 2597
42 Ga0070668_100018484 3300005347 Bacteria 5233
43 Ga0070669_100234259 3300005353 Bacteria 1456
44 Ga0070671_100013350 3300005355 Bacteria 6621
45 Ga0070671_100067357 3300005355 Bacteria 2985
46 Ga0070671_100137679 3300005355 Bacteria 2059
47 Ga0070659_100023554 3300005366 Unclassified 4713
48 Ga0070659_100030049 3300005366 Bacteria 4203
49 Ga0070659_100138129 3300005366 Bacteria 1983
50 Ga0070667_100006235 3300005367 Bacteria 9921
51 Ga0070667_100016560 3300005367 Bacteria 6101
52 Ga0070667_100075515 3300005367 Unclassified 2877
53 Ga0070701_10060408 3300005438 Bacteria 1996
54 Ga0070700_100095390 3300005441 Unclassified 1950
55 Ga0070663_100004297 3300005455 Bacteria 8343
56 Ga0070662_100006091 3300005457 Bacteria 7748
57 Ga0070681_10127478 3300005458 Bacteria 2478
58 Ga0068867_100006003 3300005459 Bacteria 8611
59 Ga0070685_10036922 3300005466 Bacteria 2764
60 Ga0070706_100291078 3300005467 Bacteria 1524
61 Ga0070698_100000965 3300005471 Bacteria 31529
62 Ga0070698_100010578 3300005471 Bacteria 9833
63 Ga0070698_100018700 3300005471 Bacteria 7294
64 Ga0070679_100113333 3300005530 Bacteria 2697
65 Ga0070684_100007071 3300005535 Bacteria 8726
66 Ga0070684_100107562 3300005535 Bacteria 2498
67 Ga0068853_100027829 3300005539 Bacteria 4753
68 Ga0068853_100089691 3300005539 Bacteria 2701
69 Ga0068853_100108201 3300005539 Bacteria 2466
70 Ga0068853_100140806 3300005539 Bacteria 2165
71 Ga0068853_100145150 3300005539 Bacteria 2132
72 Ga0070672_100050413 3300005543 Bacteria 3241
73 Ga0070672_100246699 3300005543 Bacteria 1503
74 Ga0070686_100041578 3300005544 Bacteria 2874
75 Ga0070665_100000031 3300005548 Bacteria 333365
76 Ga0070665_100001604 3300005548 Bacteria 26025
77 Ga0070665_100009726 3300005548 Bacteria 9721
78 Ga0068855_100006093 3300005563 Bacteria 14708
79 Ga0068855_100012369 3300005563 Bacteria 10309
80 Ga0068855_100034944 3300005563 Bacteria 5990
81 Ga0068855_100040421 3300005563 Bacteria 5535
82 Ga0068855_100049935 3300005563 Bacteria 4932
83 Ga0068855_100142712 3300005563 Unclassified 2728
84 Ga0070664_100039923 3300005564 Unclassified 3957
85 Ga0070664_100077781 3300005564 Bacteria 2853
86 Ga0068857_100000697 3300005577 Bacteria 24969
87 Ga0068857_100013784 3300005577 Bacteria 7042
88 Ga0068854_100014269 3300005578 Bacteria 5234
89 Ga0068854_100029837 3300005578 Bacteria 3779
90 Ga0068856_100007044 3300005614 Bacteria 10983
91 Ga0068856_100044869 3300005614 Bacteria 4351
92 Ga0068856_100113296 3300005614 Bacteria 2710
93 Ga0068856_100276727 3300005614 Bacteria 1695
94 Ga0068852_100002245 3300005616 Bacteria 13263
95 Ga0068852_100004323 3300005616 Bacteria 10030
96 Ga0068852_100082712 3300005616 Bacteria 2853
97 Ga0068852_100154023 3300005616 Bacteria 2140
98 Ga0068859_100000012 3300005617 Bacteria 300376
99 Ga0068859_100015275 3300005617 Bacteria 7711
100 Ga0068859_100055472 3300005617 Bacteria 3987
101 Ga0068859_100256245 3300005617 Bacteria 1840
102 Ga0068864_100002123 3300005618 Bacteria 16390
103 Ga0068864_100254504 3300005618 Unclassified 1631
104 Ga0068864_100290137 3300005618 Bacteria 1529
105 Ga0068851_10001521 3300005834 Bacteria 10173
106 Ga0068870_10095406 3300005840 Unclassified 1671
107 Ga0068863_100004636 3300005841 Bacteria 13548
108 Ga0068863_100074144 3300005841 Bacteria 3219
109 Ga0068858_100003981 3300005842 Bacteria 14582
110 Ga0068858_100012915 3300005842 Bacteria 7875
111 Ga0068858_100145367 3300005842 Bacteria 2227
112 Ga0068860_100000072 3300005843 Bacteria 174997
113 Ga0068860_100002371 3300005843 Bacteria 19784
114 Ga0068860_100006064 3300005843 Bacteria 12167
115 Ga0068860_100038917 3300005843 Bacteria 4549
116 Ga0068862_100006143 3300005844 Bacteria 9996
117 Ga0068862_100179091 3300005844 Unclassified 1901
118 Ga0081540_1003369 3300005983 Bacteria 12666
119 Ga0070717_10157567 3300006028 Bacteria 1968
120 Ga0075366_10010456 3300006195 Bacteria 5211
121 Ga0097621_100006903 3300006237 Bacteria 8079
122 Ga0097621_100041401 3300006237 Bacteria 3708
123 Ga0097621_100058223 3300006237 Unclassified 3161
124 Ga0097621_100070399 3300006237 Bacteria 2888
125 Ga0068871_100000737 3300006358 Bacteria 22233
126 Ga0068871_100013343 3300006358 Bacteria 6098
127 Ga0068871_100032988 3300006358 Bacteria 4095
128 Ga0068871_100060893 3300006358 Unclassified 3080
129 Ga0068871_100086313 3300006358 Bacteria 2607
130 Ga0068871_100269906 3300006358 Bacteria 1486
131 Ga0075428_100007967 3300006844 Bacteria 11752
132 Ga0075428_100129367 3300006844 Bacteria 2747
133 Ga0075430_100155797 3300006846 Bacteria 1902
134 Ga0075431_100269718 3300006847 Bacteria 1725
135 Ga0075429_100006484 3300006880 Bacteria 10137
