F459270

General Info

Members Datasets Scaffolds Average Seq Length
525 243 1050 224

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10066605|Ga0157372_100666055
Length 232
Sequence VRAQAGMKPLPPTLEGVLFDLDGTLLDSAPDLYAALKRQCEEEGAPVPPYAPVREVVSRGARAVLRCAFGQLGEPAVEARVDRYLELYGAVMGQATRPFEGIEPMLDQLEAAGVRWGIVTNKAGFLTDELLRRIGWAGRASAVVSGDTLPVKKPDPAPVRLACERAGIDPIRSLFVGDDRRDVMAGAAAGLYTVAVAWGYLDGGDPHEWNADAVLDTPDQFARWLRRGQAVA

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
78 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
221 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
222 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
223 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
224 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
225 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
226 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
227 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
228 2734482264 Dyella sp. AD052 Isolate Unclassified
229 2738543009 Luteibacter sp. OK325 Isolate Unclassified
230 2739367700 Dyella sp. YR388 Isolate Unclassified
231 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
232 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
233 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
234 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
235 2884411467 Dyella sp. AD56 Isolate Rhizosphere
236 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
237 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
238 2919085039 Luteibacter sp. 1214 Isolate Unclassified
239 2919404418 Luteibacter sp. 3190 Isolate Unclassified
240 2928963466 Dyella japonica 1073 Isolate Unclassified
241 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
242 2941471342 Luteibacter sp. 621 Isolate Unclassified
243 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.76
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.29
Nodule 0
Rhizoplane 3.24
Rhizosphere 59.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10066605 3300013307 Bacteria 4046
2 JGI24739J22299_10006098 3300001989 Bacteria 4555
3 JGI24737J22298_10003212 3300001990 Bacteria 5799
4 JGI25156J39149_1001926 3300002705 Bacteria 8053
5 JGI25156J39149_1004139 3300002705 Bacteria 4503
6 JGI25162J39368_1000163 3300002737 Bacteria 74121
7 JGI25162J39368_1000895 3300002737 Bacteria 19431
8 JGI25162J39368_1001009 3300002737 Bacteria 17538
9 JGI25162J39368_1001817 3300002737 Bacteria 10019
10 JGI25162J39368_1002271 3300002737 Bacteria 7765
11 JGI25154J39366_1002584 3300002738 Bacteria 4548
12 JGI25157J39369_1000229 3300002741 Bacteria 43921
13 JGI25157J39369_1000804 3300002741 Bacteria 15869
14 JGI25157J39369_1000996 3300002741 Bacteria 13204
15 JGI25157J39369_1001518 3300002741 Bacteria 8435
16 JGI25157J39369_1001578 3300002741 Bacteria 8041
17 JGI25163J39215_1001619 3300002771 Bacteria 3366
18 JGI25164J39214_1000045 3300002772 Bacteria 125909
19 JGI25164J39214_1000285 3300002772 Bacteria 35663
20 JGI25164J39214_1000895 3300002772 Bacteria 10019
21 JGI25164J39214_1001103 3300002772 Bacteria 7765
22 JGI25165J46597_1000072 3300003214 Bacteria 192184
23 JGI25165J46597_1000215 3300003214 Bacteria 81941
