F459264

General Info

Members Datasets Scaffolds Average Seq Length
525 289 1050 227

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10039305|Ga0105237_100393053
Length 254
Sequence VRRSPRPASPPERPGFASTRRRDYALRPMPDPVTLRRLYGRRQGHKLRQGQSALVEELLPQVSVPDAGPLDAQTLFGDDRPLEFEIGFGGGEHLAGQATMRPDHGFIGCEPFLNGVVGALNHIRDGELANVRLHMGDALEVMERLPDASLSRVYLLHPDPWPKARHAKRRMVNHGPLDLIAAKLKPGSEFRLGTDDPTYCRWAMMVLGQRKDFVWQAQTAQDFLTRPADWPETRYERKARRQGHEVWYFRYVRV

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
183 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
251 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
259 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
274 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
279 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
280 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
281 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
282 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
283 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
284 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
285 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
286 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
287 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
288 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
289 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 2.67
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10039305 3300009545 Bacteria 4777
2 ARcpr5yngRDRAFT_c003292 3300000043 Bacteria 1605
3 JGI24741J21665_1001268 3300001915 Bacteria 7416
4 JGI24740J21852_10015875 3300001979 Bacteria 2736
5 JGI24740J21852_10048828 3300001979 Bacteria 1227
6 JGI24739J22299_10001115 3300001989 Bacteria 10004
7 JGI24739J22299_10004309 3300001989 Bacteria 5453
8 JGI24739J22299_10024538 3300001989 Bacteria 2125
9 JGI24739J22299_10063196 3300001989 Bacteria 1166
10 JGI24739J22299_10084786 3300001989 Bacteria 969
11 JGI24737J22298_10009754 3300001990 Bacteria 3182
12 JGI24737J22298_10012289 3300001990 Bacteria 2791
13 JGI24737J22298_10012493 3300001990 Bacteria 2769
14 JGI24737J22298_10042752 3300001990 Bacteria 1388
15 JGI24735J21928_10000517 3300002067 Bacteria 13668
16 JGI24735J21928_10000834 3300002067 Bacteria 10966
17 JGI24735J21928_10003257 3300002067 Bacteria 5554
18 JGI24735J21928_10011036 3300002067 Bacteria 2869
19 JGI24735J21928_10023805 3300002067 Bacteria 1856
20 JGI24738J21930_10000121 3300002075 Bacteria 18616
21 JGI24738J21930_10000227 3300002075 Bacteria 15280
22 JGI24738J21930_10013722 3300002075 Bacteria 1747
23 JGI25150J39212_1000614 3300002774 Bacteria 13625
24 JGI25153J46596_10000064 3300003215 Bacteria 125642
25 rootH1_10000559 3300003323 Bacteria 1584
26 rootH1_10033822 3300003323 Bacteria 1724
27 Ga0055525_1000012 3300003759 Bacteria 486564
28 Ga0055542_1000094 3300003762 Bacteria 119899
29 Ga0055529_1000045 3300003763 Bacteria 209617
30 Ga0055526_1003211 3300003771 Bacteria 10555
31 Ga0055537_1001677 3300003773 Bacteria 8220
32 Ga0055530_10002780 3300003791 Bacteria 10799
33 Ga0055530_10030210 3300003791 Bacteria 1439
34 Ga0055540_1002539 3300003792 Bacteria 9522
35 Ga0055531_10000165 3300003794 Bacteria 74768
36 Ga0055543_1034503 3300004625 Bacteria 872
37 Ga0065165_1003207 3300005262 Bacteria 11920
38 Ga0065165_1004639 3300005262 Bacteria 8333
39 Ga0065165_1010686 3300005262 Bacteria 3930
40 Ga0065165_1025320 3300005262 Bacteria 1977
41 Ga0070658_10000193 3300005327 Bacteria 53795
42 Ga0070658_10000472 3300005327 Bacteria 34823
43 Ga0070658_10003099 3300005327 Bacteria 13707
44 Ga0070658_10018346 3300005327 Bacteria 5602
45 Ga0070658_10077825 3300005327 Bacteria 2721
46 Ga0070658_10554105 3300005327 Bacteria 995
47 Ga0070676_10192022 3300005328 Bacteria 1334
48 Ga0070683_100601907 3300005329 Bacteria 1052
49 Ga0070670_100002038 3300005331 Bacteria 16529
50 Ga0068869_100000737 3300005334 Bacteria 18590
51 Ga0070666_10084082 3300005335 Bacteria 2178
52 Ga0070680_100073214 3300005336 Bacteria 2817
53 Ga0068868_100000217 3300005338 Bacteria 38869
54 Ga0068868_100149468 3300005338 Bacteria 1923
55 Ga0070660_100001054 3300005339 Bacteria 18548
56 Ga0070660_100028700 3300005339 Bacteria 4165
57 Ga0070660_100090818 3300005339 Bacteria 2408
58 Ga0070660_100253905 3300005339 Bacteria 1434
59 Ga0070660_100559900 3300005339 Bacteria 954
60 Ga0070661_100003201 3300005344 Bacteria 11278
61 Ga0070661_100206562 3300005344 Bacteria 1502
62 Ga0070661_100221813 3300005344 Bacteria 1450
63 Ga0070668_100001275 3300005347 Bacteria 18002
64 Ga0070668_100254202 3300005347 Bacteria 1460
65 Ga0070675_100014593 3300005354 Bacteria 6195
66 Ga0070671_100012203 3300005355 Bacteria 6914
67 Ga0070674_100016481 3300005356 Bacteria 4632
68 Ga0070674_100018413 3300005356 Bacteria 4415
69 Ga0070674_100022471 3300005356 Bacteria 4069
70 Ga0070673_100000064 3300005364 Bacteria 43942
71 Ga0070673_100042968 3300005364 Bacteria 3489
72 Ga0070659_100078530 3300005366 Bacteria 2633
73 Ga0070667_100011055 3300005367 Bacteria 7467