136 Ga0068865_100085899 3300006881 Unclassified 2270
137 Ga0068865_100177730 3300006881 Bacteria 1637
138 Ga0097620_100000012 3300006931 Bacteria 300376
139 Ga0097620_100015275 3300006931 Bacteria 7711
140 Ga0097620_100055467 3300006931 Bacteria 3987
141 Ga0097620_100256234 3300006931 Bacteria 1840
142 Ga0105240_10000011 3300009093 Bacteria 523646
143 Ga0105240_10000100 3300009093 Bacteria 176640
144 Ga0105240_10000319 3300009093 Bacteria 91429
145 Ga0105240_10007530 3300009093 Bacteria 15793
146 Ga0105240_10009710 3300009093 Bacteria 13586
147 Ga0105240_10015435 3300009093 Bacteria 10386
148 Ga0105240_10041200 3300009093 Bacteria 5897
149 Ga0105240_10315718 3300009093 Unclassified 1783
150 Ga0111539_10065798 3300009094 Bacteria 4282
151 Ga0111539_10120492 3300009094 Bacteria 3074
152 Ga0111539_10172101 3300009094 Unclassified 2530
153 Ga0111539_10574902 3300009094 Bacteria 1312
154 Ga0105245_10096582 3300009098 Unclassified 2727
155 Ga0105247_10035764 3300009101 Bacteria 3029
156 Ga0114129_10110056 3300009147 Bacteria 3802
157 Ga0105241_10002514 3300009174 Bacteria 13768
158 Ga0105241_10004826 3300009174 Bacteria 9936
159 Ga0105241_10009603 3300009174 Bacteria 7112
160 Ga0105241_10012031 3300009174 Bacteria 6356
161 Ga0105241_10121574 3300009174 Bacteria 2103
162 Ga0105242_10044006 3300009176 Bacteria 3613
163 Ga0105242_10058834 3300009176 Bacteria 3152
164 Ga0105242_10079329 3300009176 Bacteria 2742
165 Ga0105242_10165000 3300009176 Bacteria 1942
166 Ga0105248_10306905 3300009177 Bacteria 1787
167 Ga0105248_10308066 3300009177 Bacteria 1783
168 Ga0105237_10000256 3300009545 Bacteria 75634
169 Ga0105237_10001107 3300009545 Bacteria 36103
170 Ga0105237_10001705 3300009545 Bacteria 28418
171 Ga0105237_10003457 3300009545 Bacteria 18748
172 Ga0105237_10006687 3300009545 Bacteria 12743
173 Ga0105237_10046780 3300009545 Bacteria 4351
174 Ga0105237_10146708 3300009545 Bacteria 2354
175 Ga0105237_10206312 3300009545 Bacteria 1965
176 Ga0105237_10206410 3300009545 Bacteria 1965
177 Ga0105238_10084732 3300009551 Bacteria 3159
178 Ga0105238_10134033 3300009551 Unclassified 2455
179 Ga0105249_10003245 3300009553 Bacteria 14094
180 Ga0105249_10006757 3300009553 Bacteria 9995
181 Ga0105249_10047239 3300009553 Bacteria 3922
182 Ga0105249_10100591 3300009553 Bacteria 2718
183 Ga0105249_10139141 3300009553 Bacteria 2326
184 Ga0105239_10000176 3300010375 Bacteria 92577
185 Ga0105239_10001802 3300010375 Bacteria 28139
186 Ga0105239_10023740 3300010375 Bacteria 6752
187 Ga0105239_10024961 3300010375 Bacteria 6584
188 Ga0105239_10038296 3300010375 Bacteria 5254
189 Ga0105239_10071322 3300010375 Bacteria 3817
190 Ga0105239_10101177 3300010375 Bacteria 3188
191 Ga0105239_10114888 3300010375 Bacteria 2986
192 Ga0105239_10124651 3300010375 Bacteria 2862
193 Ga0105239_10147418 3300010375 Bacteria 2626
194 Ga0105239_10383440 3300010375 Bacteria 1589
195 Ga0105246_10069887 3300011119 Bacteria 2468
196 Ga0105246_10073579 3300011119 Unclassified 2413
197 Ga0157373_10004048 3300013100 Bacteria 11044
198 Ga0157373_10007633 3300013100 Bacteria 8033
199 Ga0157373_10028684 3300013100 Unclassified 4014
200 Ga0157373_10130317 3300013100 Unclassified 1769
201 Ga0157371_10003427 3300013102 Bacteria 14396
202 Ga0157371_10106257 3300013102 Bacteria 1992
203 Ga0157371_10110133 3300013102 Bacteria 1955
204 Ga0157370_10012521 3300013104 Bacteria 8793
205 Ga0157369_10000742 3300013105 Bacteria 42082
206 Ga0157369_10015108 3300013105 Bacteria 8713
207 Ga0157369_10027556 3300013105 Bacteria 6296
208 Ga0157369_10107283 3300013105 Bacteria 2971
209 Ga0157374_10005877 3300013296 Bacteria 10366
210 Ga0157374_10048822 3300013296 Bacteria 3928
211 Ga0157374_10060745 3300013296 Bacteria 3538
212 Ga0157374_10105853 3300013296 Bacteria 2702
213 Ga0157378_10003535 3300013297 Bacteria 13847
214 Ga0157378_10004919 3300013297 Bacteria 11710
215 Ga0157378_10061863 3300013297 Bacteria 3343
216 Ga0157378_10102262 3300013297 Bacteria 2617
217 Ga0157378_10136684 3300013297 Bacteria 2273
218 Ga0157378_10205006 3300013297 Unclassified 1867
219 Ga0157378_10267236 3300013297 Bacteria 1643
220 Ga0163162_10000140 3300013306 Bacteria 65811
221 Ga0163162_10001646 3300013306 Bacteria 20940
222 Ga0163162_10004336 3300013306 Bacteria 13656
223 Ga0163162_10009385 3300013306 Bacteria 9517
224 Ga0163162_10014680 3300013306 Bacteria 7655
225 Ga0163162_10074681 3300013306 Unclassified 3449
226 Ga0163162_10102461 3300013306 Bacteria 2956
227 Ga0163162_10112283 3300013306 Unclassified 2824
228 Ga0163162_10117717 3300013306 Bacteria 2758
229 Ga0163162_10134747 3300013306 Bacteria 2580
230 Ga0157372_10000048 3300013307 Bacteria 142757
