F459263

General Info

Members Datasets Scaffolds Average Seq Length
525 354 1048 151

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10007199|Ga0105237_100071992
Length 171
Sequence LYFLILIHFSGLALSATLGITKNIKKMKARILIKKADPEAYKALGVLSNYIANSSLSKTHQELIKIRASQINGCAYCIDMHTKDARKAGETEQRIYALNAWRETPFFTEEERAILALTEEVTLIQNHVSDKTYEEAERILGEKYLAQVIMAIINISAWNRIGIATGMQPGL

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
139 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
155 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
158 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
159 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
260 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
261 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
262 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
263 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
282 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
287 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
292 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
304 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
305 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
306 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
307 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
308 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
309 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
310 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
311 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
312 2643221714 Streptomyces sp. Root264 Isolate Unclassified
313 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
314 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
315 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
316 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
317 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
318 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
319 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
320 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
321 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
322 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
323 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
324 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
325 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
326 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
327 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
328 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
329 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
330 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
331 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
332 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
333 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
334 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
335 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
336 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
337 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
338 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
339 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
340 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
341 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
342 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
343 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
344 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
345 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
346 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
347 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
348 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
349 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
350 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
351 8022792930 Bacillus sp. Xin Isolate Rhizosphere
352 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
353 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
354 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0.38
Isolates 10.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0.57
Rhizoplane 1.71
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10007199 3300009545 Bacteria 12215
2 SwRhRL2b_contig_3915940 2162886007 Bacteria 993
3 JGI24740J21852_10002037 3300001979 Bacteria 9242
4 JGI25162J39368_1000011 3300002737 Bacteria 379156
5 JGI25154J39366_1000041 3300002738 Bacteria 144221
6 JGI25157J39369_1003559 3300002741 Bacteria 3130
7 JGI25159J45721_1014250 3300002987 Bacteria 1801
8 JGI25151J46595_10006327 3300003187 Bacteria 5968
9 JGI25151J46595_10008495 3300003187 Bacteria 4934
10 JGI25153J46596_10003472 3300003215 Bacteria 8825
11 JGI25153J46596_10038521 3300003215 Unclassified 1506
12 rootH2_10005684 3300003320 Bacteria 48336
13 rootH2_10063502 3300003320 Bacteria 13069
14 rootH2_10212327 3300003320 Unclassified 1346
15 rootH2_10283979 3300003320 Bacteria 1082
16 rootL2_10071856 3300003322 Bacteria 3682
17 rootL2_10213467 3300003322 Bacteria 1207
18 rootH1_10037955 3300003323 Bacteria 16172
19 rootH1_10080260 3300003323 Bacteria 4994
20 rootH1_10103407 3300003323 Bacteria 4190
21 rootH1_10268703 3300003323 Bacteria 1666