74 Ga0070667_100040602 3300005367 Bacteria 3902
75 Ga0070667_100201168 3300005367 Bacteria 1768
76 Ga0070663_100008593 3300005455 Bacteria 6290
77 Ga0070663_100263442 3300005455 Bacteria 1368
78 Ga0070678_100012169 3300005456 Bacteria 5337
79 Ga0070678_100012931 3300005456 Bacteria 5212
80 Ga0070662_100018215 3300005457 Bacteria 4747
81 Ga0070662_100072862 3300005457 Bacteria 2537
82 Ga0070662_100161652 3300005457 Bacteria 1752
83 Ga0070662_100383219 3300005457 Bacteria 1158
84 Ga0068867_100000008 3300005459 Bacteria 143488
85 Ga0068867_100077986 3300005459 Bacteria 2491
86 Ga0068867_100922757 3300005459 Bacteria 787
87 Ga0070679_100671491 3300005530 Bacteria 979
88 Ga0070684_100343379 3300005535 Bacteria 1373
89 Ga0068853_100019636 3300005539 Bacteria 5609
90 Ga0068853_100027770 3300005539 Bacteria 4757
91 Ga0068853_100075734 3300005539 Bacteria 2937
92 Ga0068853_100379148 3300005539 Bacteria 1320
93 Ga0070672_100032771 3300005543 Bacteria 3926
94 Ga0070672_100412510 3300005543 Bacteria 1159
95 Ga0070665_100442008 3300005548 Bacteria 1310
96 Ga0070665_100730451 3300005548 Bacteria 1003
97 Ga0068855_100008632 3300005563 Bacteria 12312
98 Ga0068855_100189120 3300005563 Bacteria 2323
99 Ga0070664_100105086 3300005564 Bacteria 2459
100 Ga0070664_100208601 3300005564 Bacteria 1745
101 Ga0068857_100200173 3300005577 Bacteria 1820
102 Ga0068857_100460476 3300005577 Bacteria 1190
103 Ga0068854_100000051 3300005578 Bacteria 86667
104 Ga0068854_100010070 3300005578 Bacteria 6122
105 Ga0068856_100072458 3300005614 Bacteria 3410
106 Ga0068856_100189871 3300005614 Bacteria 2068
107 Ga0068852_100007240 3300005616 Bacteria 8092
108 Ga0068852_100285578 3300005616 Bacteria 1592
109 Ga0068859_100087994 3300005617 Bacteria 3155
110 Ga0068859_100150778 3300005617 Bacteria 2400
111 Ga0068864_100002808 3300005618 Bacteria 14382
112 Ga0068866_10159671 3300005718 Bacteria 1313
113 Ga0068851_10008789 3300005834 Bacteria 4680
114 Ga0068863_100003733 3300005841 Bacteria 15059
115 Ga0068863_100020855 3300005841 Bacteria 6257
116 Ga0068863_100846872 3300005841 Bacteria 913
117 Ga0068860_100000999 3300005843 Bacteria 31328
118 Ga0068862_100003133 3300005844 Bacteria 14381
119 Ga0075366_10054214 3300006195 Bacteria 2381
120 Ga0097621_100038585 3300006237 Bacteria 3833
121 Ga0068871_100008800 3300006358 Bacteria 7271
122 Ga0068865_100000093 3300006881 Bacteria 47577
123 Ga0097620_100010326 3300006931 Bacteria 9400
124 Ga0097620_100087996 3300006931 Bacteria 3155
125 Ga0097620_100150781 3300006931 Bacteria 2400
126 Ga0105240_10068237 3300009093 Bacteria 4404
127 Ga0105245_10000844 3300009098 Bacteria 27827
128 Ga0105247_10005970 3300009101 Bacteria 7586
129 Ga0105243_10000512 3300009148 Bacteria 39573
130 Ga0105243_10000679 3300009148 Bacteria 33211
131 Ga0105243_10074707 3300009148 Bacteria 2749
132 Ga0105243_10468161 3300009148 Bacteria 1186
133 Ga0105241_10008724 3300009174 Bacteria 7447
134 Ga0105241_10069646 3300009174 Bacteria 2728
135 Ga0105242_10001742 3300009176 Bacteria 17189
136 Ga0105248_10000061 3300009177 Bacteria 125706
137 Ga0105248_10001310 3300009177 Bacteria 27712
138 Ga0105248_10069898 3300009177 Bacteria 3943
139 Ga0105237_10479597 3300009545 Bacteria 1250
140 Ga0105238_10062752 3300009551 Bacteria 3716
141 Ga0105238_10546200 3300009551 Bacteria 1163
142 Ga0105249_10008099 3300009553 Bacteria 9163
143 Ga0105249_10016258 3300009553 Bacteria 6599
144 Ga0105249_10067322 3300009553 Bacteria 3299
145 Ga0105239_10111051 3300010375 Bacteria 3039
146 Ga0105239_10301250 3300010375 Bacteria 1805
147 Ga0105246_10006252 3300011119 Bacteria 7270
148 Ga0105246_10243374 3300011119 Bacteria 1423
149 Ga0157373_10004747 3300013100 Bacteria 10227
150 Ga0157373_10086053 3300013100 Bacteria 2215
151 Ga0157373_10102132 3300013100 Bacteria 2017
152 Ga0157373_10297108 3300013100 Bacteria 1146
153 Ga0157371_10000032 3300013102 Bacteria 230252
154 Ga0157371_10412644 3300013102 Bacteria 989
155 Ga0157370_10000288 3300013104 Bacteria 63948
156 Ga0157370_10230497 3300013104 Bacteria 1714
157 Ga0157369_10018668 3300013105 Bacteria 7774
158 Ga0157369_10026805 3300013105 Bacteria 6390
159 Ga0157374_10001034 3300013296 Bacteria 24127
160 Ga0157374_10026005 3300013296 Bacteria 5261
161 Ga0157374_10095194 3300013296 Bacteria 2847
162 Ga0157378_10001808 3300013297 Bacteria 19217
163 Ga0157372_10060555 3300013307 Bacteria 4236
164 Ga0157372_10139210 3300013307 Bacteria 2795
165 Ga0157372_10219717 3300013307 Bacteria 2203
166 Ga0157372_10505129 3300013307 Bacteria 1410
167 Ga0157375_10003075 3300013308 Bacteria 14483
168 Ga0163163_11195102 3300014325 Bacteria 823
169 Ga0157377_10104600 3300014745 Bacteria 1693
170 Ga0157379_10108726 3300014968 Bacteria 2490
171 Ga0157376_10000033 3300014969 Bacteria 163952
172 Ga0209563_100030 3300025230 Bacteria 489259
173 Ga0207425_1000228 3300025245 Bacteria 43864
174 Ga0209646_1014913 3300025246 Bacteria 1165
175 Ga0209026_1005105 3300025250 Bacteria 3634
176 Ga0209148_1000011 3300025254 Bacteria 1196503