24 JGI25165J46597_1001691 3300003214 Bacteria 9962
25 JGI25153J46596_10055055 3300003215 Bacteria 1115
26 rootH1_10012190 3300003316 Bacteria 3610
27 rootH1_10058214 3300003316 Bacteria 2566
28 rootH2_10012587 3300003320 Bacteria 26291
29 rootH2_10076181 3300003320 Bacteria 1354
30 rootH2_10107780 3300003320 Bacteria 1811
31 rootH2_10157713 3300003320 Bacteria 1267
32 rootH2_10157714 3300003320 Bacteria 1384
33 rootL2_10172163 3300003322 Bacteria 2894
34 Ga0006562J51391_1014503 3300003578 Bacteria 8470
35 Ga0006562J51391_1014506 3300003578 Bacteria 6840
36 Ga0006562J51391_1182275 3300003578 Bacteria 5201
37 Ga0006562J51391_1182276 3300003578 Bacteria 3790
38 Ga0055538_1001562 3300003751 Bacteria 4207
39 Ga0055539_1002669 3300003752 Bacteria 2653
40 Ga0055539_1011031 3300003752 Bacteria 1116
41 Ga0055533_1000617 3300003756 Bacteria 12010
42 Ga0055533_1001642 3300003756 Bacteria 5755
43 Ga0055525_1000027 3300003759 Bacteria 340506
44 Ga0055527_1000082 3300003760 Bacteria 75048
45 Ga0055527_1000209 3300003760 Bacteria 37913
46 Ga0055527_1001667 3300003760 Bacteria 4381
47 Ga0055535_1000124 3300003761 Bacteria 81941
48 Ga0055535_1000143 3300003761 Bacteria 75049
49 Ga0055535_1000451 3300003761 Bacteria 37913
50 Ga0055535_1001467 3300003761 Bacteria 11877
51 Ga0055535_1001833 3300003761 Bacteria 9117
52 Ga0055542_1000190 3300003762 Bacteria 75049
53 Ga0055542_1000197 3300003762 Bacteria 74121
54 Ga0055542_1000466 3300003762 Bacteria 37913
55 Ga0055542_1001205 3300003762 Bacteria 14614
56 Ga0055542_1001440 3300003762 Bacteria 11865
57 Ga0055542_1001764 3300003762 Bacteria 9117
58 Ga0055542_1010406 3300003762 Bacteria 1700
59 Ga0055529_1000197 3300003763 Bacteria 81941
60 Ga0055529_1000204 3300003763 Bacteria 78293
61 Ga0055529_1000217 3300003763 Bacteria 75049
62 Ga0055529_1000671 3300003763 Bacteria 23784
63 Ga0065165_1000587 3300005262 Bacteria 53507
64 Ga0065165_1003615 3300005262 Bacteria 10615
65 Ga0070670_100062735 3300005331 Bacteria 3190
66 Ga0070666_10000005 3300005335 Bacteria 343092
67 Ga0070682_100005295 3300005337 Bacteria 7180
68 Ga0070682_100011835 3300005337 Bacteria 4991
69 Ga0070682_100635572 3300005337 Bacteria 848
70 Ga0070660_100015081 3300005339 Bacteria 5576
71 Ga0070660_100015362 3300005339 Bacteria 5525
72 Ga0070689_100000503 3300005340 Bacteria 23097
73 Ga0070661_100007160 3300005344 Bacteria 7692
74 Ga0070661_100019917 3300005344 Bacteria 4782
75 Ga0070661_100027284 3300005344 Bacteria 4110
76 Ga0070692_10017423 3300005345 Bacteria 3435
77 Ga0070688_100406052 3300005365 Bacteria 1009
78 Ga0070659_100008535 3300005366 Bacteria 7486
79 Ga0070659_100045224 3300005366 Bacteria 3448
80 Ga0070659_100250726 3300005366 Bacteria 1467
81 Ga0070659_100486487 3300005366 Bacteria 1050
82 Ga0070709_10408452 3300005434 Bacteria 1015
83 Ga0070714_100002041 3300005435 Bacteria 14793
84 Ga0070714_100003673 3300005435 Bacteria 11488
85 Ga0070713_100002146 3300005436 Bacteria 12752
86 Ga0070710_10076724 3300005437 Bacteria 1940
87 Ga0070694_100074176 3300005444 Bacteria 2351
88 Ga0070694_100428025 3300005444 Bacteria 1041
89 Ga0070663_100024906 3300005455 Bacteria 4034