22 JGI25160J50197_1032290 3300003354 Bacteria 1333
23 Ga0006562J51391_1057395 3300003578 Bacteria 609
24 Ga0055526_1076962 3300003771 Bacteria 660
25 Ga0055531_10000104 3300003794 Bacteria 92278
26 Ga0058860_12076626 3300004801 Bacteria 756
27 Ga0065165_1057060 3300005262 Bacteria 1083
28 Ga0065714_10071155 3300005288 Bacteria 3652
29 Ga0065714_10076072 3300005288 Bacteria 2832
30 Ga0065714_10244477 3300005288 Bacteria 768
31 Ga0065714_10248088 3300005288 Bacteria 781
32 Ga0065704_10072920 3300005289 Bacteria 7814
33 Ga0065704_10366593 3300005289 Bacteria 790
34 Ga0065715_10200358 3300005293 Bacteria 1365
35 Ga0065715_10536852 3300005293 Bacteria 751
36 Ga0070658_10330702 3300005327 Bacteria 1302
37 Ga0070680_100015323 3300005336 Bacteria 6007
38 Ga0070682_100000583 3300005337 Bacteria 22371
39 Ga0070660_100052884 3300005339 Bacteria 3132
40 Ga0070691_10001351 3300005341 Bacteria 10464
41 Ga0070669_100297274 3300005353 Bacteria 1298
42 Ga0070663_101499412 3300005455 Bacteria 599
43 Ga0070678_100189657 3300005456 Bacteria 1689
44 Ga0070681_10001864 3300005458 Bacteria 19041
45 Ga0070679_100000415 3300005530 Bacteria 36278
46 Ga0070679_101617181 3300005530 Bacteria 595
47 Ga0068853_100028605 3300005539 Bacteria 4689
48 Ga0068853_100141613 3300005539 Bacteria 2159
49 Ga0070672_100332812 3300005543 Bacteria 1292
50 Ga0070672_101441076 3300005543 Bacteria 616
51 Ga0070686_100000007 3300005544 Bacteria 242709
52 Ga0070693_100007791 3300005547 Bacteria 5252
53 Ga0070693_100007797 3300005547 Bacteria 5251
54 Ga0068855_100049427 3300005563 Bacteria 4960
55 Ga0068855_100060518 3300005563 Bacteria 4428
56 Ga0068857_102279237 3300005577 Bacteria 532
57 Ga0068854_100368588 3300005578 Bacteria 1180
58 Ga0068856_100016947 3300005614 Bacteria 7061
59 Ga0068870_10164973 3300005840 Bacteria 1317
60 Ga0068863_100013234 3300005841 Bacteria 7958
61 Ga0068860_100046394 3300005843 Bacteria 4143
62 Ga0075365_10041421 3300006038 Bacteria 3008
63 Ga0075368_10024780 3300006042 Bacteria 2299
64 Ga0070712_100012667 3300006175 Bacteria 5368
65 Ga0075367_10008634 3300006178 Bacteria 5286
66 Ga0075370_10124220 3300006353 Bacteria 1504
67 Ga0075370_10672915 3300006353 Bacteria 629
68 Ga0075428_102038951 3300006844 Bacteria 594
69 Ga0075429_100243476 3300006880 Bacteria 1575
70 Ga0099826_10436516 3300006948 Bacteria 627
71 Ga0105251_10030030 3300009011 Bacteria 2733
72 Ga0105244_10000201 3300009036 Bacteria 60835
73 Ga0105244_10187245 3300009036 Bacteria 980
74 Ga0105250_10010368 3300009092 Bacteria 3884
75 Ga0105250_10263920 3300009092 Bacteria 738
76 Ga0105240_10001681 3300009093 Bacteria 37540
77 Ga0105240_10003959 3300009093 Bacteria 22879
78 Ga0105240_10412696 3300009093 Bacteria 1518
79 Ga0105240_10509014 3300009093 Bacteria 1338
80 Ga0105240_10721060 3300009093 Bacteria 1087
81 Ga0105245_10463336 3300009098 Bacteria 1278
82 Ga0105247_10899222 3300009101 Bacteria 684
83 Ga0105243_10364562 3300009148 Bacteria 1331
84 Ga0105243_10992211 3300009148 Bacteria 842
85 Ga0105241_10000404 3300009174 Bacteria 32610
86 Ga0105241_10087105 3300009174 Bacteria 2457
87 Ga0105241_10181221 3300009174 Bacteria 1748
88 Ga0105248_11032500 3300009177 Bacteria 929
89 Ga0105237_10010066 3300009545 Bacteria 10087
90 Ga0105237_10128103 3300009545 Bacteria 2532
91 Ga0105237_10918378 3300009545 Bacteria 882
92 Ga0105238_10137072 3300009551 Bacteria 2425
93 Ga0105238_10406951 3300009551 Bacteria 1354
94 Ga0105249_10108628 3300009553 Bacteria 2619
95 Ga0105249_12171746 3300009553 Bacteria 628
96 Ga0105239_10000008 3300010375 Bacteria 376925
97 Ga0105239_10000256 3300010375 Bacteria 79404
98 Ga0105239_10015160 3300010375 Bacteria 8541
99 Ga0105239_10119416 3300010375 Bacteria 2926
100 Ga0105239_10972266 3300010375 Bacteria 976
101 Ga0105246_10047265 3300011119 Bacteria 2938
102 Ga0157373_10002593 3300013100 Bacteria 13729
103 Ga0157373_10116952 3300013100 Bacteria 1874
104 Ga0157371_10003257 3300013102 Bacteria 14885
105 Ga0157371_10030689 3300013102 Bacteria 3876
106 Ga0157371_10600262 3300013102 Unclassified 819
107 Ga0157370_10000134 3300013104 Bacteria 89337
108 Ga0157370_10009827 3300013104 Bacteria 10142
109 Ga0157370_10203460 3300013104 Bacteria 1836
110 Ga0157370_11336599 3300013104 Bacteria 645
111 Ga0157369_10001052 3300013105 Bacteria 34841
112 Ga0163162_10440737 3300013306 Bacteria 1435
113 Ga0157372_10064294 3300013307 Bacteria 4117
114 Ga0157372_10094520 3300013307 Bacteria 3404
115 Ga0157375_10066839 3300013308 Bacteria 3590
116 Ga0163163_10599502 3300014325 Bacteria 1165
117 Ga0182008_10000034 3300014497 Bacteria 138235
118 Ga0157376_10855245 3300014969 Bacteria 925
119 Ga0157376_11077031 3300014969 Bacteria 829
120 Ga0157376_11699673 3300014969 Bacteria 666
121 Ga0182006_1002474 3300015261 Bacteria 10076
122 Ga0182006_1008371 3300015261 Bacteria 4686
123 Ga0182006_1017652 3300015261 Bacteria 3028
124 Ga0163161_10000922 3300017792 Bacteria 22691
125 Ga0163161_10196783 3300017792 Bacteria 1552
126 Ga0209147_106110 3300025229 Bacteria 1706
127 Ga0209437_100017 3300025233 Bacteria 694471
128 Ga0209646_1000122 3300025246 Bacteria 144486
129 Ga0209026_1000329 3300025250 Bacteria 47539
130 Ga0209673_1009305 3300025273 Bacteria 4276