231 Ga0157372_10001517 3300013307 Bacteria 25239
232 Ga0157372_10003940 3300013307 Bacteria 15946
233 Ga0157372_10008533 3300013307 Bacteria 10879
234 Ga0157372_10018325 3300013307 Bacteria 7525
235 Ga0157372_10107012 3300013307 Bacteria 3199
236 Ga0157372_10116201 3300013307 Bacteria 3068
237 Ga0157375_10006874 3300013308 Bacteria 9923
238 Ga0157375_10029284 3300013308 Bacteria 5176
239 Ga0157375_10099478 3300013308 Unclassified 2987
240 Ga0157375_10154262 3300013308 Bacteria 2434
241 Ga0157375_10161077 3300013308 Bacteria 2385
242 Ga0163163_10000407 3300014325 Bacteria 40536
243 Ga0163163_10002931 3300014325 Bacteria 14436
244 Ga0163163_10224338 3300014325 Bacteria 1928
245 Ga0157380_10000068 3300014326 Bacteria 58289
246 Ga0157380_10013195 3300014326 Bacteria 6016
247 Ga0157380_10081207 3300014326 Bacteria 2651
248 Ga0157379_10121216 3300014968 Bacteria 2352
249 Ga0157379_10162617 3300014968 Unclassified 2015
250 Ga0157376_10012138 3300014969 Bacteria 6382
251 Ga0157376_10025569 3300014969 Bacteria 4652
252 Ga0157376_10038993 3300014969 Bacteria 3870
253 Ga0157376_10060121 3300014969 Bacteria 3189
254 Ga0183373_1003 3300015682 Bacteria 558813
255 Ga0183365_10004 3300015684 Bacteria 333304
256 Ga0163161_10000823 3300017792 Bacteria 24283
257 Ga0163161_10033293 3300017792 Bacteria 3683
258 Ga0209437_100070 3300025233 Bacteria 306718
259 Ga0209258_100159 3300025242 Bacteria 155141
260 Ga0207425_1017189 3300025245 Bacteria 1594
261 Ga0209646_1000003 3300025246 Bacteria 1160860
262 Ga0209646_1000746 3300025246 Bacteria 11373
263 Ga0209026_1000202 3300025250 Bacteria 82517
264 Ga0209026_1003860 3300025250 Bacteria 4726
265 Ga0209148_1000156 3300025254 Bacteria 142889
266 Ga0209758_1013892 3300025297 Unclassified 4340
267 Ga0207426_1001047 3300025302 Bacteria 26255
268 Ga0207656_10000641 3300025321 Bacteria 11433
269 Ga0207656_10003051 3300025321 Bacteria 5722
270 Ga0207656_10051422 3300025321 Unclassified 1782
271 Ga0207682_10019689 3300025893 Bacteria 2644
272 Ga0207680_10000031 3300025903 Bacteria 77871
273 Ga0207680_10025221 3300025903 Unclassified 3277
274 Ga0207647_10000347 3300025904 Bacteria 37523
275 Ga0207647_10001274 3300025904 Bacteria 19392
276 Ga0207645_10000542 3300025907 Bacteria 31431
277 Ga0207645_10008116 3300025907 Bacteria 7358
278 Ga0207643_10011962 3300025908 Unclassified 4686
279 Ga0207705_10255641 3300025909 Bacteria 1337
280 Ga0207654_10002706 3300025911 Bacteria 8996
281 Ga0207654_10007850 3300025911 Bacteria 5380
282 Ga0207654_10015076 3300025911 Bacteria 4003
283 Ga0207654_10023653 3300025911 Bacteria 3294
284 Ga0207654_10123716 3300025911 Bacteria 1628
285 Ga0207707_10002565 3300025912 Bacteria 16286
286 Ga0207695_10000010 3300025913 Bacteria 981919
287 Ga0207695_10000027 3300025913 Bacteria 612456
288 Ga0207695_10011387 3300025913 Bacteria 10781
289 Ga0207695_10024762 3300025913 Bacteria 6740
290 Ga0207695_10076180 3300025913 Bacteria 3411
291 Ga0207695_10090010 3300025913 Bacteria 3085
292 Ga0207695_10113424 3300025913 Unclassified 2687
293 Ga0207695_10115455 3300025913 Bacteria 2659
294 Ga0207671_10000067 3300025914 Bacteria 162184
295 Ga0207671_10000730 3300025914 Bacteria 41672
296 Ga0207671_10001908 3300025914 Bacteria 23135
297 Ga0207671_10002014 3300025914 Bacteria 22347
298 Ga0207671_10007673 3300025914 Bacteria 9317
299 Ga0207671_10015552 3300025914 Bacteria 5952
300 Ga0207671_10150228 3300025914 Bacteria 1799
301 Ga0207671_10162927 3300025914 Bacteria 1728
302 Ga0207660_10008582 3300025917 Bacteria 6611
303 Ga0207662_10043611 3300025918 Bacteria 2646
304 Ga0207649_10001036 3300025920 Bacteria 17088
305 Ga0207652_10014719 3300025921 Bacteria 6339
306 Ga0207681_10024417 3300025923 Unclassified 3880
307 Ga0207694_10031636 3300025924 Bacteria 4044
308 Ga0207694_10112734 3300025924 Unclassified 2164
309 Ga0207650_10111263 3300025925 Unclassified 2120
310 Ga0207659_10016338 3300025926 Bacteria 4828
311 Ga0207659_10109060 3300025926 Bacteria 2101
312 Ga0207659_10249120 3300025926 Bacteria 1441
313 Ga0207644_10035378 3300025931 Unclassified 3499
314 Ga0207690_10026989 3300025932 Unclassified 3624
315 Ga0207706_10004070 3300025933 Bacteria 13820
316 Ga0207686_10014112 3300025934 Bacteria 4439
317 Ga0207686_10159257 3300025934 Bacteria 1580
318 Ga0207670_10005273 3300025936 Bacteria 7078
319 Ga0207670_10023522 3300025936 Bacteria 3837
320 Ga0207704_10081839 3300025938 Unclassified 2090
321 Ga0207691_10101662 3300025940 Bacteria 2565
322 Ga0207689_10003365 3300025942 Bacteria 14638
323 Ga0207689_10063393 3300025942 Bacteria 3041
324 Ga0207689_10175789 3300025942 Bacteria 1765
325 Ga0207661_10279866 3300025944 Bacteria 1491