177 Ga0209129_1001380 3300025258 Bacteria 13602
178 Ga0209233_1000041 3300025261 Bacteria 515463
179 Ga0209565_1000007 3300025263 Bacteria 784361
180 Ga0209565_1000180 3300025263 Bacteria 78672
181 Ga0209455_1000006 3300025272 Bacteria 1196503
182 Ga0209455_1000672 3300025272 Bacteria 20577
183 Ga0209673_1019036 3300025273 Bacteria 2477
184 Ga0209025_1001956 3300025294 Bacteria 23749
185 Ga0209564_1001991 3300025295 Bacteria 17896
186 Ga0209758_1000019 3300025297 Bacteria 743682
187 Ga0209758_1000023 3300025297 Bacteria 612453
188 Ga0209758_1037684 3300025297 Bacteria 1865
189 Ga0209050_1000001 3300025298 Bacteria 3563507
190 Ga0209050_1000010 3300025298 Bacteria 980454
191 Ga0209050_1004823 3300025298 Bacteria 8876
192 Ga0209256_1000008 3300025299 Bacteria 975723
193 Ga0207426_1066393 3300025302 Bacteria 1020
194 Ga0209051_1000415 3300025303 Bacteria 58919
195 Ga0209257_1000027 3300025304 Bacteria 703541
196 Ga0209257_1003123 3300025304 Bacteria 14803
197 Ga0209257_1009696 3300025304 Bacteria 5076
198 Ga0209257_1009862 3300025304 Bacteria 4989
199 Ga0209257_1014783 3300025304 Bacteria 3316
200 Ga0207656_10015393 3300025321 Bacteria 2959
201 Ga0207656_10059089 3300025321 Bacteria 1677
202 Ga0207713_1003190 3300025735 Bacteria 11338
203 Ga0207642_10062398 3300025899 Bacteria 1738
204 Ga0207710_10005783 3300025900 Bacteria 5306
205 Ga0207688_10057820 3300025901 Bacteria 2181
206 Ga0207680_10064425 3300025903 Bacteria 2247
207 Ga0207647_10005360 3300025904 Bacteria 9424
208 Ga0207647_10009808 3300025904 Bacteria 6788
209 Ga0207647_10010994 3300025904 Bacteria 6367
210 Ga0207645_10000439 3300025907 Bacteria 34509
211 Ga0207645_10084596 3300025907 Bacteria 2036
212 Ga0207705_10000027 3300025909 Bacteria 248863
213 Ga0207705_10000291 3300025909 Bacteria 46715
214 Ga0207705_10001096 3300025909 Bacteria 22035
215 Ga0207705_10005385 3300025909 Bacteria 9571
216 Ga0207705_10310700 3300025909 Bacteria 1210
217 Ga0207654_10002902 3300025911 Bacteria 8690
218 Ga0207654_10026105 3300025911 Bacteria 3160
219 Ga0207695_10006684 3300025913 Bacteria 14888
220 Ga0207695_10006756 3300025913 Bacteria 14796
221 Ga0207695_10022982 3300025913 Bacteria 7061
222 Ga0207671_10000800 3300025914 Bacteria 39901
223 Ga0207671_10005244 3300025914 Bacteria 12034
224 Ga0207671_10035644 3300025914 Bacteria 3691
225 Ga0207671_10105686 3300025914 Bacteria 2136
226 Ga0207660_10113599 3300025917 Bacteria 2042
227 Ga0207657_10001796 3300025919 Bacteria 23147
228 Ga0207657_10002835 3300025919 Bacteria 18615
229 Ga0207657_10028223 3300025919 Bacteria 5123
230 Ga0207657_10033720 3300025919 Bacteria 4612
231 Ga0207657_10151130 3300025919 Bacteria 1891
232 Ga0207657_10355555 3300025919 Bacteria 1155
233 Ga0207657_10490539 3300025919 Bacteria 963
234 Ga0207649_10000903 3300025920 Bacteria 18719
235 Ga0207649_10218946 3300025920 Bacteria 1355
236 Ga0207694_10002740 3300025924 Bacteria 14253
237 Ga0207694_10085710 3300025924 Bacteria 2480
238 Ga0207694_10353669 3300025924 Bacteria 1216
239 Ga0207650_10000638 3300025925 Bacteria 27850
240 Ga0207659_10007723 3300025926 Bacteria 6639
241 Ga0207687_10002088 3300025927 Bacteria 13657
242 Ga0207644_10000063 3300025931 Bacteria 78017
243 Ga0207644_10035113 3300025931 Bacteria 3511
244 Ga0207690_10000557 3300025932 Bacteria 24372
245 Ga0207690_10064514 3300025932 Bacteria 2501
246 Ga0207690_10069298 3300025932 Bacteria 2426
247 Ga0207690_10230974 3300025932 Bacteria 1420
248 Ga0207706_10008737 3300025933 Bacteria 9326
249 Ga0207706_10072821 3300025933 Bacteria 3021
250 Ga0207706_10139480 3300025933 Bacteria 2133
251 Ga0207706_10257318 3300025933 Bacteria 1524
252 Ga0207706_10538625 3300025933 Bacteria 1006
253 Ga0207686_10002143 3300025934 Bacteria 10854
254 Ga0207709_10000102 3300025935 Bacteria 132562
255 Ga0207709_10000145 3300025935 Bacteria 98629
256 Ga0207709_10184980 3300025935 Bacteria 1474
257 Ga0207669_10000118 3300025937 Bacteria 39673
258 Ga0207704_10000014 3300025938 Bacteria 164052
259 Ga0207691_10169465 3300025940 Bacteria 1912
260 Ga0207691_10749764 3300025940 Bacteria 822
261 Ga0207711_10000017 3300025941 Bacteria 441730
262 Ga0207711_10023487 3300025941 Bacteria 5162
263 Ga0207711_10049433 3300025941 Bacteria 3601
264 Ga0207711_10215882 3300025941 Bacteria 1753
265 Ga0207689_10000379 3300025942 Bacteria 41902
266 Ga0207661_10456917 3300025944 Bacteria 1164
267 Ga0207679_10846542 3300025945 Bacteria 835
268 Ga0207667_10000002 3300025949 Bacteria 895662
269 Ga0207667_10004542 3300025949 Bacteria 17006
270 Ga0207667_10070423 3300025949 Bacteria 3640
271 Ga0207667_10719528 3300025949 Bacteria 999
272 Ga0207651_10000015 3300025960 Bacteria 164178
273 Ga0207651_10131373 3300025960 Bacteria 1917
274 Ga0207712_10003796 3300025961 Bacteria 9532
275 Ga0207712_10004108 3300025961 Bacteria 9190
276 Ga0207712_10036427 3300025961 Bacteria 3351
277 Ga0207668_10001118 3300025972 Bacteria 15983
278 Ga0207640_10000163 3300025981 Bacteria 48375
279 Ga0207640_10010264 3300025981 Bacteria 5269