131 Ga0209130_1039520 3300025284 Bacteria 918
132 Ga0209025_1001072 3300025294 Bacteria 39679
133 Ga0209025_1001789 3300025294 Bacteria 25516
134 Ga0209564_1008257 3300025295 Bacteria 5179
135 Ga0209758_1005260 3300025297 Bacteria 10124
136 Ga0207426_1001512 3300025302 Bacteria 18977
137 Ga0207426_1009457 3300025302 Bacteria 3855
138 Ga0209257_1000013 3300025304 Bacteria 1047305
139 Ga0207696_1112235 3300025711 Bacteria 738
140 Ga0207655_1000381 3300025728 Bacteria 61849
141 Ga0207655_1188995 3300025728 Bacteria 623
142 Ga0207713_1027134 3300025735 Bacteria 2607
143 Ga0207688_10296604 3300025901 Bacteria 988
144 Ga0207643_10110301 3300025908 Bacteria 1621
145 Ga0207705_11211901 3300025909 Bacteria 579
146 Ga0207654_10068651 3300025911 Bacteria 2098
147 Ga0207707_10002482 3300025912 Bacteria 16598
148 Ga0207695_10006276 3300025913 Bacteria 15475
149 Ga0207695_10007718 3300025913 Bacteria 13624
150 Ga0207695_10101866 3300025913 Unclassified 2865
151 Ga0207671_10005635 3300025914 Bacteria 11477
152 Ga0207671_10014905 3300025914 Bacteria 6114
153 Ga0207660_10005556 3300025917 Bacteria 8189
154 Ga0207657_10109514 3300025919 Bacteria 2282
155 Ga0207652_10000016 3300025921 Bacteria 188815
156 Ga0207652_10002176 3300025921 Bacteria 16750
157 Ga0207681_10651385 3300025923 Bacteria 873
158 Ga0207694_10267428 3300025924 Bacteria 1402
159 Ga0207650_11441008 3300025925 Bacteria 586
160 Ga0207709_10217813 3300025935 Bacteria 1375
161 Ga0207667_10069624 3300025949 Bacteria 3662
162 Ga0207667_10086441 3300025949 Bacteria 3245
163 Ga0207667_10141618 3300025949 Bacteria 2476
164 Ga0207640_10015839 3300025981 Bacteria 4374
165 Ga0207703_10807215 3300026035 Bacteria 896
166 Ga0207639_10107989 3300026041 Bacteria 2262
167 Ga0207639_12063627 3300026041 Bacteria 531
168 Ga0207641_10090940 3300026088 Bacteria 2670
169 Ga0207674_11144190 3300026116 Bacteria 748
170 Ga0207683_10233712 3300026121 Bacteria 1677
171 Ga0209813_10009922 3300027866 Bacteria 2450
172 Ga0265334_10254033 3300028573 Bacteria 605
173 Ga0307517_10016527 3300028786 Bacteria 9693
174 Ga0307515_10000353 3300028794 Bacteria 112876
175 Ga0307515_10005513 3300028794 Bacteria 25617
176 Ga0307515_10033940 3300028794 Bacteria 8378
177 Ga0307515_10132920 3300028794 Bacteria 2726
178 Ga0307515_10290675 3300028794 Bacteria 1330
179 Ga0307512_10050498 3300030522 Bacteria 3339
180 Ga0307512_10285186 3300030522 Bacteria 785
181 Ga0316177_1128036 3300030731 Bacteria 2413
182 Ga0265327_10000006 3300031251 Bacteria 693716
183 Ga0265327_10025157 3300031251 Bacteria 3478
184 Ga0265327_10075306 3300031251 Bacteria 1679
185 Ga0307513_10009379 3300031456 Bacteria 12382
186 Ga0307513_10047943 3300031456 Unclassified 4642
187 Ga0307513_10080791 3300031456 Bacteria 3352
188 Ga0307513_10576802 3300031456 Bacteria 835
189 Ga0307509_10748062 3300031507 Bacteria 643
190 Ga0307408_100042156 3300031548 Unclassified 3240
191 Ga0307508_10047628 3300031616 Bacteria 3821
192 Ga0307514_10197725 3300031649 Bacteria 1269
193 Ga0307514_10357840 3300031649 Bacteria 773
194 Ga0307405_10022711 3300031731 Unclassified 3552
195 Ga0307410_10851273 3300031852 Unclassified 778
196 Ga0307407_10069916 3300031903 Unclassified 2085
197 Ga0307412_10000049 3300031911 Bacteria 151588
198 Ga0307412_10765046 3300031911 Bacteria 835
199 Ga0307416_100022952 3300032002 Bacteria 4517
200 Ga0307416_100027471 3300032002 Unclassified 4215
201 Ga0307414_10005831 3300032004 Bacteria 6811
202 Ga0307414_10025379 3300032004 Bacteria 3796
203 Ga0307414_10049838 3300032004 Bacteria 2897
204 Ga0307414_10111620 3300032004 Bacteria 2082
205 Ga0307414_10167054 3300032004 Bacteria 1755
206 Ga0307414_11753461 3300032004 Bacteria 579
207 Ga0307411_10000004 3300032005 Bacteria 460327
208 Ga0307411_11099625 3300032005 Bacteria 716
209 Ga0307415_100019356 3300032126 Bacteria 4132
210 Ga0307507_10000362 3300033179 Bacteria 93053
211 Ga0307507_10311738 3300033179 Bacteria 955
212 Ga0307510_10068758 3300033180 Bacteria 3551
213 Ga0307510_10085718 3300033180 Bacteria 3025
214 Ga0395900_0619352 3300037418 Bacteria 1021
215 Ga0395900_0820778 3300037418 Bacteria 857
216 Ga0436363_1578705 3300039450 Unclassified 1152
217 Ga0436362_0649927 3300039453 Bacteria 683
218 Ga0436362_1225224 3300039453 Bacteria 1449
219 Ga0439436_0021983 3300041404 Bacteria 1891
220 Ga0439439_0106950 3300041406 Bacteria 773
221 Ga0439447_004295 3300041407 Bacteria 4941
222 Ga0451787_094168 3300041441 Bacteria 608
223 Ga0451793_0428212 3300041452 Unclassified 744
224 Ga0451793_1195031 3300041452 Unclassified 1345
225 Ga0451797_1207730 3300041453 Bacteria 952
226 Ga0451795_0246016 3300041456 Bacteria 553
227 Ga0451795_1578515 3300041456 Bacteria 1448
228 Ga0451802_0384759 3300041460 Bacteria 1135
229 Ga0451807_0222980 3300041486 Bacteria 911
230 Ga0451839_1165440 3300041496 Bacteria 592
231 Ga0451847_0955537 3300041503 Bacteria 530
232 Ga0451853_0842481 3300041512 Bacteria 2029
233 Ga0451853_0878125 3300041512 Bacteria 6787
234 Ga0451853_1390141 3300041512 Bacteria 6633
235 Ga0451853_1429198 3300041512 Bacteria 655
236 Ga0451853_2021448 3300041512 Bacteria 2569
237 Ga0451853_2072721 3300041512 Bacteria 1604