326 Ga0207667_10005062 3300025949 Bacteria 16104
327 Ga0207667_10006552 3300025949 Bacteria 14084
328 Ga0207667_10010151 3300025949 Bacteria 11030
329 Ga0207667_10023006 3300025949 Bacteria 6870
330 Ga0207651_10022577 3300025960 Bacteria 3851
331 Ga0207712_10003064 3300025961 Bacteria 10667
332 Ga0207712_10003234 3300025961 Bacteria 10351
333 Ga0207712_10061500 3300025961 Unclassified 2665
334 Ga0207668_10078491 3300025972 Unclassified 2384
335 Ga0207640_10108851 3300025981 Unclassified 1959
336 Ga0207640_10139635 3300025981 Bacteria 1764
337 Ga0207640_10166797 3300025981 Bacteria 1636
338 Ga0207658_10001199 3300025986 Bacteria 20672
339 Ga0207658_10017731 3300025986 Bacteria 4907
340 Ga0207658_10020810 3300025986 Bacteria 4545
341 Ga0207658_10025403 3300025986 Bacteria 4149
342 Ga0207677_10070042 3300026023 Unclassified 2469
343 Ga0207677_10112147 3300026023 Unclassified 2033
344 Ga0207703_10009965 3300026035 Bacteria 7453
345 Ga0207639_10035170 3300026041 Bacteria 3706
346 Ga0207639_10094138 3300026041 Bacteria 2404
347 Ga0207678_10027997 3300026067 Bacteria 4921
348 Ga0207708_10094803 3300026075 Unclassified 2304
349 Ga0207702_10031068 3300026078 Bacteria 4452
350 Ga0207702_10050474 3300026078 Bacteria 3513
351 Ga0207641_10000048 3300026088 Bacteria 178206
352 Ga0207641_10008548 3300026088 Bacteria 8457
353 Ga0207641_10027604 3300026088 Bacteria 4688
354 Ga0207641_10031708 3300026088 Bacteria 4384
355 Ga0207648_10046869 3300026089 Unclassified 3789
356 Ga0207648_10065383 3300026089 Bacteria 3171
357 Ga0207648_10078126 3300026089 Bacteria 2887
358 Ga0207648_10119285 3300026089 Unclassified 2318
359 Ga0207676_10013618 3300026095 Bacteria 5838
360 Ga0207674_10000487 3300026116 Bacteria 52391
361 Ga0207674_10013017 3300026116 Bacteria 9268
362 Ga0207675_100018877 3300026118 Bacteria 6435
363 Ga0207675_100045784 3300026118 Bacteria 4087
364 Ga0207683_10003268 3300026121 Bacteria 14130
365 Ga0207683_10308275 3300026121 Bacteria 1449
366 Ga0207683_10309274 3300026121 Unclassified 1446
367 Ga0207698_10007703 3300026142 Bacteria 6756
368 Ga0207698_10031428 3300026142 Bacteria 3832
369 Ga0268266_10000088 3300028379 Bacteria 199029
370 Ga0268266_10001424 3300028379 Bacteria 28538
371 Ga0268266_10083145 3300028379 Unclassified 2794
372 Ga0268265_10012870 3300028380 Bacteria 5678
373 Ga0268264_10000201 3300028381 Bacteria 122060
374 Ga0268264_10003372 3300028381 Bacteria 13801
375 Ga0268264_10006728 3300028381 Bacteria 9660
376 Ga0268264_10091484 3300028381 Bacteria 2624
377 Ga0265319_1003241 3300028563 Bacteria 8565
378 Ga0265334_10000602 3300028573 Bacteria 18167
379 Ga0265318_10002173 3300028577 Bacteria 10628
380 Ga0265322_10000143 3300028654 Bacteria 33417
381 Ga0265336_10000991 3300028666 Bacteria 13994
382 Ga0265336_10012918 3300028666 Bacteria 2796
383 Ga0265338_10003310 3300028800 Bacteria 22826
384 Ga0265338_10042158 3300028800 Bacteria 4256
385 Ga0265324_10020522 3300029957 Bacteria 2373
386 Ga0265330_10012178 3300031235 Unclassified 4024
387 Ga0265320_10007117 3300031240 Bacteria 6975
388 Ga0265340_10014462 3300031247 Bacteria 4119
389 Ga0265327_10000055 3300031251 Bacteria 247188
390 Ga0265327_10000368 3300031251 Bacteria 85604
391 Ga0265327_10003723 3300031251 Bacteria 14194
392 Ga0265327_10014414 3300031251 Bacteria 5173
393 Ga0265327_10061068 3300031251 Unclassified 1924
394 Ga0265316_10021419 3300031344 Bacteria 5474
395 Ga0265316_10037463 3300031344 Bacteria 3913
396 Ga0265316_10078079 3300031344 Bacteria 2542
397 Ga0265316_10149644 3300031344 Bacteria 1749
398 Ga0307509_10034551 3300031507 Bacteria 5555
399 Ga0265313_10054808 3300031595 Bacteria 1891
400 Ga0307508_10003562 3300031616 Bacteria 15680
401 Ga0307508_10030681 3300031616 Bacteria 4859
402 Ga0307516_10003131 3300031730 Bacteria 21513
403 Ga0307516_10021590 3300031730 Bacteria 6620
404 Ga0373944_0013904 3300035089 Bacteria 2239
405 Ga0373936_0016512 3300035113 Bacteria 2840
406 Ga0373956_0041878 3300035119 Bacteria 2035
407 Ga0373946_0001073 3300035171 Bacteria 9421
408 Ga0373935_0035396 3300035692 Bacteria 3116
409 Ga0373927_0000413 3300035695 Bacteria 32824
410 Ga0373927_0010990 3300035695 Bacteria 6029
411 Ga0373947_0000599 3300035725 Bacteria 21255
412 Ga0373947_0041463 3300035725 Bacteria 2744
413 Ga0373937_0156005 3300036401 Bacteria 2139
414 Ga0373925_0037676 3300037068 Bacteria 3571
415 Ga0395899_0000522 3300037312 Bacteria 42283
416 Ga0395905_0006828 3300037471 Bacteria 11423
417 Ga0395905_0054490 3300037471 Bacteria 3743
418 Ga0436365_1837098 3300039437 Bacteria 29699
419 Ga0451807_0982136 3300041486 Bacteria 2817
420 Ga0451577_0000034 3300042876 Bacteria 376183