280 Ga0207640_10014937 3300025981 Bacteria 4482
281 Ga0207640_10023202 3300025981 Bacteria 3726
282 Ga0207640_10029834 3300025981 Bacteria 3352
283 Ga0207658_10000820 3300025986 Bacteria 25974
284 Ga0207658_10000863 3300025986 Bacteria 25346
285 Ga0207658_10264928 3300025986 Bacteria 1466
286 Ga0207677_10000062 3300026023 Bacteria 92263
287 Ga0207677_10088788 3300026023 Bacteria 2242
288 Ga0207639_10002451 3300026041 Bacteria 12445
289 Ga0207639_10004584 3300026041 Bacteria 9302
290 Ga0207639_10021304 3300026041 Bacteria 4654
291 Ga0207639_10033172 3300026041 Bacteria 3807
292 Ga0207639_10048963 3300026041 Bacteria 3201
293 Ga0207639_10213723 3300026041 Bacteria 1662
294 Ga0207678_10006963 3300026067 Bacteria 10036
295 Ga0207678_10162463 3300026067 Bacteria 1907
296 Ga0207678_10179504 3300026067 Bacteria 1808
297 Ga0207678_10562502 3300026067 Bacteria 998
298 Ga0207702_10004289 3300026078 Bacteria 12720
299 Ga0207702_10007833 3300026078 Bacteria 9061
300 Ga0207702_10068113 3300026078 Bacteria 3057
301 Ga0207641_10000008 3300026088 Bacteria 424415
302 Ga0207648_10000014 3300026089 Bacteria 163862
303 Ga0207648_10059152 3300026089 Bacteria 3342
304 Ga0207676_10000060 3300026095 Bacteria 118841
305 Ga0207674_10006677 3300026116 Bacteria 13554
306 Ga0207674_10039263 3300026116 Bacteria 4908
307 Ga0207674_10140343 3300026116 Bacteria 2376
308 Ga0207674_10272578 3300026116 Bacteria 1640
309 Ga0207674_10743525 3300026116 Bacteria 947
310 Ga0207683_10002173 3300026121 Bacteria 17223
311 Ga0207683_10002716 3300026121 Bacteria 15449
312 Ga0207683_10299162 3300026121 Bacteria 1472
313 Ga0207698_10000487 3300026142 Bacteria 23098
314 Ga0207698_10016458 3300026142 Bacteria 4985
315 Ga0207698_10164483 3300026142 Bacteria 1945
316 Ga0207698_10362795 3300026142 Bacteria 1372
317 Ga0207698_10795084 3300026142 Bacteria 948
318 Ga0268265_10000011 3300028380 Bacteria 343832
319 Ga0268264_10000345 3300028381 Bacteria 71600
320 Ga0268264_10041036 3300028381 Bacteria 3825
321 Ga0307517_10014276 3300028786 Bacteria 10686
322 Ga0307517_10021600 3300028786 Bacteria 8120
323 Ga0307513_10051260 3300031456 Bacteria 4454
324 Ga0307405_10450179 3300031731 Bacteria 1020
325 Ga0307410_10476606 3300031852 Bacteria 1023
326 Ga0307412_10000717 3300031911 Bacteria 19141
327 Ga0307412_10007519 3300031911 Bacteria 6187
328 Ga0307412_10069703 3300031911 Bacteria 2394
329 Ga0307412_10227146 3300031911 Bacteria 1435
330 Ga0307412_10401092 3300031911 Bacteria 1116
331 Ga0307416_100375741 3300032002 Bacteria 1449
332 Ga0307416_100834912 3300032002 Bacteria 1019
333 Ga0307416_100874209 3300032002 Bacteria 998
334 Ga0307510_10055253 3300033180 Bacteria 4149
335 Ga0395899_0001393 3300037312 Bacteria 20735
336 Ga0395899_0166457 3300037312 Bacteria 1555
337 Ga0395900_0007203 3300037418 Bacteria 11525
338 Ga0395905_0017562 3300037471 Bacteria 6791
339 Ga0395905_0051879 3300037471 Bacteria 3842
340 Ga0395905_0053572 3300037471 Bacteria 3776
341 Ga0436365_0893373 3300039437 Bacteria 1360
342 Ga0439436_0005431 3300041404 Bacteria 3905
343 Ga0439436_0007341 3300041404 Bacteria 3392
344 Ga0439439_0005349 3300041406 Bacteria 2928
345 Ga0439461_0000091 3300041410 Bacteria 11870
346 Ga0439461_0002112 3300041410 Bacteria 3144
347 Ga0439465_0002362 3300041413 Bacteria 6189
348 Ga0439465_0004010 3300041413 Bacteria 4799
349 Ga0451798_1045537 3300041458 Bacteria 2162
350 Ga0451849_1232889 3300041505 Bacteria 975
351 Ga0439431_0001409 3300041997 Bacteria 5306
352 Ga0439431_0019251 3300041997 Bacteria 1621
353 Ga0439433_0049647 3300041999 Bacteria 988
354 Ga0439445_0001512 3300042004 Bacteria 5054
355 Ga0439445_0024960 3300042004 Bacteria 1522
356 Ga0439448_0006476 3300042005 Bacteria 3370
357 Ga0439448_0019053 3300042005 Bacteria 2109
358 Ga0439432_000977 3300042006 Bacteria 10805
359 Ga0439432_052631 3300042006 Bacteria 1267
360 Ga0439452_010005 3300042010 Bacteria 2774
361 Ga0439455_0000562 3300042012 Bacteria 5287
362 Ga0439455_0005812 3300042012 Bacteria 2526
363 Ga0439457_018370 3300042014 Bacteria 1553
364 Ga0439462_0000203 3300042015 Bacteria 10309
365 Ga0439462_0004166 3300042015 Bacteria 3517
366 Ga0450920_011955 3300042122 Bacteria 1623
367 Ga0450894_004385 3300042131 Bacteria 1833
368 Ga0439446_0030427 3300042156 Bacteria 1560
369 Ga0439446_0162723 3300042156 Bacteria 739
370 Ga0439458_0004316 3300042157 Bacteria 3271
371 Ga0450909_008779 3300042185 Bacteria 1471
372 Ga0439434_0001327 3300042435 Bacteria 7133
373 Ga0439434_0002073 3300042435 Bacteria 5788
374 Ga0466972_0004641 3300044658 Bacteria 6882
375 Ga0466965_0011951 3300044683 Bacteria 4075
376 Ga0466961_0003592 3300044693 Bacteria 9678
377 Ga0466963_0004889 3300044694 Bacteria 7813
378 Ga0466964_0004566 3300044706 Bacteria 5122
379 Ga0466971_0004636 3300044719 Bacteria 5939
380 Ga0466968_0000516 3300044735 Bacteria 13114
381 Ga0466970_0055156 3300044765 Bacteria 2122
382 Ga0466970_0246753 3300044765 Bacteria 1000
383 Ga0466957_0253696 3300044842 Bacteria 1170
384 Ga0466960_0002398 3300044901 Bacteria 7058