90 Ga0070663_100114572 3300005455 Bacteria 2030
91 Ga0070662_100097095 3300005457 Bacteria 2223
92 Ga0070662_100193969 3300005457 Bacteria 1608
93 Ga0070681_10033942 3300005458 Bacteria 5122
94 Ga0070681_10313268 3300005458 Bacteria 1479
95 Ga0070685_10002217 3300005466 Bacteria 10022
96 Ga0070679_100447160 3300005530 Bacteria 1237
97 Ga0068853_100002365 3300005539 Bacteria 14105
98 Ga0070696_100002542 3300005546 Bacteria 12087
99 Ga0070693_100020439 3300005547 Bacteria 3491
100 Ga0070665_100031284 3300005548 Bacteria 5356
101 Ga0068855_100020454 3300005563 Bacteria 7937
102 Ga0068855_100031508 3300005563 Bacteria 6331
103 Ga0070664_100056433 3300005564 Bacteria 3337
104 Ga0068857_100000591 3300005577 Bacteria 26568
105 Ga0068854_100001805 3300005578 Bacteria 13020
106 Ga0068856_100008712 3300005614 Bacteria 9869
107 Ga0068852_100321382 3300005616 Bacteria 1503
108 Ga0068859_100526224 3300005617 Bacteria 1277
109 Ga0068858_100026962 3300005842 Bacteria 5337
110 Ga0068858_100074036 3300005842 Bacteria 3162
111 Ga0068860_100777556 3300005843 Bacteria 970
112 Ga0070712_100347410 3300006175 Bacteria 1213
113 Ga0075369_10046397 3300006186 Bacteria 1871
114 Ga0097620_100526179 3300006931 Bacteria 1277
115 Ga0105240_10017472 3300009093 Bacteria 9666
116 Ga0105240_10017515 3300009093 Bacteria 9652
117 Ga0105240_10025699 3300009093 Bacteria 7736
118 Ga0105240_10032828 3300009093 Bacteria 6715
119 Ga0105241_10038015 3300009174 Bacteria 3629
120 Ga0105241_10527186 3300009174 Bacteria 1057
121 Ga0105237_10000064 3300009545 Bacteria 139463
122 Ga0105237_10104031 3300009545 Bacteria 2831
123 Ga0105238_10000924 3300009551 Bacteria 30076
124 Ga0105238_10012802 3300009551 Bacteria 8465
125 Ga0105239_10000030 3300010375 Bacteria 233669
126 Ga0105239_10010561 3300010375 Bacteria 10324
127 Ga0105239_10181121 3300010375 Bacteria 2357
128 Ga0157314_1000130 3300012500 Bacteria 8211
129 Ga0157373_10037776 3300013100 Bacteria 3460
130 Ga0157373_10309838 3300013100 Bacteria 1122
131 Ga0157373_10342836 3300013100 Bacteria 1065
132 Ga0157371_10007084 3300013102 Bacteria 9118
133 Ga0157370_10000293 3300013104 Bacteria 63396
134 Ga0157370_10001525 3300013104 Bacteria 28645
135 Ga0157370_10019471 3300013104 Bacteria 6807
136 Ga0157370_10044325 3300013104 Bacteria 4276
137 Ga0157370_10070652 3300013104 Bacteria 3295
138 Ga0157370_10075220 3300013104 Bacteria 3184
139 Ga0157370_10080786 3300013104 Bacteria 3061
140 Ga0157369_10000509 3300013105 Bacteria 51146
141 Ga0157369_10053631 3300013105 Bacteria 4357
142 Ga0163162_10048390 3300013306 Bacteria 4260
143 Ga0163162_10250103 3300013306 Bacteria 1904
144 Ga0157372_10001376 3300013307 Bacteria 26252
145 Ga0182008_10002353 3300014497 Bacteria 11897
146 Ga0182008_10004608 3300014497 Bacteria 8025
147 Ga0182008_10021939 3300014497 Bacteria 3274
148 Ga0182008_10068585 3300014497 Bacteria 1745
149 Ga0182008_10091421 3300014497 Bacteria 1500
150 Ga0157379_10378592 3300014968 Bacteria 1298
151 Ga0157376_10041966 3300014969 Bacteria 3748
152 Ga0182006_1000085 3300015261 Bacteria 117595
153 Ga0182006_1001993 3300015261 Bacteria 11510
154 Ga0182006_1009764 3300015261 Bacteria 4292
155 Ga0182007_10023128 3300015262 Bacteria 2188