421 Ga0466969_0000556 3300044656 Bacteria 20505
422 Ga0466969_0000925 3300044656 Bacteria 15832
423 Ga0466972_0000120 3300044658 Bacteria 66494
424 Ga0466972_0013257 3300044658 Bacteria 4139
425 Ga0453683_0000057 3300044673 Bacteria 190239
426 Ga0466966_0000127 3300044684 Bacteria 48556
427 Ga0466966_0000393 3300044684 Bacteria 28294
428 Ga0466961_0002668 3300044693 Bacteria 11070
429 Ga0466963_0169316 3300044694 Bacteria 1522
430 Ga0453684_0000098 3300044712 Bacteria 376183
431 Ga0453684_0011148 3300044712 Bacteria 15154
432 Ga0453684_0051097 3300044712 Bacteria 5426
433 Ga0466971_0005111 3300044719 Bacteria 5682
434 Ga0466957_0029344 3300044842 Bacteria 3279
435 Ga0466959_0000083 3300045049 Bacteria 59623
436 Ga0466959_0009087 3300045049 Bacteria 7054
437 Ga0451576_0000036 3300045051 Bacteria 376183
438 Ga0451576_0000080 3300045051 Bacteria 242782
439 Ga0451576_0000739 3300045051 Bacteria 65393
440 Ga0466958_0006547 3300045836 Bacteria 6347
441 Ga0466958_0129372 3300045836 Bacteria 1585
442 Ga0495629_0038731 3300046459 Bacteria 3357
443 Ga0495653_0109366 3300046463 Bacteria 1989
444 Ga0495580_0026634 3300046472 Bacteria 4214
445 Ga0495662_0000683 3300046476 Bacteria 16037
446 Ga0495662_0010605 3300046476 Bacteria 4507
447 Ga0495664_0000090 3300046477 Bacteria 44350
448 Ga0495608_0036383 3300046511 Bacteria 3315
449 Ga0495618_0001865 3300046514 Bacteria 13891
450 Ga0495628_0045566 3300046516 Bacteria 3486
451 Ga0495630_0025881 3300046517 Bacteria 4341
452 Ga0495630_0045433 3300046517 Bacteria 3282
453 Ga0495648_0015330 3300046524 Bacteria 5571
454 Ga0495652_0125453 3300046529 Bacteria 2040
455 Ga0495665_0063320 3300046531 Bacteria 1952
456 Ga0495640_0014492 3300046533 Bacteria 5961
457 Ga0495621_0032213 3300046539 Bacteria 1801
458 Ga0495621_0053423 3300046539 Unclassified 1450
459 Ga0495621_0073294 3300046539 Unclassified 1265
460 Ga0495645_0010498 3300046543 Bacteria 6495
461 Ga0495634_0005829 3300046642 Bacteria 9402
462 Ga0495634_0007208 3300046642 Bacteria 8382
463 Ga0495611_0018429 3300046648 Bacteria 2994
464 Ga0495635_0010273 3300046663 Bacteria 6545
465 Ga0495635_0058775 3300046663 Bacteria 2645
466 Ga0495658_0016170 3300046683 Bacteria 3840
467 Ga0495669_0038164 3300046684 Bacteria 2127
468 Ga0495613_0020841 3300046689 Bacteria 4887
469 Ga0495624_0013454 3300046690 Bacteria 5579
470 Ga0495670_0015714 3300046691 Bacteria 3721
471 Ga0495600_0144390 3300046809 Bacteria 1543
472 Ga0495581_0001641 3300047315 Bacteria 12467
473 Ga0495674_0001316 3300047319 Bacteria 24174
474 Ga0495674_0097442 3300047319 Bacteria 2505
475 Ga0495672_0036494 3300047320 Bacteria 3018
476 Ga0495687_000010 3300047443 Bacteria 413735
477 Ga0495684_0031342 3300047471 Bacteria 4081
478 Ga0495593_0012267 3300047673 Bacteria 4898
479 Ga0496108_0087848 3300048911 Unclassified 2641
480 Ga0496114_0000414 3300048917 Bacteria 31641
481 Ga0501032_0010255 3300049569 Bacteria 6760
482 Ga0501034_0000043 3300049571 Bacteria 229049
483 Ga0501034_0046235 3300049571 Bacteria 4398
484 Ga0501034_0327558 3300049571 Bacteria 1464
485 Ga0501036_0047216 3300049572 Bacteria 3647
486 Ga0501039_0023050 3300049575 Bacteria 4776
487 Ga0501043_0001605 3300049579 Bacteria 19666
488 Ga0501043_0110255 3300049579 Bacteria 2161
489 Ga0501046_0001390 3300049580 Bacteria 23300
490 Ga0501047_0003344 3300049581 Bacteria 15194
491 Ga0501047_0021592 3300049581 Bacteria 6183
492 Ga0501048_0018277 3300049582 Bacteria 5157
493 Ga0501070_0029788 3300049586 Bacteria 4574
494 Ga0501073_0011587 3300049589 Bacteria 6445
495 Ga0501074_0005404 3300049590 Bacteria 9196
496 Ga0501077_0124194 3300049593 Bacteria 1636
497 Ga0501257_005232 3300049686 Bacteria 2855
498 Ga0501079_0025378 3300049741 Bacteria 4546
499 Ga0501035_0042329 3300049822 Bacteria 4108
500 Ga0501044_0005070 3300049823 Bacteria 14702
501 nmdc:mga0k408_8547_c1 3300050493 Bacteria 5499
502 nmdc:mga05p37_89356_c1 3300050507 Bacteria 3796
503 nmdc:mga09592_17647_c1 3300050508 Bacteria 5850
504 nmdc:mga06r32_268875_c1 3300050510 Bacteria 1692
505 nmdc:mga08y16_154716_c1 3300050511 Bacteria 2383
506 Ga0495601_0008643 3300053077 Bacteria 6010
507 Ga0495612_0000207 3300053078 Bacteria 25049
508 Ga0495619_0004861 3300053085 Bacteria 8526
509 Ga0495619_0091014 3300053085 Bacteria 2065
510 Ga0500578_0096752 3300053086 Bacteria 1871
511 Ga0500583_0029101 3300053092 Bacteria 2404
512 Ga0500608_000835 3300053122 Bacteria 11138
513 Ga0500622_0002993 3300053156 Bacteria 11711
514 Ga0500636_0021307 3300053177 Unclassified 3836
515 Ga0500636_0085756 3300053177 Bacteria 1809
516 Ga0466962_0003613 3300061719 Bacteria 7372
517 2520879243 2519899754 Bacteria 5336938