238 Ga0439442_027232 3300042002 Bacteria 1191
239 Ga0439448_0014792 3300042005 Bacteria 2357
240 Ga0439449_0010774 3300042007 Bacteria 3450
241 Ga0439449_0021745 3300042007 Bacteria 2401
242 Ga0439449_0160192 3300042007 Bacteria 840
243 Ga0439449_0317165 3300042007 Bacteria 589
244 Ga0439455_0003760 3300042012 Bacteria 2935
245 Ga0439457_019007 3300042014 Bacteria 1526
246 Ga0439462_0075525 3300042015 Bacteria 917
247 Ga0450894_000150 3300042131 Bacteria 12331
248 Ga0450896_026848 3300042133 Bacteria 860
249 Ga0450898_050851 3300042134 Bacteria 800
250 Ga0450899_001245 3300042135 Bacteria 2885
251 Ga0450903_008829 3300042138 Bacteria 1646
252 Ga0450906_005737 3300042145 Bacteria 2533
253 Ga0439458_0002003 3300042157 Bacteria 5059
254 Ga0466969_0000451 3300044656 Bacteria 22561
255 Ga0466972_0011561 3300044658 Bacteria 4432
256 Ga0466965_0001081 3300044683 Bacteria 10598
257 Ga0466966_0001814 3300044684 Bacteria 13849
258 Ga0466966_0003200 3300044684 Bacteria 10784
259 Ga0466961_0001727 3300044693 Bacteria 13590
260 Ga0466961_0002469 3300044693 Bacteria 11471
261 Ga0466963_0051646 3300044694 Bacteria 2725
262 Ga0466964_0299359 3300044706 Bacteria 810
263 Ga0466971_0001603 3300044719 Bacteria 9539
264 Ga0466970_0000971 3300044765 Bacteria 13790
265 Ga0466970_0012511 3300044765 Bacteria 4341
266 Ga0466970_0135403 3300044765 Bacteria 1355
267 Ga0466957_0002710 3300044842 Bacteria 9576
268 Ga0466957_0003736 3300044842 Bacteria 8414
269 Ga0466959_0000182 3300045049 Bacteria 41499
270 Ga0466959_0002105 3300045049 Bacteria 12594
271 Ga0466958_0000961 3300045836 Bacteria 13041
272 Ga0466967_0000560 3300045976 Bacteria 18187
273 Ga0495603_0033465 3300046455 Bacteria 3092
274 Ga0495590_0031788 3300046457 Bacteria 1847
275 Ga0495629_0018902 3300046459 Bacteria 4926
276 Ga0495638_0424890 3300046460 Bacteria 684
277 Ga0495650_0134882 3300046471 Bacteria 897
278 Ga0495650_0299202 3300046471 Bacteria 539
279 Ga0495605_0032866 3300046474 Bacteria 2638
280 Ga0495662_0192847 3300046476 Bacteria 1004
281 Ga0495585_0000388 3300046492 Bacteria 42445
282 Ga0495585_0107778 3300046492 Bacteria 1484
283 Ga0495585_0360579 3300046492 Unclassified 705
284 Ga0495585_0568018 3300046492 Bacteria 535
285 Ga0495594_0184624 3300046499 Bacteria 1187
286 Ga0495594_0429043 3300046499 Bacteria 752
287 Ga0495583_0143583 3300046506 Bacteria 992
288 Ga0495583_0317752 3300046506 Bacteria 617
289 Ga0495606_0000074 3300046507 Bacteria 170848
290 Ga0495606_0004380 3300046507 Bacteria 14156
291 Ga0495606_0006049 3300046507 Bacteria 11319
292 Ga0495606_0017582 3300046507 Bacteria 5398
293 Ga0495606_0028451 3300046507 Bacteria 3942
294 Ga0495606_0085940 3300046507 Bacteria 1945
295 Ga0495608_0073014 3300046511 Bacteria 2238
296 Ga0495610_0029208 3300046512 Bacteria 2907
297 Ga0495610_0057176 3300046512 Bacteria 1872
298 Ga0495616_0006996 3300046513 Bacteria 6791
299 Ga0495616_0008620 3300046513 Bacteria 6021
300 Ga0495616_0293361 3300046513 Bacteria 688
301 Ga0495618_0224704 3300046514 Bacteria 1183
302 Ga0495620_0004387 3300046515 Bacteria 7961
303 Ga0495620_0034178 3300046515 Bacteria 2300
304 Ga0495628_0067106 3300046516 Bacteria 2802
305 Ga0495630_0135145 3300046517 Bacteria 1874
306 Ga0495631_0011003 3300046518 Bacteria 4466
307 Ga0495637_0019315 3300046520 Bacteria 3153
308 Ga0495643_0006478 3300046522 Bacteria 7704
309 Ga0495643_0034893 3300046522 Bacteria 2772
310 Ga0495644_0163266 3300046523 Bacteria 854
311 Ga0495648_0008222 3300046524 Bacteria 8227
312 Ga0495648_0213277 3300046524 Bacteria 957
313 Ga0495663_0047279 3300046525 Bacteria 1324
314 Ga0495666_0025458 3300046526 Bacteria 2921
315 Ga0495642_0211994 3300046528 Bacteria 845
316 Ga0495652_0135326 3300046529 Bacteria 1945
317 Ga0495654_0261234 3300046530 Bacteria 718
318 Ga0495640_0103707 3300046533 Bacteria 1864
319 Ga0495609_0034029 3300046538 Bacteria 2311
320 Ga0495597_0085113 3300046542 Bacteria 1347
321 Ga0495622_0010743 3300046557 Bacteria 4224
322 Ga0495622_0055525 3300046557 Bacteria 1837
323 Ga0495622_0335435 3300046557 Bacteria 655
324 Ga0495633_0000027 3300046558 Bacteria 204613
325 Ga0495633_0004447 3300046558 Bacteria 8916
326 Ga0495633_0124349 3300046558 Bacteria 1194
327 Ga0495667_0672677 3300046559 Bacteria 642
328 Ga0495667_0821509 3300046559 Bacteria 572
329 Ga0495668_0000010 3300046616 Bacteria 487308
330 Ga0495668_0007298 3300046616 Bacteria 7087
331 Ga0495634_0381750 3300046642 Bacteria 839
332 Ga0495611_0000010 3300046648 Bacteria 156661
333 Ga0495611_0069259 3300046648 Bacteria 1611
334 Ga0495625_0022865 3300046660 Bacteria 4783
335 Ga0495625_0025338 3300046660 Bacteria 4499
336 Ga0495625_0043358 3300046660 Bacteria 3263
337 Ga0495625_0184263 3300046660 Bacteria 1386
338 Ga0495625_0401828 3300046660 Bacteria 856
339 Ga0495661_0040743 3300046665 Bacteria 2878
340 Ga0495657_0030837 3300046675 Bacteria 3751
341 Ga0495599_0404411 3300046678 Bacteria 813
342 Ga0495623_0038597 3300046679 Bacteria 3054
343 Ga0495646_0313190 3300046680 Bacteria 828
344 Ga0495658_0094445 3300046683 Bacteria 1776
345 Ga0495669_0466631 3300046684 Bacteria 613
346 Ga0495613_0787035 3300046689 Bacteria 621
347 Ga0495613_0791070 3300046689 Bacteria 619