156 Ga0182007_10025262 3300015262 Bacteria 2070
157 Ga0182005_1000028 3300015265 Bacteria 221889
158 Ga0182005_1001312 3300015265 Bacteria 10188
159 Ga0182005_1040505 3300015265 Bacteria 1267
160 Ga0183369_1007 3300015685 Bacteria 414878
161 Ga0183368_1003 3300015687 Bacteria 1276390
162 Ga0163161_10001533 3300017792 Bacteria 17070
163 Ga0209435_103139 3300025206 Bacteria 1895
164 Ga0209760_100451 3300025207 Bacteria 9390
165 Ga0209784_100120 3300025224 Bacteria 82684
166 Ga0209566_106276 3300025225 Bacteria 1418
167 Ga0209674_100012 3300025226 Bacteria 950162
168 Ga0209674_100119 3300025226 Bacteria 135468
169 Ga0209674_101621 3300025226 Bacteria 5639
170 Ga0209674_101928 3300025226 Bacteria 4869
171 Ga0209672_100005 3300025228 Bacteria 1069303
172 Ga0209672_100016 3300025228 Bacteria 522604
173 Ga0209672_100277 3300025228 Bacteria 37238
174 Ga0209672_100887 3300025228 Bacteria 13631
175 Ga0209672_101154 3300025228 Bacteria 10845
176 Ga0209672_103907 3300025228 Bacteria 2918
177 Ga0209563_100023 3300025230 Bacteria 636844
178 Ga0207427_100013 3300025231 Bacteria 581419
179 Ga0207427_100055 3300025231 Bacteria 209093
180 Ga0207427_100244 3300025231 Bacteria 43765
181 Ga0207427_100248 3300025231 Bacteria 42623
182 Ga0207427_102252 3300025231 Bacteria 5410
183 Ga0209437_100015 3300025233 Bacteria 713457
184 Ga0209437_100020 3300025233 Bacteria 656374
185 Ga0209437_100079 3300025233 Bacteria 275948
186 Ga0209437_100161 3300025233 Bacteria 148264
187 Ga0209437_100224 3300025233 Bacteria 101515
188 Ga0209437_100476 3300025233 Bacteria 30448
189 Ga0209258_100006 3300025242 Bacteria 1069303
190 Ga0209258_100012 3300025242 Bacteria 825544
191 Ga0209258_100049 3300025242 Bacteria 358328
192 Ga0209258_100064 3300025242 Bacteria 293837
193 Ga0209258_100186 3300025242 Bacteria 132381
194 Ga0209258_101044 3300025242 Bacteria 12271
195 Ga0209646_1001157 3300025246 Bacteria 7711
196 Ga0209646_1001176 3300025246 Bacteria 7603
197 Ga0209646_1023248 3300025246 Bacteria 880
198 Ga0209026_1000037 3300025250 Bacteria 282562
199 Ga0209026_1000204 3300025250 Bacteria 81999
200 Ga0209026_1000375 3300025250 Bacteria 41000
201 Ga0209026_1000541 3300025250 Bacteria 26051
202 Ga0209026_1002787 3300025250 Bacteria 6225
203 Ga0209677_111543 3300025253 Bacteria 1371
204 Ga0209148_1000005 3300025254 Bacteria 1806504
205 Ga0209148_1000010 3300025254 Bacteria 1265567
206 Ga0209148_1000012 3300025254 Bacteria 1069303
207 Ga0209148_1000014 3300025254 Bacteria 925277
208 Ga0209148_1000073 3300025254 Bacteria 320851
209 Ga0209148_1000142 3300025254 Bacteria 163404
210 Ga0209148_1004544 3300025254 Bacteria 3388
211 Ga0209759_1000103 3300025256 Bacteria 153195
212 Ga0209759_1000672 3300025256 Bacteria 31426
213 Ga0209759_1000792 3300025256 Bacteria 25985
214 Ga0209759_1014900 3300025256 Bacteria 2031
215 Ga0209129_1001735 3300025258 Bacteria 11717
216 Ga0209129_1005774 3300025258 Bacteria 4240
217 Ga0209233_1000009 3300025261 Bacteria 1265567
218 Ga0209233_1000020 3300025261 Bacteria 798224
219 Ga0209233_1000063 3300025261 Bacteria 395810
220 Ga0209233_1000147 3300025261 Bacteria 186517
221 Ga0209233_1006986 3300025261 Bacteria 3605