385 Ga0466959_0008278 3300045049 Bacteria 7344
386 Ga0466959_0391255 3300045049 Bacteria 945
387 Ga0466958_0040499 3300045836 Bacteria 2800
388 Ga0466958_0104145 3300045836 Bacteria 1767
389 Ga0495638_0001805 3300046460 Bacteria 18647
390 Ga0495638_0211879 3300046460 Bacteria 1088
391 Ga0495638_0248484 3300046460 Bacteria 981
392 Ga0495650_0000302 3300046471 Bacteria 89516
393 Ga0495584_0053582 3300046491 Bacteria 2030
394 Ga0495584_0266871 3300046491 Bacteria 870
395 Ga0495585_0122475 3300046492 Bacteria 1375
396 Ga0495583_0000426 3300046506 Bacteria 63627
397 Ga0495583_0001733 3300046506 Bacteria 20909
398 Ga0495583_0052388 3300046506 Bacteria 1856
399 Ga0495606_0001599 3300046507 Bacteria 29536
400 Ga0495606_0007200 3300046507 Bacteria 10035
401 Ga0495606_0038079 3300046507 Bacteria 3257
402 Ga0495610_0246845 3300046512 Bacteria 709
403 Ga0495616_0044143 3300046513 Bacteria 2262
404 Ga0495643_0002197 3300046522 Bacteria 15923
405 Ga0495643_0002309 3300046522 Bacteria 15381
406 Ga0495643_0042363 3300046522 Bacteria 2480
407 Ga0495643_0057575 3300046522 Bacteria 2071
408 Ga0495643_0074081 3300046522 Bacteria 1784
409 Ga0495643_0094690 3300046522 Bacteria 1537
410 Ga0495648_0000143 3300046524 Bacteria 85539
411 Ga0495648_0035974 3300046524 Bacteria 3203
412 Ga0495663_0016672 3300046525 Bacteria 2077
413 Ga0495587_0080495 3300046536 Bacteria 1888
414 Ga0495597_0058691 3300046542 Bacteria 1681
415 Ga0495622_0041367 3300046557 Bacteria 2143
416 Ga0495633_0011822 3300046558 Bacteria 4680
417 Ga0495633_0035038 3300046558 Bacteria 2411
418 Ga0495668_0000016 3300046616 Bacteria 438197
419 Ga0495668_0035813 3300046616 Bacteria 2781
420 Ga0495611_0007268 3300046648 Bacteria 4705
421 Ga0495611_0111033 3300046648 Bacteria 1276
422 Ga0495611_0235948 3300046648 Bacteria 849
423 Ga0495625_0038263 3300046660 Bacteria 3513
424 Ga0495625_0122815 3300046660 Bacteria 1765
425 Ga0495625_0133511 3300046660 Bacteria 1680
426 Ga0495661_0136550 3300046665 Bacteria 1338
427 Ga0495669_0000050 3300046684 Bacteria 80688
428 Ga0495669_0045014 3300046684 Bacteria 1967
429 Ga0495670_0000006 3300046691 Bacteria 255322
430 Ga0495649_0171911 3300046694 Bacteria 1133
431 Ga0495600_0001060 3300046809 Bacteria 14894
432 Ga0495683_0005106 3300047323 Bacteria 7330
433 Ga0495683_0046179 3300047323 Bacteria 2186
434 Ga0495687_000648 3300047443 Bacteria 39841
435 Ga0495687_000694 3300047443 Bacteria 38010
436 Ga0495677_0083505 3300047445 Bacteria 1199
437 Ga0495681_0017776 3300047470 Bacteria 3937
438 Ga0495681_0019925 3300047470 Bacteria 3649
439 Ga0495686_0000137 3300047472 Bacteria 148290
440 Ga0495686_0000650 3300047472 Bacteria 47482
441 Ga0495686_0003978 3300047472 Bacteria 12382
442 Ga0495686_0062714 3300047472 Bacteria 2305
443 Ga0496102_0000199 3300048905 Bacteria 81435
444 Ga0496103_0000131 3300048906 Bacteria 79787
445 Ga0496103_0033379 3300048906 Bacteria 3144
446 Ga0496104_0021824 3300048907 Bacteria 5880
447 Ga0496105_0000344 3300048908 Bacteria 30542
448 Ga0496110_0005650 3300048913 Bacteria 9814
449 Ga0496111_0282401 3300048914 Bacteria 1231
450 Ga0496113_0053597 3300048916 Bacteria 3016
451 Ga0496114_0036561 3300048917 Bacteria 4059
452 Ga0496115_0000133 3300048918 Bacteria 67951
453 Ga0496115_0008205 3300048918 Bacteria 7717
454 Ga0496116_0078484 3300048919 Bacteria 2059
455 Ga0496117_0000352 3300048920 Bacteria 81089
456 Ga0496117_0021867 3300048920 Bacteria 5155
457 Ga0496118_0000092 3300048921 Bacteria 169106
458 Ga0496118_0002341 3300048921 Bacteria 25696
459 Ga0496118_0258415 3300048921 Bacteria 985
460 Ga0496119_0054331 3300048922 Bacteria 2439
461 Ga0496120_0020743 3300048923 Bacteria 4168
462 Ga0496120_0024610 3300048923 Bacteria 3750
463 Ga0496121_0000228 3300048924 Bacteria 120653
464 Ga0496122_0014512 3300048925 Bacteria 7605
465 Ga0496122_0137751 3300048925 Bacteria 1534
466 Ga0496123_0001165 3300048926 Bacteria 38914
467 Ga0496123_0077680 3300048926 Bacteria 2038
468 Ga0496123_0126045 3300048926 Bacteria 1429
469 Ga0496123_0145564 3300048926 Bacteria 1288
470 Ga0496123_0177673 3300048926 Bacteria 1115
471 Ga0496124_0000081 3300048927 Bacteria 208413
472 Ga0496124_0000325 3300048927 Bacteria 88310
473 Ga0496124_0001159 3300048927 Bacteria 41313
474 Ga0496124_0041227 3300048927 Bacteria 3986
475 Ga0496124_0064655 3300048927 Bacteria 3053
476 Ga0496125_0001320 3300048928 Bacteria 36659
477 Ga0496125_0025486 3300048928 Bacteria 5414
478 Ga0496125_0385834 3300048928 Bacteria 824
479 Ga0496126_0000283 3300048929 Bacteria 107129
480 Ga0501034_0109228 3300049571 Bacteria 2757
481 Ga0501047_0506942 3300049581 Bacteria 1033
482 Ga0501241_007337 3300049758 Bacteria 2019
483 Ga0501282_008133 3300049778 Bacteria 1124
484 nmdc:mga0k408_50009_c1 3300050493 Bacteria 2419
485 nmdc:mga0qj67_6321_c1 3300050509 Bacteria 8697
486 Ga0500610_0000963 3300053079 Bacteria 9353
487 Ga0500643_000065 3300053087 Bacteria 119995
488 Ga0500643_042617 3300053087 Bacteria 1327
489 Ga0500583_0295531 3300053092 Bacteria 793