518 2819681215 2818991460 Bacteria 7595395
519 2884937100 2884933994 Bacteria 4535041
520 2902052750 2902048731 Bacteria 4976191
521 2914762263 2914759650 Bacteria 4701441
522 2929179330 2929177148 Bacteria 7883697
523 2929926284 2929921140 Bacteria 8649150
524 2946018857 2946013367 Bacteria 7766675
525 8003156576 8003151029 Bacteria 8187759
526 Ga0105242_10124436
527 JGI24740J21852_10005045
528 JGI25162J39368_1000046
529 JGI25154J39366_1000016
530 rootH1_10036836
531 rootH1_10052212
532 rootH1_10160141
533 rootH2_10005192
534 rootH2_10133397
535 rootL2_10024198
536 rootL2_10124837
537 rootH1_10011789
538 rootH1_10025617
539 rootH1_10071014
540 rootH1_10122889
541 rootH1_10289623
542 JGI25160J50197_1004864
543 Ga0055535_1002736
544 Ga0065712_10000853
545 Ga0070658_10012491
546 Ga0070658_10124481
547 Ga0070683_100085077
548 Ga0070690_100017902
549 Ga0070670_100081108
550 Ga0070670_100203315
551 Ga0070670_100230979
552 Ga0068869_100004103
553 Ga0068869_100040291
554 Ga0070666_10006658
555 Ga0070666_10016644
556 Ga0070666_10147434
557 Ga0070680_100005777
558 Ga0070680_100188428
559 Ga0070682_100000044
560 Ga0070682_100055890
561 Ga0068868_100004562
562 Ga0068868_100037277
563 Ga0068868_100065260
564 Ga0068868_100193686
565 Ga0070689_100024974
566 Ga0070661_100069081
567 Ga0070668_100018484
568 Ga0070669_100234259
569 Ga0070671_100013350
570 Ga0070671_100067357
571 Ga0070671_100137679
572 Ga0070659_100023554
573 Ga0070659_100030049
574 Ga0070659_100138129
575 Ga0070667_100006235
576 Ga0070667_100016560
577 Ga0070667_100075515
578 Ga0070701_10060408
579 Ga0070700_100095390
580 Ga0070663_100004297
581 Ga0070662_100006091
582 Ga0070681_10127478
583 Ga0068867_100006003
584 Ga0070685_10036922
585 Ga0070706_100291078
586 Ga0070698_100000965
587 Ga0070698_100010578
588 Ga0070698_100018700
589 Ga0070679_100113333
590 Ga0070684_100007071
591 Ga0070684_100107562
592 Ga0068853_100027829
593 Ga0068853_100089691
594 Ga0068853_100108201
595 Ga0068853_100140806
596 Ga0068853_100145150
597 Ga0070672_100050413
598 Ga0070672_100246699
599 Ga0070686_100041578
600 Ga0070665_100000031
601 Ga0070665_100001604
602 Ga0070665_100009726
603 Ga0068855_100006093
604 Ga0068855_100012369
605 Ga0068855_100034944
606 Ga0068855_100040421
607 Ga0068855_100049935
608 Ga0068855_100142712
609 Ga0070664_100039923
610 Ga0070664_100077781
611 Ga0068857_100000697
612 Ga0068857_100013784
613 Ga0068854_100014269
614 Ga0068854_100029837
615 Ga0068856_100007044
616 Ga0068856_100044869
617 Ga0068856_100113296
618 Ga0068856_100276727
619 Ga0068852_100002245
620 Ga0068852_100004323
621 Ga0068852_100082712
622 Ga0068852_100154023
623 Ga0068859_100000012
624 Ga0068859_100015275
625 Ga0068859_100055472
626 Ga0068859_100256245
627 Ga0068864_100002123
628 Ga0068864_100254504
629 Ga0068864_100290137
630 Ga0068851_10001521
631 Ga0068870_10095406
632 Ga0068863_100004636
633 Ga0068863_100074144
634 Ga0068858_100003981
635 Ga0068858_100012915
636 Ga0068858_100145367
637 Ga0068860_100000072
638 Ga0068860_100002371
639 Ga0068860_100006064
640 Ga0068860_100038917
641 Ga0068862_100006143
642 Ga0068862_100179091
643 Ga0081540_1003369
644 Ga0070717_10157567
645 Ga0075366_10010456
646 Ga0097621_100006903
647 Ga0097621_100041401
648 Ga0097621_100058223
649 Ga0097621_100070399
650 Ga0068871_100000737
651 Ga0068871_100013343
652 Ga0068871_100032988
653 Ga0068871_100060893
654 Ga0068871_100086313
655 Ga0068871_100269906
656 Ga0075428_100007967
657 Ga0075428_100129367
658 Ga0075430_100155797
659 Ga0075431_100269718
660 Ga0075429_100006484
661 Ga0068865_100085899
662 Ga0068865_100177730
663 Ga0097620_100000012
664 Ga0097620_100015275
665 Ga0097620_100055467
666 Ga0097620_100256234
667 Ga0105240_10000011
668 Ga0105240_10000100
669 Ga0105240_10000319
670 Ga0105240_10007530
671 Ga0105240_10009710
672 Ga0105240_10015435
673 Ga0105240_10041200
674 Ga0105240_10315718
675 Ga0111539_10065798
676 Ga0111539_10120492
677 Ga0111539_10172101
678 Ga0111539_10574902
679 Ga0105245_10096582
680 Ga0105247_10035764
681 Ga0114129_10110056
682 Ga0105241_10002514
683 Ga0105241_10004826
684 Ga0105241_10009603
685 Ga0105241_10012031
686 Ga0105241_10121574
687 Ga0105242_10044006
688 Ga0105242_10058834
689 Ga0105242_10079329
690 Ga0105242_10165000
691 Ga0105248_10306905
692 Ga0105248_10308066
693 Ga0105237_10000256
694 Ga0105237_10001107
695 Ga0105237_10001705
696 Ga0105237_10003457
697 Ga0105237_10006687
698 Ga0105237_10046780
699 Ga0105237_10146708
700 Ga0105237_10206312
701 Ga0105237_10206410
702 Ga0105238_10084732
703 Ga0105238_10134033
704 Ga0105249_10003245
705 Ga0105249_10006757
706 Ga0105249_10047239
707 Ga0105249_10100591