222 Ga0209233_1026589 3300025261 Bacteria 1412
223 Ga0209455_1000008 3300025272 Bacteria 1069303
224 Ga0209455_1000014 3300025272 Bacteria 806601
225 Ga0209455_1000082 3300025272 Bacteria 257909
226 Ga0209455_1000177 3300025272 Bacteria 106026
227 Ga0209455_1002695 3300025272 Bacteria 6684
228 Ga0209758_1003436 3300025297 Bacteria 14415
229 Ga0209051_1034134 3300025303 Bacteria 1912
230 Ga0207692_10052783 3300025898 Bacteria 2067
231 Ga0207710_10009627 3300025900 Bacteria 4058
232 Ga0207680_10000005 3300025903 Bacteria 660983
233 Ga0207647_10000512 3300025904 Bacteria 30880
234 Ga0207647_10001940 3300025904 Bacteria 15811
235 Ga0207647_10014059 3300025904 Bacteria 5533
236 Ga0207647_10022890 3300025904 Bacteria 4143
237 Ga0207705_10002446 3300025909 Bacteria 14328
238 Ga0207705_10013387 3300025909 Bacteria 5917
239 Ga0207707_10008818 3300025912 Bacteria 8757
240 Ga0207707_10720695 3300025912 Bacteria 836
241 Ga0207695_10003105 3300025913 Bacteria 23782
242 Ga0207695_10004047 3300025913 Bacteria 20165
243 Ga0207695_10004907 3300025913 Bacteria 18022
244 Ga0207695_10050523 3300025913 Bacteria 4373
245 Ga0207671_10000061 3300025914 Bacteria 175061
246 Ga0207671_10275600 3300025914 Bacteria 1326
247 Ga0207663_10311405 3300025916 Bacteria 1180
248 Ga0207657_10028402 3300025919 Bacteria 5103
249 Ga0207657_10035345 3300025919 Bacteria 4482
250 Ga0207649_10011726 3300025920 Bacteria 4844
251 Ga0207649_10016581 3300025920 Bacteria 4158
252 Ga0207649_10033090 3300025920 Bacteria 3087
253 Ga0207694_10001362 3300025924 Bacteria 21050
254 Ga0207694_10029488 3300025924 Bacteria 4187
255 Ga0207694_10341797 3300025924 Bacteria 1238
256 Ga0207650_10034988 3300025925 Bacteria 3645
257 Ga0207650_10406289 3300025925 Bacteria 1128
258 Ga0207700_10057819 3300025928 Bacteria 2926
259 Ga0207664_10000026 3300025929 Bacteria 194571
260 Ga0207664_10001714 3300025929 Bacteria 14452
261 Ga0207664_10203153 3300025929 Bacteria 1711
262 Ga0207690_10002499 3300025932 Bacteria 11123
263 Ga0207690_10003314 3300025932 Bacteria 9634
264 Ga0207690_10003820 3300025932 Bacteria 8911
265 Ga0207690_10062025 3300025932 Bacteria 2543
266 Ga0207690_10200575 3300025932 Bacteria 1515
267 Ga0207706_10077962 3300025933 Bacteria 2914
268 Ga0207670_10000709 3300025936 Bacteria 17570
269 Ga0207679_10284779 3300025945 Bacteria 1419
270 Ga0207667_10000119 3300025949 Bacteria 124365
271 Ga0207667_10003156 3300025949 Bacteria 20387
272 Ga0207667_10005743 3300025949 Bacteria 15144
273 Ga0207640_10000797 3300025981 Bacteria 17930
274 Ga0207640_10009780 3300025981 Bacteria 5377
275 Ga0207658_10861819 3300025986 Bacteria 824
276 Ga0207703_10029561 3300026035 Bacteria 4325
277 Ga0207703_10058077 3300026035 Bacteria 3157
278 Ga0207639_10013353 3300026041 Bacteria 5748
279 Ga0207678_10016567 3300026067 Bacteria 6472
280 Ga0207678_10080190 3300026067 Bacteria 2795
281 Ga0207678_10119809 3300026067 Bacteria 2246
282 Ga0207678_10362607 3300026067 Bacteria 1251
283 Ga0207678_10422438 3300026067 Bacteria 1156
284 Ga0207702_10000937 3300026078 Bacteria 30118
285 Ga0207674_10000226 3300026116 Bacteria 70605
286 Ga0207674_10020397 3300026116 Bacteria 7160