348 Ga0495624_0032786 3300046690 Bacteria 3366
349 Ga0495624_0140191 3300046690 Bacteria 1481
350 Ga0495670_0152220 3300046691 Bacteria 1213
351 Ga0495671_0218809 3300046692 Bacteria 922
352 Ga0495649_0038296 3300046694 Bacteria 2631
353 Ga0495600_0851540 3300046809 Bacteria 540
354 Ga0495660_0078996 3300046810 Bacteria 1728
355 Ga0495660_0216802 3300046810 Bacteria 904
356 Ga0495660_0378822 3300046810 Bacteria 624
357 Ga0495581_0130138 3300047315 Bacteria 1466
358 Ga0495604_0045469 3300047317 Bacteria 3426
359 Ga0495636_0050896 3300047318 Bacteria 1735
360 Ga0495674_1399868 3300047319 Bacteria 521
361 Ga0495672_0081353 3300047320 Bacteria 1804
362 Ga0495676_0012453 3300047321 Bacteria 7661
363 Ga0495676_0068551 3300047321 Bacteria 2740
364 Ga0495680_0016059 3300047322 Bacteria 6437
365 Ga0495680_0018359 3300047322 Bacteria 5940
366 Ga0495683_0030126 3300047323 Bacteria 2770
367 Ga0495683_0044007 3300047323 Bacteria 2245
368 Ga0495687_011324 3300047443 Bacteria 4807
369 Ga0495687_049857 3300047443 Bacteria 1787
370 Ga0495687_157291 3300047443 Bacteria 769
371 Ga0495677_0163530 3300047445 Bacteria 860
372 Ga0495685_114709 3300047447 Bacteria 885
373 Ga0495681_0027610 3300047470 Bacteria 2933
374 Ga0495684_0865832 3300047471 Bacteria 585
375 Ga0495686_0000249 3300047472 Bacteria 96604
376 Ga0495686_0000386 3300047472 Bacteria 70225
377 Ga0495686_0000582 3300047472 Bacteria 51799
378 Ga0495686_0000587 3300047472 Bacteria 51313
379 Ga0495686_0001554 3300047472 Bacteria 24493
380 Ga0495686_0066967 3300047472 Bacteria 2218
381 Ga0495593_0008174 3300047673 Bacteria 6086
382 Ga0495593_0072907 3300047673 Bacteria 1782
383 Ga0495593_0313917 3300047673 Bacteria 784
384 Ga0495614_0013162 3300048089 Bacteria 3629
385 Ga0495614_0029728 3300048089 Bacteria 2351
386 Ga0495614_0070246 3300048089 Bacteria 1508
387 Ga0495626_0019938 3300048091 Bacteria 3345
388 Ga0496101_0281832 3300048904 Bacteria 1299
389 Ga0496116_0000024 3300048919 Bacteria 471420
390 Ga0496117_0218606 3300048920 Bacteria 1062
391 Ga0496118_0080707 3300048921 Bacteria 2288
392 Ga0496121_0019380 3300048924 Bacteria 6804
393 Ga0496121_0163799 3300048924 Bacteria 1623
394 Ga0496122_0000066 3300048925 Bacteria 231473
395 Ga0496123_0096876 3300048926 Bacteria 1730
396 Ga0496124_0017724 3300048927 Bacteria 6700
397 Ga0496124_0177392 3300048927 Bacteria 1643
398 Ga0496125_0000018 3300048928 Bacteria 482390
399 Ga0496126_0014506 3300048929 Bacteria 7963
400 Ga0496126_0018225 3300048929 Bacteria 6967
401 Ga0495678_056852 3300049459 Bacteria 1485
402 Ga0495682_0113112 3300049460 Bacteria 973
403 Ga0501032_0466896 3300049569 Bacteria 808
404 Ga0501033_0397782 3300049570 Unclassified 961
405 Ga0501034_0924455 3300049571 Bacteria 759
406 Ga0501070_0785365 3300049586 Bacteria 749
407 Ga0501198_090711 3300049649 Unclassified 606
408 Ga0501238_002146 3300049671 Bacteria 2330
409 Ga0501241_004732 3300049758 Bacteria 2540
410 Ga0501266_000002 3300049763 Bacteria 459947
411 Ga0501269_001832 3300049766 Bacteria 2697
412 Ga0501280_002242 3300049776 Unclassified 3282
413 Ga0501035_0436176 3300049822 Unclassified 1086
414 nmdc:mga03n38_716763_c1 3300050490 Bacteria 577
415 nmdc:mga0yw44_123704_c1 3300050492 Bacteria 1668
416 nmdc:mga06z11_5136_c1 3300050494 Bacteria 5219
417 nmdc:mga04h51_13231_c1 3300050495 Bacteria 2332
418 nmdc:mga0rr50_440802_c1 3300050513 Bacteria 1103
419 Ga0500635_0000558 3300053080 Bacteria 9937
420 Ga0500635_0021064 3300053080 Bacteria 2004
421 Ga0500644_0002380 3300053088 Bacteria 4720
422 Ga0500644_0012972 3300053088 Bacteria 2317
423 Ga0500644_0049063 3300053088 Bacteria 1439
424 Ga0500646_0011416 3300053090 Bacteria 2286
425 Ga0500646_0057660 3300053090 Bacteria 1135
426 Ga0500646_0167667 3300053090 Bacteria 737
427 Ga0500651_0000756 3300053093 Bacteria 15793
428 Ga0500651_0015489 3300053093 Unclassified 4680
429 Ga0500651_0037850 3300053093 Unclassified 3039
430 Ga0500651_0079716 3300053093 Bacteria 2029
431 Ga0500641_0000143 3300053096 Bacteria 26192
432 Ga0500641_0003775 3300053096 Bacteria 5353
433 Ga0500555_082418 3300053103 Bacteria 835
434 Ga0500560_058057 3300053107 Bacteria 1256
435 Ga0500562_000111 3300053108 Bacteria 28772
436 Ga0500569_000338 3300053109 Bacteria 7520
437 Ga0500594_0047530 3300053118 Bacteria 1197
438 Ga0500608_018193 3300053122 Bacteria 3203
439 Ga0500614_286395 3300053123 Bacteria 517
440 Ga0500618_000013 3300053125 Bacteria 183026
441 Ga0500642_0079083 3300053130 Bacteria 1507
442 Ga0500658_0000002 3300053134 Bacteria 548440
443 Ga0500658_0201695 3300053134 Bacteria 909
444 Ga0500561_0035330 3300053137 Bacteria 1289
445 Ga0500564_095564 3300053138 Bacteria 1319
446 Ga0500568_0062607 3300053139 Bacteria 1437
447 Ga0500573_0029975 3300053140 Bacteria 3137
448 Ga0500577_0000386 3300053142 Bacteria 11294
449 Ga0500589_144834 3300053147 Bacteria 974
450 Ga0500600_0322464 3300053149 Bacteria 650
451 Ga0500616_0007615 3300053153 Bacteria 6846
452 Ga0500616_0368440 3300053153 Bacteria 580
453 Ga0500616_0397564 3300053153 Bacteria 551
454 Ga0500622_0000042 3300053156 Bacteria 161253
455 Ga0500622_0000086 3300053156 Bacteria 99366
456 Ga0500622_0000354 3300053156 Bacteria 44739