708 Ga0105249_10139141
709 Ga0105239_10000176
710 Ga0105239_10001802
711 Ga0105239_10023740
712 Ga0105239_10024961
713 Ga0105239_10038296
714 Ga0105239_10071322
715 Ga0105239_10101177
716 Ga0105239_10114888
717 Ga0105239_10124651
718 Ga0105239_10147418
719 Ga0105239_10383440
720 Ga0105246_10069887
721 Ga0105246_10073579
722 Ga0157373_10004048
723 Ga0157373_10007633
724 Ga0157373_10028684
725 Ga0157373_10130317
726 Ga0157371_10003427
727 Ga0157371_10106257
728 Ga0157371_10110133
729 Ga0157370_10012521
730 Ga0157369_10000742
731 Ga0157369_10015108
732 Ga0157369_10027556
733 Ga0157369_10107283
734 Ga0157374_10005877
735 Ga0157374_10048822
736 Ga0157374_10060745
737 Ga0157374_10105853
738 Ga0157378_10003535
739 Ga0157378_10004919
740 Ga0157378_10061863
741 Ga0157378_10102262
742 Ga0157378_10136684
743 Ga0157378_10205006
744 Ga0157378_10267236
745 Ga0163162_10000140
746 Ga0163162_10001646
747 Ga0163162_10004336
748 Ga0163162_10009385
749 Ga0163162_10014680
750 Ga0163162_10074681
751 Ga0163162_10102461
752 Ga0163162_10112283
753 Ga0163162_10117717
754 Ga0163162_10134747
755 Ga0157372_10000048
756 Ga0157372_10001517
757 Ga0157372_10003940
758 Ga0157372_10008533
759 Ga0157372_10018325
760 Ga0157372_10107012
761 Ga0157372_10116201
762 Ga0157375_10006874
763 Ga0157375_10029284
764 Ga0157375_10099478
765 Ga0157375_10154262
766 Ga0157375_10161077
767 Ga0163163_10000407
768 Ga0163163_10002931
769 Ga0163163_10224338
770 Ga0157380_10000068
771 Ga0157380_10013195
772 Ga0157380_10081207
773 Ga0157379_10121216
774 Ga0157379_10162617
775 Ga0157376_10012138
776 Ga0157376_10025569
777 Ga0157376_10038993
778 Ga0157376_10060121
779 Ga0183373_1003
780 Ga0183365_10004
781 Ga0163161_10000823
782 Ga0163161_10033293
783 Ga0209437_100070
784 Ga0209258_100159
785 Ga0207425_1017189
786 Ga0209646_1000003
787 Ga0209646_1000746
788 Ga0209026_1000202
789 Ga0209026_1003860
790 Ga0209148_1000156
791 Ga0209758_1013892
792 Ga0207426_1001047
793 Ga0207656_10000641
794 Ga0207656_10003051
795 Ga0207656_10051422
796 Ga0207682_10019689
797 Ga0207680_10000031
798 Ga0207680_10025221
799 Ga0207647_10000347
800 Ga0207647_10001274
801 Ga0207645_10000542
802 Ga0207645_10008116
803 Ga0207643_10011962
804 Ga0207705_10255641
805 Ga0207654_10002706
806 Ga0207654_10007850
807 Ga0207654_10015076
808 Ga0207654_10023653
809 Ga0207654_10123716
810 Ga0207707_10002565
811 Ga0207695_10000010
812 Ga0207695_10000027
813 Ga0207695_10011387
814 Ga0207695_10024762
815 Ga0207695_10076180
816 Ga0207695_10090010
817 Ga0207695_10113424
818 Ga0207695_10115455
819 Ga0207671_10000067
820 Ga0207671_10000730
821 Ga0207671_10001908
822 Ga0207671_10002014
823 Ga0207671_10007673
824 Ga0207671_10015552
825 Ga0207671_10150228
826 Ga0207671_10162927
827 Ga0207660_10008582
828 Ga0207662_10043611
829 Ga0207649_10001036
830 Ga0207652_10014719
831 Ga0207681_10024417
832 Ga0207694_10031636
833 Ga0207694_10112734
834 Ga0207650_10111263
835 Ga0207659_10016338
836 Ga0207659_10109060
837 Ga0207659_10249120
838 Ga0207644_10035378
839 Ga0207690_10026989
840 Ga0207706_10004070
841 Ga0207686_10014112
842 Ga0207686_10159257
843 Ga0207670_10005273
844 Ga0207670_10023522
845 Ga0207704_10081839
846 Ga0207691_10101662
847 Ga0207689_10003365
848 Ga0207689_10063393
849 Ga0207689_10175789
850 Ga0207661_10279866
851 Ga0207667_10005062
852 Ga0207667_10006552
853 Ga0207667_10010151
854 Ga0207667_10023006
855 Ga0207651_10022577
856 Ga0207712_10003064
857 Ga0207712_10003234
858 Ga0207712_10061500
859 Ga0207668_10078491
860 Ga0207640_10108851
861 Ga0207640_10139635
862 Ga0207640_10166797
863 Ga0207658_10001199
864 Ga0207658_10017731
865 Ga0207658_10020810
866 Ga0207658_10025403
867 Ga0207677_10070042
868 Ga0207677_10112147
869 Ga0207703_10009965
870 Ga0207639_10035170
871 Ga0207639_10094138
872 Ga0207678_10027997
873 Ga0207708_10094803
874 Ga0207702_10031068
875 Ga0207702_10050474
876 Ga0207641_10000048
877 Ga0207641_10008548
878 Ga0207641_10027604
879 Ga0207641_10031708
880 Ga0207648_10046869
881 Ga0207648_10065383
882 Ga0207648_10078126
883 Ga0207648_10119285
884 Ga0207676_10013618
885 Ga0207674_10000487
886 Ga0207674_10013017
887 Ga0207675_100018877
888 Ga0207675_100045784
889 Ga0207683_10003268
890 Ga0207683_10308275
891 Ga0207683_10309274
892 Ga0207698_10007703
893 Ga0207698_10031428
894 Ga0268266_10000088
895 Ga0268266_10001424
896 Ga0268266_10083145
897 Ga0268265_10012870
898 Ga0268264_10000201
899 Ga0268264_10003372
900 Ga0268264_10006728
901 Ga0268264_10091484
902 Ga0265319_1003241
903 Ga0265334_10000602
904 Ga0265318_10002173
905 Ga0265322_10000143
906 Ga0265336_10000991
907 Ga0265336_10012918
908 Ga0265338_10003310
909 Ga0265338_10042158