490 Ga0500566_0000251 3300053094 Bacteria 28795
491 Ga0500555_000281 3300053103 Bacteria 22097
492 Ga0500594_0008261 3300053118 Bacteria 2368
493 Ga0500595_000504 3300053119 Bacteria 23584
494 Ga0500595_000609 3300053119 Bacteria 21343
495 Ga0500618_006067 3300053125 Bacteria 3584
496 Ga0500642_0001024 3300053130 Bacteria 8043
497 Ga0500642_0002144 3300053130 Bacteria 5736
498 Ga0500655_000338 3300053133 Bacteria 10331
499 Ga0500658_0000246 3300053134 Bacteria 25414
500 Ga0500568_0007031 3300053139 Bacteria 5565
501 Ga0500573_0000022 3300053140 Bacteria 154562
502 Ga0500577_0006763 3300053142 Bacteria 3182
503 Ga0500590_000023 3300053148 Bacteria 41133
504 Ga0500604_0011143 3300053151 Bacteria 2411
505 Ga0500616_0073977 3300053153 Bacteria 1728
506 Ga0500619_037184 3300053154 Bacteria 1519
507 Ga0500627_0001068 3300053158 Bacteria 7462
508 Ga0500639_133539 3300053163 Bacteria 1172
509 Ga0500570_000177 3300053724 Bacteria 19968
510 Ga0500645_000221 3300053730 Bacteria 43327
511 Ga0500645_005206 3300053730 Bacteria 4840
512 Ga0500596_011267 3300053735 Bacteria 1369
513 Ga0466962_0008313 3300061719 Bacteria 4972
514 2585261021 2582581305 Bacteria 4895574
515 2600203324 2599185354 Bacteria 4398675
516 2600227563 2599185359 Bacteria 4772316
517 2644125435 2643221622 Bacteria 4212502
518 2753765873 2751185897 Bacteria 5322941
519 2819716144 2818991466 Bacteria 4748179
520 2830076857 2830075706 Bacteria 3855215
521 2879164070 2879163058 Bacteria 4223965
522 2928528205 2928526807 Bacteria 4760224
523 2928971290 2928968154 Bacteria 4633371
524 2990269080 2990265787 Bacteria 3943888
525 2993694783 2993693658 Bacteria 4040749
526 Ga0105237_10039305
527 ARcpr5yngRDRAFT_c003292
528 JGI24741J21665_1001268
529 JGI24740J21852_10015875
530 JGI24740J21852_10048828
531 JGI24739J22299_10001115
532 JGI24739J22299_10004309
533 JGI24739J22299_10024538
534 JGI24739J22299_10063196
535 JGI24739J22299_10084786
536 JGI24737J22298_10009754
537 JGI24737J22298_10012289
538 JGI24737J22298_10012493
539 JGI24737J22298_10042752
540 JGI24735J21928_10000517
541 JGI24735J21928_10000834
542 JGI24735J21928_10003257
543 JGI24735J21928_10011036
544 JGI24735J21928_10023805
545 JGI24738J21930_10000121
546 JGI24738J21930_10000227
547 JGI24738J21930_10013722
548 JGI25150J39212_1000614
549 JGI25153J46596_10000064
550 rootH1_10000559
551 rootH1_10033822
552 Ga0055525_1000012
553 Ga0055542_1000094
554 Ga0055529_1000045
555 Ga0055526_1003211
556 Ga0055537_1001677
557 Ga0055530_10002780
558 Ga0055530_10030210
559 Ga0055540_1002539
560 Ga0055531_10000165
561 Ga0055543_1034503
562 Ga0065165_1003207
563 Ga0065165_1004639
564 Ga0065165_1010686
565 Ga0065165_1025320
566 Ga0070658_10000193
567 Ga0070658_10000472
568 Ga0070658_10003099
569 Ga0070658_10018346
570 Ga0070658_10077825
571 Ga0070658_10554105
572 Ga0070676_10192022
573 Ga0070683_100601907
574 Ga0070670_100002038
575 Ga0068869_100000737
576 Ga0070666_10084082
577 Ga0070680_100073214
578 Ga0068868_100000217
579 Ga0068868_100149468
580 Ga0070660_100001054
581 Ga0070660_100028700
582 Ga0070660_100090818
583 Ga0070660_100253905
584 Ga0070660_100559900
585 Ga0070661_100003201
586 Ga0070661_100206562
587 Ga0070661_100221813
588 Ga0070668_100001275
589 Ga0070668_100254202
590 Ga0070675_100014593
591 Ga0070671_100012203
592 Ga0070674_100016481
593 Ga0070674_100018413
594 Ga0070674_100022471
595 Ga0070673_100000064
596 Ga0070673_100042968
597 Ga0070659_100078530
598 Ga0070667_100011055
599 Ga0070667_100040602
600 Ga0070667_100201168
601 Ga0070663_100008593
602 Ga0070663_100263442
603 Ga0070678_100012169
604 Ga0070678_100012931
605 Ga0070662_100018215
606 Ga0070662_100072862
607 Ga0070662_100161652
608 Ga0070662_100383219
609 Ga0068867_100000008
610 Ga0068867_100077986
611 Ga0068867_100922757
612 Ga0070679_100671491
613 Ga0070684_100343379
614 Ga0068853_100019636
615 Ga0068853_100027770
616 Ga0068853_100075734
617 Ga0068853_100379148
618 Ga0070672_100032771
619 Ga0070672_100412510
620 Ga0070665_100442008
621 Ga0070665_100730451
622 Ga0068855_100008632
623 Ga0068855_100189120
624 Ga0070664_100105086
625 Ga0070664_100208601
626 Ga0068857_100200173
627 Ga0068857_100460476
628 Ga0068854_100000051
629 Ga0068854_100010070
630 Ga0068856_100072458
631 Ga0068856_100189871
632 Ga0068852_100007240
633 Ga0068852_100285578
634 Ga0068859_100087994
635 Ga0068859_100150778
636 Ga0068864_100002808
637 Ga0068866_10159671
638 Ga0068851_10008789
639 Ga0068863_100003733
640 Ga0068863_100020855
641 Ga0068863_100846872
642 Ga0068860_100000999
643 Ga0068862_100003133
644 Ga0075366_10054214
645 Ga0097621_100038585
646 Ga0068871_100008800
647 Ga0068865_100000093
648 Ga0097620_100010326
649 Ga0097620_100087996
650 Ga0097620_100150781
651 Ga0105240_10068237
652 Ga0105245_10000844
653 Ga0105247_10005970
654 Ga0105243_10000512
655 Ga0105243_10000679
656 Ga0105243_10074707
657 Ga0105243_10468161
658 Ga0105241_10008724
659 Ga0105241_10069646
660 Ga0105242_10001742
661 Ga0105248_10000061
662 Ga0105248_10001310
663 Ga0105248_10069898