457 Ga0500622_0001279 3300053156 Bacteria 20471
458 Ga0500624_000158 3300053157 Bacteria 27895
459 Ga0500627_0151586 3300053158 Bacteria 1047
460 Ga0500627_0237856 3300053158 Bacteria 809
461 Ga0500633_0000863 3300053160 Bacteria 5258
462 Ga0500636_0005090 3300053177 Bacteria 7463
463 Ga0500584_025201 3300053726 Bacteria 2765
464 Ga0500645_003030 3300053730 Bacteria 7083
465 Ga0500661_008673 3300055283 Bacteria 1869
466 Ga0466962_0002543 3300061719 Bacteria 8654
467 Ga0466962_0057525 3300061719 Bacteria 1856
468 2513235886 2513020052 Bacteria 5120511
469 2585306219 2582581313 Bacteria 10042643
470 2585313782 2582581314 Bacteria 11452267
471 2587749435 2585428060 Bacteria 5304711
472 2588446598 2588253712 Bacteria 5403181
473 2590612089 2588254257 Bacteria 5436094
474 2616696632 2616644814 Bacteria 11555299
475 2644008424 2643221600 Bacteria 5530138
476 2644009616 2643221600 Bacteria 5530138
477 2644011252 2643221600 Bacteria 5530138
478 2644372142 2643221667 Bacteria 5627472
479 2644633144 2643221714 Bacteria 9015452
480 2676487618 2675903060 Bacteria 10051191
481 2738732697 2738541279 Bacteria 6149495
482 2738765235 2738541285 Bacteria 6150075
483 2739214278 2738543007 Bacteria 6149845
484 2740003191 2739367857 Bacteria 5433684
485 2740008008 2739367858 Bacteria 5432813
486 2740057842 2739367874 Bacteria 4872888
487 2753266273 2751185782 Bacteria 11227053
488 2785339210 2784746763 Bacteria 9783172
489 2785370929 2784746768 Bacteria 10036182
490 2786672105 2786546132 Bacteria 10419719
491 2802654901 2802428842 Bacteria 4926114
492 2808843486 2808606359 Bacteria 9866990
493 2817482419 2816332295 Bacteria 4352468
494 2819739549 2818991472 Bacteria 10089953
495 2840678189 2840677318 Bacteria 2664183
496 2857618309 2857618242 Bacteria 5635925
497 2857620083 2857618242 Bacteria 5635925
498 2862382990 2862382967 Bacteria 10317375
499 2863410727 2863404153 Bacteria 9672205
500 2896086007 2896085136 Bacteria 6129793
501 2896115212 2896109856 Bacteria 7140722
502 2919193786 2919191525 Bacteria 5765973
503 2919195515 2919191525 Bacteria 5765973
504 2919196503 2919191525 Bacteria 5765973
505 2919440801 2919437846 Bacteria 6199444
506 2919688360 2919683626 Bacteria 5534354
507 2929150250 2929150217 Bacteria 5462483
508 2929241154 2929239360 Bacteria 7745570
509 2929925275 2929921140 Bacteria 8649150
510 2946077254 2946072368 Bacteria 8999607
511 2954004889 2954002825 Bacteria 9173742
512 2954678378 2954673503 Bacteria 9685905
513 2954685777 2954682443 Bacteria 9862841
514 2954695414 2954691527 Bacteria 10720516
515 2954710607 2954701450 Bacteria 10834262
516 2971412278 2971410472 Bacteria 8311090
517 2977271719 2977268062 Bacteria 5243061
518 2990066828 2990059506 Bacteria 9321252
519 3006858347 3006858327 Bacteria 4317835
520 8008564770 8008558824 Bacteria 10610750
521 8022794021 8022792930 Bacteria 5693794
522 8054309860 8054307821 Bacteria 5212224
523 8055423220 8055419101 Bacteria 5289643
524 8057587295 8057582654 Bacteria 5218944
525 Ga0105237_10007199
526 SwRhRL2b_contig_3915940
527 JGI24740J21852_10002037
528 JGI25162J39368_1000011
529 JGI25154J39366_1000041
530 JGI25157J39369_1003559
531 JGI25159J45721_1014250
532 JGI25151J46595_10006327
533 JGI25151J46595_10008495
534 JGI25153J46596_10003472
535 JGI25153J46596_10038521
536 rootH2_10005684
537 rootH2_10063502
538 rootH2_10212327
539 rootH2_10283979
540 rootL2_10071856
541 rootL2_10213467
542 rootH1_10037955
543 rootH1_10080260
544 rootH1_10103407
545 rootH1_10268703
546 JGI25160J50197_1032290
547 Ga0006562J51391_1057395
548 Ga0055526_1076962
549 Ga0055531_10000104
550 Ga0058860_12076626
551 Ga0065165_1057060
552 Ga0065714_10071155
553 Ga0065714_10076072
554 Ga0065714_10244477
555 Ga0065714_10248088
556 Ga0065704_10072920
557 Ga0065704_10366593
558 Ga0065715_10200358
559 Ga0065715_10536852
560 Ga0070658_10330702
561 Ga0070680_100015323
562 Ga0070682_100000583
563 Ga0070660_100052884
564 Ga0070691_10001351
565 Ga0070669_100297274
566 Ga0070663_101499412
567 Ga0070678_100189657
568 Ga0070681_10001864
569 Ga0070679_100000415
570 Ga0070679_101617181
571 Ga0068853_100028605
572 Ga0068853_100141613
573 Ga0070672_100332812
574 Ga0070672_101441076
575 Ga0070686_100000007
576 Ga0070693_100007791
577 Ga0070693_100007797
578 Ga0068855_100049427
579 Ga0068855_100060518
580 Ga0068857_102279237
581 Ga0068854_100368588
582 Ga0068856_100016947
583 Ga0068870_10164973
584 Ga0068863_100013234
585 Ga0068860_100046394
586 Ga0075365_10041421
587 Ga0075368_10024780
588 Ga0070712_100012667
589 Ga0075367_10008634
590 Ga0075370_10124220
591 Ga0075370_10672915
592 Ga0075428_102038951
593 Ga0075429_100243476
594 Ga0099826_10436516
595 Ga0105251_10030030
596 Ga0105244_10000201
597 Ga0105244_10187245
598 Ga0105250_10010368
599 Ga0105250_10263920
600 Ga0105240_10001681
601 Ga0105240_10003959
602 Ga0105240_10412696
603 Ga0105240_10509014
604 Ga0105240_10721060
605 Ga0105245_10463336
606 Ga0105247_10899222
607 Ga0105243_10364562
608 Ga0105243_10992211
609 Ga0105241_10000404
610 Ga0105241_10087105
611 Ga0105241_10181221
612 Ga0105248_11032500
613 Ga0105237_10010066
614 Ga0105237_10128103
615 Ga0105237_10918378
616 Ga0105238_10137072
617 Ga0105238_10406951