287 Ga0207698_10421184 3300026142 Bacteria 1281
288 Ga0268266_10000004 3300028379 Bacteria 1495817
289 Ga0268264_10703055 3300028381 Bacteria 1004
290 Ga0307405_10052926 3300031731 Bacteria 2527
291 Ga0307412_10002224 3300031911 Bacteria 10775
292 Ga0307510_10006545 3300033180 Bacteria 13894
293 Ga0307510_10142629 3300033180 Bacteria 2035
294 Ga0395899_0000108 3300037312 Bacteria 142347
295 Ga0395899_0003966 3300037312 Bacteria 11658
296 Ga0395899_0025215 3300037312 Bacteria 4489
297 Ga0395899_0041216 3300037312 Bacteria 3450
298 Ga0395899_0151192 3300037312 Bacteria 1645
299 Ga0395900_0000144 3300037418 Bacteria 119971
300 Ga0395900_0002611 3300037418 Bacteria 19685
301 Ga0395900_0004074 3300037418 Bacteria 15582
302 Ga0395900_0094595 3300037418 Bacteria 3069
303 Ga0395900_0311818 3300037418 Bacteria 1556
304 Ga0395898_0000018 3300037466 Bacteria 418600
305 Ga0395898_0000049 3300037466 Bacteria 284792
306 Ga0395898_0010041 3300037466 Bacteria 9910
307 Ga0395898_0010070 3300037466 Bacteria 9895
308 Ga0395898_0095680 3300037466 Bacteria 2853
309 Ga0395905_0147239 3300037471 Bacteria 2216
310 Ga0395901_0007439 3300038443 Bacteria 11052
311 Ga0395901_0007941 3300038443 Bacteria 10703
312 Ga0395901_0026088 3300038443 Bacteria 6000
313 Ga0395901_0046899 3300038443 Bacteria 4489
314 Ga0395901_0068848 3300038443 Bacteria 3686
315 Ga0395901_0077574 3300038443 Bacteria 3467
316 Ga0395901_0161973 3300038443 Bacteria 2349
317 Ga0395901_0209993 3300038443 Bacteria 2038
318 Ga0395901_0370010 3300038443 Bacteria 1476
319 Ga0439436_0000030 3300041404 Bacteria 48429
320 Ga0439465_0005693 3300041413 Bacteria 3965
321 Ga0451793_1722862 3300041452 Bacteria 1187
322 Ga0439437_004686 3300042000 Bacteria 1495
323 Ga0439432_034934 3300042006 Bacteria 1612
324 Ga0450908_000350 3300042184 Bacteria 8908
325 Ga0439459_0014893 3300042438 Bacteria 1419
326 Ga0439459_0021406 3300042438 Bacteria 1241
327 Ga0466969_0001731 3300044656 Bacteria 11648
328 Ga0466969_0006502 3300044656 Bacteria 6219
329 Ga0466969_0006507 3300044656 Bacteria 6214
330 Ga0466982_0000003 3300044672 Bacteria 417243
331 Ga0466982_0000612 3300044672 Bacteria 10925
332 Ga0466965_0032619 3300044683 Bacteria 2543
333 Ga0466965_0386360 3300044683 Bacteria 771
334 Ga0466966_0003978 3300044684 Bacteria 9768
335 Ga0466966_0009639 3300044684 Bacteria 6390
336 Ga0466961_0008586 3300044693 Bacteria 6509
337 Ga0466961_0009792 3300044693 Bacteria 6099
338 Ga0466961_0075908 3300044693 Bacteria 2130
339 Ga0466961_0156412 3300044693 Bacteria 1422
340 Ga0466961_0168091 3300044693 Bacteria 1364
341 Ga0466963_0110486 3300044694 Bacteria 1887
342 Ga0466971_0001052 3300044719 Bacteria 11434
343 Ga0466971_0003433 3300044719 Bacteria 6777
344 Ga0466971_0009181 3300044719 Bacteria 4324
345 Ga0466968_0001048 3300044735 Bacteria 9788
346 Ga0466968_0002071 3300044735 Bacteria 7302
347 Ga0466970_0014209 3300044765 Bacteria 4083
348 Ga0466970_0033957 3300044765 Bacteria 2698
349 Ga0466970_0063659 3300044765 Bacteria 1977
350 Ga0466970_0069613 3300044765 Bacteria 1891
351 Ga0466970_0118079 3300044765 Bacteria 1451
352 Ga0466957_0007781 3300044842 Bacteria 6067