664 Ga0105237_10479597
665 Ga0105238_10062752
666 Ga0105238_10546200
667 Ga0105249_10008099
668 Ga0105249_10016258
669 Ga0105249_10067322
670 Ga0105239_10111051
671 Ga0105239_10301250
672 Ga0105246_10006252
673 Ga0105246_10243374
674 Ga0157373_10004747
675 Ga0157373_10086053
676 Ga0157373_10102132
677 Ga0157373_10297108
678 Ga0157371_10000032
679 Ga0157371_10412644
680 Ga0157370_10000288
681 Ga0157370_10230497
682 Ga0157369_10018668
683 Ga0157369_10026805
684 Ga0157374_10001034
685 Ga0157374_10026005
686 Ga0157374_10095194
687 Ga0157378_10001808
688 Ga0157372_10060555
689 Ga0157372_10139210
690 Ga0157372_10219717
691 Ga0157372_10505129
692 Ga0157375_10003075
693 Ga0163163_11195102
694 Ga0157377_10104600
695 Ga0157379_10108726
696 Ga0157376_10000033
697 Ga0209563_100030
698 Ga0207425_1000228
699 Ga0209646_1014913
700 Ga0209026_1005105
701 Ga0209148_1000011
702 Ga0209129_1001380
703 Ga0209233_1000041
704 Ga0209565_1000007
705 Ga0209565_1000180
706 Ga0209455_1000006
707 Ga0209455_1000672
708 Ga0209673_1019036
709 Ga0209025_1001956
710 Ga0209564_1001991
711 Ga0209758_1000019
712 Ga0209758_1000023
713 Ga0209758_1037684
714 Ga0209050_1000001
715 Ga0209050_1000010
716 Ga0209050_1004823
717 Ga0209256_1000008
718 Ga0207426_1066393
719 Ga0209051_1000415
720 Ga0209257_1000027
721 Ga0209257_1003123
722 Ga0209257_1009696
723 Ga0209257_1009862
724 Ga0209257_1014783
725 Ga0207656_10015393
726 Ga0207656_10059089
727 Ga0207713_1003190
728 Ga0207642_10062398
729 Ga0207710_10005783
730 Ga0207688_10057820
731 Ga0207680_10064425
732 Ga0207647_10005360
733 Ga0207647_10009808
734 Ga0207647_10010994
735 Ga0207645_10000439
736 Ga0207645_10084596
737 Ga0207705_10000027
738 Ga0207705_10000291
739 Ga0207705_10001096
740 Ga0207705_10005385
741 Ga0207705_10310700
742 Ga0207654_10002902
743 Ga0207654_10026105
744 Ga0207695_10006684
745 Ga0207695_10006756
746 Ga0207695_10022982
747 Ga0207671_10000800
748 Ga0207671_10005244
749 Ga0207671_10035644
750 Ga0207671_10105686
751 Ga0207660_10113599
752 Ga0207657_10001796
753 Ga0207657_10002835
754 Ga0207657_10028223
755 Ga0207657_10033720
756 Ga0207657_10151130
757 Ga0207657_10355555
758 Ga0207657_10490539
759 Ga0207649_10000903
760 Ga0207649_10218946
761 Ga0207694_10002740
762 Ga0207694_10085710
763 Ga0207694_10353669
764 Ga0207650_10000638
765 Ga0207659_10007723
766 Ga0207687_10002088
767 Ga0207644_10000063
768 Ga0207644_10035113
769 Ga0207690_10000557
770 Ga0207690_10064514
771 Ga0207690_10069298
772 Ga0207690_10230974
773 Ga0207706_10008737
774 Ga0207706_10072821
775 Ga0207706_10139480
776 Ga0207706_10257318
777 Ga0207706_10538625
778 Ga0207686_10002143
779 Ga0207709_10000102
780 Ga0207709_10000145
781 Ga0207709_10184980
782 Ga0207669_10000118
783 Ga0207704_10000014
784 Ga0207691_10169465
785 Ga0207691_10749764
786 Ga0207711_10000017
787 Ga0207711_10023487
788 Ga0207711_10049433
789 Ga0207711_10215882
790 Ga0207689_10000379
791 Ga0207661_10456917
792 Ga0207679_10846542
793 Ga0207667_10000002
794 Ga0207667_10004542
795 Ga0207667_10070423
796 Ga0207667_10719528
797 Ga0207651_10000015
798 Ga0207651_10131373
799 Ga0207712_10003796
800 Ga0207712_10004108
801 Ga0207712_10036427
802 Ga0207668_10001118
803 Ga0207640_10000163
804 Ga0207640_10010264
805 Ga0207640_10014937
806 Ga0207640_10023202
807 Ga0207640_10029834
808 Ga0207658_10000820
809 Ga0207658_10000863
810 Ga0207658_10264928
811 Ga0207677_10000062
812 Ga0207677_10088788
813 Ga0207639_10002451
814 Ga0207639_10004584
815 Ga0207639_10021304
816 Ga0207639_10033172
817 Ga0207639_10048963
818 Ga0207639_10213723
819 Ga0207678_10006963
820 Ga0207678_10162463
821 Ga0207678_10179504
822 Ga0207678_10562502
823 Ga0207702_10004289
824 Ga0207702_10007833
825 Ga0207702_10068113
826 Ga0207641_10000008
827 Ga0207648_10000014
828 Ga0207648_10059152
829 Ga0207676_10000060
830 Ga0207674_10006677
831 Ga0207674_10039263
832 Ga0207674_10140343
833 Ga0207674_10272578
834 Ga0207674_10743525
835 Ga0207683_10002173
836 Ga0207683_10002716
837 Ga0207683_10299162
838 Ga0207698_10000487
839 Ga0207698_10016458
840 Ga0207698_10164483
841 Ga0207698_10362795
842 Ga0207698_10795084
843 Ga0268265_10000011
844 Ga0268264_10000345
845 Ga0268264_10041036
846 Ga0307517_10014276
847 Ga0307517_10021600
848 Ga0307513_10051260
849 Ga0307405_10450179
850 Ga0307410_10476606
851 Ga0307412_10000717
852 Ga0307412_10007519
853 Ga0307412_10069703
854 Ga0307412_10227146
855 Ga0307412_10401092
856 Ga0307416_100375741
857 Ga0307416_100834912
858 Ga0307416_100874209
859 Ga0307510_10055253
860 Ga0395899_0001393
861 Ga0395899_0166457
862 Ga0395900_0007203
863 Ga0395905_0017562
864 Ga0395905_0051879
865 Ga0395905_0053572
866 Ga0436365_0893373
867 Ga0439436_0005431
868 Ga0439436_0007341
869 Ga0439439_0005349
870 Ga0439461_0000091
871 Ga0439461_0002112
872 Ga0439465_0002362
873 Ga0439465_0004010
874 Ga0451798_1045537
875 Ga0451849_1232889
876 Ga0439431_0001409
877 Ga0439431_0019251
878 Ga0439433_0049647
879 Ga0439445_0001512
880 Ga0439445_0024960
881 Ga0439448_0006476