618 Ga0105249_10108628
619 Ga0105249_12171746
620 Ga0105239_10000008
621 Ga0105239_10000256
622 Ga0105239_10015160
623 Ga0105239_10119416
624 Ga0105239_10972266
625 Ga0105246_10047265
626 Ga0157373_10002593
627 Ga0157373_10116952
628 Ga0157371_10003257
629 Ga0157371_10030689
630 Ga0157371_10600262
631 Ga0157370_10000134
632 Ga0157370_10009827
633 Ga0157370_10203460
634 Ga0157370_11336599
635 Ga0157369_10001052
636 Ga0163162_10440737
637 Ga0157372_10064294
638 Ga0157372_10094520
639 Ga0157375_10066839
640 Ga0163163_10599502
641 Ga0182008_10000034
642 Ga0157376_10855245
643 Ga0157376_11077031
644 Ga0157376_11699673
645 Ga0182006_1002474
646 Ga0182006_1008371
647 Ga0182006_1017652
648 Ga0163161_10000922
649 Ga0163161_10196783
650 Ga0209147_106110
651 Ga0209437_100017
652 Ga0209646_1000122
653 Ga0209026_1000329
654 Ga0209673_1009305
655 Ga0209130_1039520
656 Ga0209025_1001072
657 Ga0209025_1001789
658 Ga0209564_1008257
659 Ga0209758_1005260
660 Ga0207426_1001512
661 Ga0207426_1009457
662 Ga0209257_1000013
663 Ga0207696_1112235
664 Ga0207655_1000381
665 Ga0207655_1188995
666 Ga0207713_1027134
667 Ga0207688_10296604
668 Ga0207643_10110301
669 Ga0207705_11211901
670 Ga0207654_10068651
671 Ga0207707_10002482
672 Ga0207695_10006276
673 Ga0207695_10007718
674 Ga0207695_10101866
675 Ga0207671_10005635
676 Ga0207671_10014905
677 Ga0207660_10005556
678 Ga0207657_10109514
679 Ga0207652_10000016
680 Ga0207652_10002176
681 Ga0207681_10651385
682 Ga0207694_10267428
683 Ga0207650_11441008
684 Ga0207709_10217813
685 Ga0207667_10069624
686 Ga0207667_10086441
687 Ga0207667_10141618
688 Ga0207640_10015839
689 Ga0207703_10807215
690 Ga0207639_10107989
691 Ga0207639_12063627
692 Ga0207641_10090940
693 Ga0207674_11144190
694 Ga0207683_10233712
695 Ga0209813_10009922
696 Ga0265334_10254033
697 Ga0307517_10016527
698 Ga0307515_10000353
699 Ga0307515_10005513
700 Ga0307515_10033940
701 Ga0307515_10132920
702 Ga0307515_10290675
703 Ga0307512_10050498
704 Ga0307512_10285186
705 Ga0316177_1128036
706 Ga0265327_10000006
707 Ga0265327_10025157
708 Ga0265327_10075306
709 Ga0307513_10009379
710 Ga0307513_10047943
711 Ga0307513_10080791
712 Ga0307513_10576802
713 Ga0307509_10748062
714 Ga0307408_100042156
715 Ga0307508_10047628
716 Ga0307514_10197725
717 Ga0307514_10357840
718 Ga0307405_10022711
719 Ga0307410_10851273
720 Ga0307407_10069916
721 Ga0307412_10000049
722 Ga0307412_10765046
723 Ga0307416_100022952
724 Ga0307416_100027471
725 Ga0307414_10005831
726 Ga0307414_10025379
727 Ga0307414_10049838
728 Ga0307414_10111620
729 Ga0307414_10167054
730 Ga0307414_11753461
731 Ga0307411_10000004
732 Ga0307411_11099625
733 Ga0307415_100019356
734 Ga0307507_10000362
735 Ga0307507_10311738
736 Ga0307510_10068758
737 Ga0307510_10085718
738 Ga0395900_0619352
739 Ga0395900_0820778
740 Ga0436363_1578705
741 Ga0436362_0649927
742 Ga0436362_1225224
743 Ga0439436_0021983
744 Ga0439439_0106950
745 Ga0439447_004295
746 Ga0451787_094168
747 Ga0451793_0428212
748 Ga0451793_1195031
749 Ga0451797_1207730
750 Ga0451795_0246016
751 Ga0451795_1578515
752 Ga0451802_0384759
753 Ga0451807_0222980
754 Ga0451839_1165440
755 Ga0451847_0955537
756 Ga0451853_0842481
757 Ga0451853_0878125
758 Ga0451853_1390141
759 Ga0451853_1429198
760 Ga0451853_2021448
761 Ga0451853_2072721
762 Ga0439442_027232
763 Ga0439448_0014792
764 Ga0439449_0010774
765 Ga0439449_0021745
766 Ga0439449_0160192
767 Ga0439449_0317165
768 Ga0439455_0003760
769 Ga0439457_019007
770 Ga0439462_0075525
771 Ga0450894_000150
772 Ga0450896_026848
773 Ga0450898_050851
774 Ga0450899_001245
775 Ga0450903_008829
776 Ga0450906_005737
777 Ga0439458_0002003
778 Ga0466969_0000451
779 Ga0466972_0011561
780 Ga0466965_0001081
781 Ga0466966_0001814
782 Ga0466966_0003200
783 Ga0466961_0001727
784 Ga0466961_0002469
785 Ga0466963_0051646
786 Ga0466964_0299359
787 Ga0466971_0001603
788 Ga0466970_0000971
789 Ga0466970_0012511
790 Ga0466970_0135403
791 Ga0466957_0002710
792 Ga0466957_0003736
793 Ga0466959_0000182
794 Ga0466959_0002105
795 Ga0466958_0000961
796 Ga0466967_0000560
797 Ga0495603_0033465
798 Ga0495590_0031788
799 Ga0495629_0018902
800 Ga0495638_0424890
801 Ga0495650_0134882
802 Ga0495650_0299202
803 Ga0495605_0032866
804 Ga0495662_0192847
805 Ga0495585_0000388
806 Ga0495585_0107778
807 Ga0495585_0360579
808 Ga0495585_0568018
809 Ga0495594_0184624
810 Ga0495594_0429043
811 Ga0495583_0143583
812 Ga0495583_0317752
813 Ga0495606_0000074
814 Ga0495606_0004380
815 Ga0495606_0006049
816 Ga0495606_0017582
817 Ga0495606_0028451
818 Ga0495606_0085940
819 Ga0495608_0073014
820 Ga0495610_0029208
821 Ga0495610_0057176
822 Ga0495616_0006996
823 Ga0495616_0008620
824 Ga0495616_0293361
825 Ga0495618_0224704
826 Ga0495620_0004387
827 Ga0495620_0034178
828 Ga0495628_0067106
829 Ga0495630_0135145
830 Ga0495631_0011003
831 Ga0495637_0019315
832 Ga0495643_0006478
833 Ga0495643_0034893
834 Ga0495644_0163266
835 Ga0495648_0008222
836 Ga0495648_0213277
837 Ga0495663_0047279
838 Ga0495666_0025458
839 Ga0495642_0211994
840 Ga0495652_0135326
841 Ga0495654_0261234
842 Ga0495640_0103707
843 Ga0495609_0034029
844 Ga0495597_0085113
845 Ga0495622_0010743
846 Ga0495622_0055525
847 Ga0495622_0335435
848 Ga0495633_0000027