353 Ga0466957_0237061 3300044842 Bacteria 1209
354 Ga0466959_0000194 3300045049 Bacteria 39999
355 Ga0466959_0043088 3300045049 Bacteria 3328
356 Ga0466959_0088600 3300045049 Bacteria 2224
357 Ga0466959_0348059 3300045049 Bacteria 1010
358 Ga0466958_0125933 3300045836 Bacteria 1606
359 Ga0466958_0170890 3300045836 Bacteria 1376
360 Ga0466958_0246863 3300045836 Bacteria 1141
361 Ga0466967_0094326 3300045976 Bacteria 2725
362 Ga0466967_0454074 3300045976 Bacteria 1253
363 Ga0466967_0598586 3300045976 Bacteria 1088
364 Ga0466967_0868115 3300045976 Bacteria 897
365 Ga0495617_002295 3300046452 Bacteria 7723
366 Ga0495638_0000038 3300046460 Bacteria 249534
367 Ga0495638_0000234 3300046460 Bacteria 75860
368 Ga0495638_0001171 3300046460 Bacteria 25181
369 Ga0495650_0000337 3300046471 Bacteria 83530
370 Ga0495650_0001325 3300046471 Bacteria 24874
371 Ga0495584_0122061 3300046491 Bacteria 1319
372 Ga0495585_0000104 3300046492 Bacteria 90097
373 Ga0495585_0024980 3300046492 Bacteria 3424
374 Ga0495607_0120125 3300046501 Bacteria 1381
375 Ga0495606_0000338 3300046507 Bacteria 80898
376 Ga0495606_0000401 3300046507 Bacteria 73149
377 Ga0495606_0012374 3300046507 Bacteria 6848
378 Ga0495606_0262276 3300046507 Bacteria 953
379 Ga0495610_0000482 3300046512 Bacteria 41191
380 Ga0495616_0000086 3300046513 Bacteria 78187
381 Ga0495620_0001045 3300046515 Bacteria 16982
382 Ga0495631_0000974 3300046518 Bacteria 17774
383 Ga0495632_0000004 3300046519 Bacteria 381372
384 Ga0495632_0014432 3300046519 Bacteria 4469
385 Ga0495648_0000914 3300046524 Bacteria 30767
386 Ga0495597_0062199 3300046542 Bacteria 1625
387 Ga0495622_0019037 3300046557 Bacteria 3198
388 Ga0495668_0007971 3300046616 Bacteria 6677
389 Ga0495625_0013223 3300046660 Bacteria 6645
390 Ga0495625_0015363 3300046660 Bacteria 6067
391 Ga0495625_0051026 3300046660 Bacteria 2967
392 Ga0495661_0000199 3300046665 Bacteria 69536
393 Ga0495670_0003561 3300046691 Bacteria 7651
394 Ga0495670_0010407 3300046691 Bacteria 4569
395 Ga0495649_0000553 3300046694 Bacteria 31708
396 Ga0495660_0005305 3300046810 Bacteria 7719
397 Ga0495683_0001981 3300047323 Bacteria 12761
398 Ga0495673_0000004 3300047469 Bacteria 1354526
399 Ga0495673_0192013 3300047469 Bacteria 768
400 Ga0495686_0000017 3300047472 Bacteria 435554
401 Ga0495686_0001206 3300047472 Bacteria 29747
402 Ga0495686_0018752 3300047472 Bacteria 4635
403 Ga0495686_0047312 3300047472 Bacteria 2716
404 Ga0496100_0001852 3300048903 Bacteria 10584
405 Ga0496100_0069201 3300048903 Bacteria 2350
406 Ga0496100_0187343 3300048903 Bacteria 1500
407 Ga0496101_0000776 3300048904 Bacteria 18897
408 Ga0496101_0147317 3300048904 Bacteria 1798
409 Ga0496104_0158978 3300048907 Bacteria 2168
410 Ga0496105_0008971 3300048908 Bacteria 7801
411 Ga0496106_0001299 3300048909 Bacteria 18754
412 Ga0496107_0015203 3300048910 Bacteria 5392
413 Ga0496112_0163509 3300048915 Bacteria 2192
414 Ga0496113_0007592 3300048916 Bacteria 6996
415 Ga0496114_0555487 3300048917 Bacteria 1014
416 Ga0496115_0000503 3300048918 Bacteria 30610
417 Ga0496115_0002471 3300048918 Bacteria 13281
418 Ga0496115_0012375 3300048918 Bacteria 6418
419 Ga0496115_0076332 3300048918 Bacteria 2723