910 Ga0265324_10020522
911 Ga0265330_10012178
912 Ga0265320_10007117
913 Ga0265340_10014462
914 Ga0265327_10000055
915 Ga0265327_10000368
916 Ga0265327_10003723
917 Ga0265327_10014414
918 Ga0265327_10061068
919 Ga0265316_10021419
920 Ga0265316_10037463
921 Ga0265316_10078079
922 Ga0265316_10149644
923 Ga0307509_10034551
924 Ga0265313_10054808
925 Ga0307508_10003562
926 Ga0307508_10030681
927 Ga0307516_10003131
928 Ga0307516_10021590
929 Ga0373944_0013904
930 Ga0373936_0016512
931 Ga0373956_0041878
932 Ga0373946_0001073
933 Ga0373935_0035396
934 Ga0373927_0000413
935 Ga0373927_0010990
936 Ga0373947_0000599
937 Ga0373947_0041463
938 Ga0373937_0156005
939 Ga0373925_0037676
940 Ga0395899_0000522
941 Ga0395905_0006828
942 Ga0395905_0054490
943 Ga0436365_1837098
944 Ga0451807_0982136
945 Ga0451577_0000034
946 Ga0466969_0000556
947 Ga0466969_0000925
948 Ga0466972_0000120
949 Ga0466972_0013257
950 Ga0453683_0000057
951 Ga0466966_0000127
952 Ga0466966_0000393
953 Ga0466961_0002668
954 Ga0466963_0169316
955 Ga0453684_0000098
956 Ga0453684_0011148
957 Ga0453684_0051097
958 Ga0466971_0005111
959 Ga0466957_0029344
960 Ga0466959_0000083
961 Ga0466959_0009087
962 Ga0451576_0000036
963 Ga0451576_0000080
964 Ga0451576_0000739
965 Ga0466958_0006547
966 Ga0466958_0129372
967 Ga0495629_0038731
968 Ga0495653_0109366
969 Ga0495580_0026634
970 Ga0495662_0000683
971 Ga0495662_0010605
972 Ga0495664_0000090
973 Ga0495608_0036383
974 Ga0495618_0001865
975 Ga0495628_0045566
976 Ga0495630_0025881
977 Ga0495630_0045433
978 Ga0495648_0015330
979 Ga0495652_0125453
980 Ga0495665_0063320
981 Ga0495640_0014492
982 Ga0495621_0032213
983 Ga0495621_0053423
984 Ga0495621_0073294
985 Ga0495645_0010498
986 Ga0495634_0005829
987 Ga0495634_0007208
988 Ga0495611_0018429
989 Ga0495635_0010273
990 Ga0495635_0058775
991 Ga0495658_0016170
992 Ga0495669_0038164
993 Ga0495613_0020841
994 Ga0495624_0013454
995 Ga0495670_0015714
996 Ga0495600_0144390
997 Ga0495581_0001641
998 Ga0495674_0001316
999 Ga0495674_0097442
1000 Ga0495672_0036494
1001 Ga0495687_000010
1002 Ga0495684_0031342
1003 Ga0495593_0012267
1004 Ga0496108_0087848
1005 Ga0496114_0000414
1006 Ga0501032_0010255
1007 Ga0501034_0000043
1008 Ga0501034_0046235
1009 Ga0501034_0327558
1010 Ga0501036_0047216
1011 Ga0501039_0023050
1012 Ga0501043_0001605
1013 Ga0501043_0110255
1014 Ga0501046_0001390
1015 Ga0501047_0003344
1016 Ga0501047_0021592
1017 Ga0501048_0018277
1018 Ga0501070_0029788
1019 Ga0501073_0011587
1020 Ga0501074_0005404
1021 Ga0501077_0124194
1022 Ga0501257_005232
1023 Ga0501079_0025378
1024 Ga0501035_0042329
1025 Ga0501044_0005070
1026 nmdc:mga0k408_8547_c1
1027 nmdc:mga05p37_89356_c1
1028 nmdc:mga09592_17647_c1
1029 nmdc:mga06r32_268875_c1
1030 nmdc:mga08y16_154716_c1
1031 Ga0495601_0008643
1032 Ga0495612_0000207
1033 Ga0495619_0004861
1034 Ga0495619_0091014
1035 Ga0500578_0096752
1036 Ga0500583_0029101
1037 Ga0500608_000835
1038 Ga0500622_0002993
1039 Ga0500636_0021307
1040 Ga0500636_0085756
1041 Ga0466962_0003613
1042 2520879243
1043 2819681215
1044 2884937100
1045 2902052750
1046 2914762263
1047 2929179330
1048 2929926284
1049 2946018857
1050 8003156576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

65

426

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.8854 20 419
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8846 15 419
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.8747 20 419
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8703 15 419
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.8668 14 417
ID Description Score Start End Superfamily
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8932 35 394 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.886 35 394 1.20.1740.10
af_Q2QN30_93_531_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8811 21 420 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8699 35 394 1.20.1740.10
af_Q8I3M7_238_670_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8696 21 420 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2R7JY88-F1-model_v4 Iron transporter 0.9875 9 389 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A536EP44-F1-model_v4 Divalent metal cation transporter 0.9832 9 420 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A521AXZ4-F1-model_v4 NRAMP (Natural resistance-associated macrophage protein) metal ion transporters 0.9794 11 417 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A7V5G9S2-F1-model_v4 Divalent metal cation transporter 0.9771 11 419 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A1G1WXR2-F1-model_v4 Iron transporter 0.9743 18 421 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755

Map