849 Ga0495633_0004447
850 Ga0495633_0124349
851 Ga0495667_0672677
852 Ga0495667_0821509
853 Ga0495668_0000010
854 Ga0495668_0007298
855 Ga0495634_0381750
856 Ga0495611_0000010
857 Ga0495611_0069259
858 Ga0495625_0022865
859 Ga0495625_0025338
860 Ga0495625_0043358
861 Ga0495625_0184263
862 Ga0495625_0401828
863 Ga0495661_0040743
864 Ga0495657_0030837
865 Ga0495599_0404411
866 Ga0495623_0038597
867 Ga0495646_0313190
868 Ga0495658_0094445
869 Ga0495669_0466631
870 Ga0495613_0787035
871 Ga0495613_0791070
872 Ga0495624_0032786
873 Ga0495624_0140191
874 Ga0495670_0152220
875 Ga0495671_0218809
876 Ga0495649_0038296
877 Ga0495600_0851540
878 Ga0495660_0078996
879 Ga0495660_0216802
880 Ga0495660_0378822
881 Ga0495581_0130138
882 Ga0495604_0045469
883 Ga0495636_0050896
884 Ga0495674_1399868
885 Ga0495672_0081353
886 Ga0495676_0012453
887 Ga0495676_0068551
888 Ga0495680_0016059
889 Ga0495680_0018359
890 Ga0495683_0030126
891 Ga0495683_0044007
892 Ga0495687_011324
893 Ga0495687_049857
894 Ga0495687_157291
895 Ga0495677_0163530
896 Ga0495685_114709
897 Ga0495681_0027610
898 Ga0495684_0865832
899 Ga0495686_0000249
900 Ga0495686_0000386
901 Ga0495686_0000582
902 Ga0495686_0000587
903 Ga0495686_0001554
904 Ga0495686_0066967
905 Ga0495593_0008174
906 Ga0495593_0072907
907 Ga0495593_0313917
908 Ga0495614_0013162
909 Ga0495614_0029728
910 Ga0495614_0070246
911 Ga0495626_0019938
912 Ga0496101_0281832
913 Ga0496116_0000024
914 Ga0496117_0218606
915 Ga0496118_0080707
916 Ga0496121_0019380
917 Ga0496121_0163799
918 Ga0496122_0000066
919 Ga0496123_0096876
920 Ga0496124_0017724
921 Ga0496124_0177392
922 Ga0496125_0000018
923 Ga0496126_0014506
924 Ga0496126_0018225
925 Ga0495678_056852
926 Ga0495682_0113112
927 Ga0501032_0466896
928 Ga0501033_0397782
929 Ga0501034_0924455
930 Ga0501070_0785365
931 Ga0501198_090711
932 Ga0501238_002146
933 Ga0501241_004732
934 Ga0501266_000002
935 Ga0501269_001832
936 Ga0501280_002242
937 Ga0501035_0436176
938 nmdc:mga03n38_716763_c1
939 nmdc:mga0yw44_123704_c1
940 nmdc:mga06z11_5136_c1
941 nmdc:mga04h51_13231_c1
942 nmdc:mga0rr50_440802_c1
943 Ga0500635_0000558
944 Ga0500635_0021064
945 Ga0500644_0002380
946 Ga0500644_0012972
947 Ga0500644_0049063
948 Ga0500646_0011416
949 Ga0500646_0057660
950 Ga0500646_0167667
951 Ga0500651_0000756
952 Ga0500651_0015489
953 Ga0500651_0037850
954 Ga0500651_0079716
955 Ga0500641_0000143
956 Ga0500641_0003775
957 Ga0500555_082418
958 Ga0500560_058057
959 Ga0500562_000111
960 Ga0500569_000338
961 Ga0500594_0047530
962 Ga0500608_018193
963 Ga0500614_286395
964 Ga0500618_000013
965 Ga0500642_0079083
966 Ga0500658_0000002
967 Ga0500658_0201695
968 Ga0500561_0035330
969 Ga0500564_095564
970 Ga0500568_0062607
971 Ga0500573_0029975
972 Ga0500577_0000386
973 Ga0500589_144834
974 Ga0500600_0322464
975 Ga0500616_0007615
976 Ga0500616_0368440
977 Ga0500616_0397564
978 Ga0500622_0000042
979 Ga0500622_0000086
980 Ga0500622_0000354
981 Ga0500622_0001279
982 Ga0500624_000158
983 Ga0500627_0151586
984 Ga0500627_0237856
985 Ga0500633_0000863
986 Ga0500636_0005090
987 Ga0500584_025201
988 Ga0500645_003030
989 Ga0500661_008673
990 Ga0466962_0002543
991 Ga0466962_0057525
992 2513235886
993 2585306219
994 2585313782
995 2587749435
996 2588446598
997 2590612089
998 2616696632
999 2644008424
1000 2644009616
1001 2644011252
1002 2644372142
1003 2644633144
1004 2676487618
1005 2738732697
1006 2738765235
1007 2739214278
1008 2740003191
1009 2740008008
1010 2740057842
1011 2753266273
1012 2785339210
1013 2785370929
1014 2786672105
1015 2802654901
1016 2808843486
1017 2817482419
1018 2819739549
1019 2840678189
1020 2857618309
1021 2857620083
1022 2862382990
1023 2863410727
1024 2896086007
1025 2896115212
1026 2919193786
1027 2919195515
1028 2919196503
1029 2919440801
1030 2919688360
1031 2929150250
1032 2929241154
1033 2929925275
1034 2946077254
1035 2954004889
1036 2954678378
1037 2954685777
1038 2954695414
1039 2954710607
1040 2971412278
1041 2977271719
1042 2990066828
1043 3006858347
1044 8008564770
1045 8022794021
1046 8054309860
1047 8055423220
1048 8057587295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

38

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9815 10 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9801 4 144
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.967 10 141
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.962 1 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9555 1 144
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9834 4 144 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9566 4 144 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9557 6 140 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9541 2 143 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9488 2 144 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A497ZF99-F1-model_v4 deleted 1.002 8 144
AF-A0A1M7FJB3-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 1.001 1 144 GO:0051920
AF-A0A1V9EQ61-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9977 4 144 GO:0051920
AF-A0A7Y7HAS2-F1-model_v4 AhpD family alkylhydroperoxidase 0.9976 3 144 GO:0051920
AF-A0A0W8ELG8-F1-model_v4 deleted 0.996 4 144

Map