882 Ga0439448_0019053
883 Ga0439432_000977
884 Ga0439432_052631
885 Ga0439452_010005
886 Ga0439455_0000562
887 Ga0439455_0005812
888 Ga0439457_018370
889 Ga0439462_0000203
890 Ga0439462_0004166
891 Ga0450920_011955
892 Ga0450894_004385
893 Ga0439446_0030427
894 Ga0439446_0162723
895 Ga0439458_0004316
896 Ga0450909_008779
897 Ga0439434_0001327
898 Ga0439434_0002073
899 Ga0466972_0004641
900 Ga0466965_0011951
901 Ga0466961_0003592
902 Ga0466963_0004889
903 Ga0466964_0004566
904 Ga0466971_0004636
905 Ga0466968_0000516
906 Ga0466970_0055156
907 Ga0466970_0246753
908 Ga0466957_0253696
909 Ga0466960_0002398
910 Ga0466959_0008278
911 Ga0466959_0391255
912 Ga0466958_0040499
913 Ga0466958_0104145
914 Ga0495638_0001805
915 Ga0495638_0211879
916 Ga0495638_0248484
917 Ga0495650_0000302
918 Ga0495584_0053582
919 Ga0495584_0266871
920 Ga0495585_0122475
921 Ga0495583_0000426
922 Ga0495583_0001733
923 Ga0495583_0052388
924 Ga0495606_0001599
925 Ga0495606_0007200
926 Ga0495606_0038079
927 Ga0495610_0246845
928 Ga0495616_0044143
929 Ga0495643_0002197
930 Ga0495643_0002309
931 Ga0495643_0042363
932 Ga0495643_0057575
933 Ga0495643_0074081
934 Ga0495643_0094690
935 Ga0495648_0000143
936 Ga0495648_0035974
937 Ga0495663_0016672
938 Ga0495587_0080495
939 Ga0495597_0058691
940 Ga0495622_0041367
941 Ga0495633_0011822
942 Ga0495633_0035038
943 Ga0495668_0000016
944 Ga0495668_0035813
945 Ga0495611_0007268
946 Ga0495611_0111033
947 Ga0495611_0235948
948 Ga0495625_0038263
949 Ga0495625_0122815
950 Ga0495625_0133511
951 Ga0495661_0136550
952 Ga0495669_0000050
953 Ga0495669_0045014
954 Ga0495670_0000006
955 Ga0495649_0171911
956 Ga0495600_0001060
957 Ga0495683_0005106
958 Ga0495683_0046179
959 Ga0495687_000648
960 Ga0495687_000694
961 Ga0495677_0083505
962 Ga0495681_0017776
963 Ga0495681_0019925
964 Ga0495686_0000137
965 Ga0495686_0000650
966 Ga0495686_0003978
967 Ga0495686_0062714
968 Ga0496102_0000199
969 Ga0496103_0000131
970 Ga0496103_0033379
971 Ga0496104_0021824
972 Ga0496105_0000344
973 Ga0496110_0005650
974 Ga0496111_0282401
975 Ga0496113_0053597
976 Ga0496114_0036561
977 Ga0496115_0000133
978 Ga0496115_0008205
979 Ga0496116_0078484
980 Ga0496117_0000352
981 Ga0496117_0021867
982 Ga0496118_0000092
983 Ga0496118_0002341
984 Ga0496118_0258415
985 Ga0496119_0054331
986 Ga0496120_0020743
987 Ga0496120_0024610
988 Ga0496121_0000228
989 Ga0496122_0014512
990 Ga0496122_0137751
991 Ga0496123_0001165
992 Ga0496123_0077680
993 Ga0496123_0126045
994 Ga0496123_0145564
995 Ga0496123_0177673
996 Ga0496124_0000081
997 Ga0496124_0000325
998 Ga0496124_0001159
999 Ga0496124_0041227
1000 Ga0496124_0064655
1001 Ga0496125_0001320
1002 Ga0496125_0025486
1003 Ga0496125_0385834
1004 Ga0496126_0000283
1005 Ga0501034_0109228
1006 Ga0501047_0506942
1007 Ga0501241_007337
1008 Ga0501282_008133
1009 nmdc:mga0k408_50009_c1
1010 nmdc:mga0qj67_6321_c1
1011 Ga0500610_0000963
1012 Ga0500643_000065
1013 Ga0500643_042617
1014 Ga0500583_0295531
1015 Ga0500566_0000251
1016 Ga0500555_000281
1017 Ga0500594_0008261
1018 Ga0500595_000504
1019 Ga0500595_000609
1020 Ga0500618_006067
1021 Ga0500642_0001024
1022 Ga0500642_0002144
1023 Ga0500655_000338
1024 Ga0500658_0000246
1025 Ga0500568_0007031
1026 Ga0500573_0000022
1027 Ga0500577_0006763
1028 Ga0500590_000023
1029 Ga0500604_0011143
1030 Ga0500616_0073977
1031 Ga0500619_037184
1032 Ga0500627_0001068
1033 Ga0500639_133539
1034 Ga0500570_000177
1035 Ga0500645_000221
1036 Ga0500645_005206
1037 Ga0500596_011267
1038 Ga0466962_0008313
1039 2585261021
1040 2600203324
1041 2600227563
1042 2644125435
1043 2753765873
1044 2819716144
1045 2830076857
1046 2879164070
1047 2928528205
1048 2928971290
1049 2990269080
1050 2993694783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

79

249

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8801 26 226
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8654 26 226
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8595 26 226
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.8575 45 226
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.838 26 226
ID Description Score Start End Superfamily
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8801 26 226 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8765 53 114 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8679 53 105 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8595 26 226 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8457 50 115 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A841L8J5-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9464 27 226 GO:0008176
GO:0043527
AF-A0A7X8ZMX3-F1-model_v4 tRNA (Guanosine(46)-N7)-methyltransferase TrmB 0.9449 19 106 GO:0008176
GO:0043527
AF-A0A841L8J5-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9327 27 226 GO:0008176
GO:0043527
AF-A0A800CDJ2-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9265 19 105 GO:0008176
GO:0043527
AF-A0A2S6QWI2-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9264 19 225 GO:0008176
GO:0043527

Map