420 Ga0496116_0170615 3300048919 Bacteria 1179
421 Ga0496117_0002308 3300048920 Bacteria 24516
422 Ga0496117_0022702 3300048920 Bacteria 5025
423 Ga0496117_0096322 3300048920 Bacteria 1888
424 Ga0496118_0001694 3300048921 Bacteria 32220
425 Ga0496118_0005974 3300048921 Bacteria 13580
426 Ga0496118_0018381 3300048921 Bacteria 6310
427 Ga0496118_0018478 3300048921 Bacteria 6288
428 Ga0496118_0075542 3300048921 Bacteria 2402
429 Ga0496118_0079530 3300048921 Bacteria 2313
430 Ga0496119_0000430 3300048922 Bacteria 57802
431 Ga0496119_0008458 3300048922 Bacteria 9034
432 Ga0496119_0031460 3300048922 Bacteria 3558
433 Ga0496120_0001482 3300048923 Bacteria 27908
434 Ga0496120_0002085 3300048923 Bacteria 21429
435 Ga0496121_0000743 3300048924 Bacteria 59998
436 Ga0496121_0000878 3300048924 Bacteria 54427
437 Ga0496121_0013621 3300048924 Bacteria 8719
438 Ga0496121_0015192 3300048924 Bacteria 8094
439 Ga0496121_0015809 3300048924 Bacteria 7856
440 Ga0496121_0034829 3300048924 Bacteria 4524
441 Ga0496121_0045856 3300048924 Bacteria 3750
442 Ga0496121_0111283 3300048924 Bacteria 2088
443 Ga0496121_0182438 3300048924 Bacteria 1513
444 Ga0496122_0021496 3300048925 Bacteria 5774
445 Ga0496122_0025814 3300048925 Bacteria 5088
446 Ga0496122_0120671 3300048925 Bacteria 1691
447 Ga0496123_0044054 3300048926 Bacteria 3055
448 Ga0496123_0053361 3300048926 Bacteria 2672
449 Ga0496123_0126132 3300048926 Bacteria 1428
450 Ga0496124_0001044 3300048927 Bacteria 43754
451 Ga0496124_0007573 3300048927 Bacteria 11514
452 Ga0496125_0000330 3300048928 Bacteria 91043
453 Ga0496126_0003181 3300048929 Bacteria 21118
454 Ga0496126_0013428 3300048929 Bacteria 8330
455 Ga0496126_0039582 3300048929 Bacteria 4373
456 Ga0496126_0040236 3300048929 Bacteria 4334
457 Ga0496126_0150674 3300048929 Bacteria 1994
458 Ga0496126_0166085 3300048929 Bacteria 1883
459 Ga0496126_0258780 3300048929 Bacteria 1448
460 Ga0495682_0012370 3300049460 Bacteria 3272
461 Ga0495682_0017100 3300049460 Bacteria 2741
462 Ga0501031_0177696 3300049568 Bacteria 1391
463 Ga0501031_0220780 3300049568 Bacteria 1234
464 Ga0501032_0016603 3300049569 Bacteria 5176
465 Ga0501032_0063787 3300049569 Bacteria 2466
466 Ga0501032_0350047 3300049569 Bacteria 952
467 Ga0501033_0010485 3300049570 Bacteria 7109
468 Ga0501033_0245882 3300049570 Bacteria 1269
469 Ga0501034_0004365 3300049571 Bacteria 15758
470 Ga0501034_0171258 3300049571 Bacteria 2138
471 Ga0501034_0271332 3300049571 Bacteria 1637
472 Ga0501036_0033958 3300049572 Bacteria 4315
473 Ga0501036_0166283 3300049572 Bacteria 1859
474 Ga0501037_0005496 3300049573 Bacteria 9239
475 Ga0501037_0081979 3300049573 Bacteria 2338
476 Ga0501037_0177519 3300049573 Bacteria 1512
477 Ga0501038_0044973 3300049574 Bacteria 3834
478 Ga0501038_0309519 3300049574 Bacteria 1238
479 Ga0501043_0019217 3300049579 Bacteria 5364
480 Ga0501043_0058545 3300049579 Bacteria 3024
481 Ga0501043_0059933 3300049579 Bacteria 2987
482 Ga0501043_0185975 3300049579 Bacteria 1617
483 Ga0501046_0050304 3300049580 Bacteria 3293
484 Ga0501046_0189508 3300049580 Bacteria 1535
485 Ga0501046_0341911 3300049580 Bacteria 1087
486 Ga0501047_0006844 3300049581 Bacteria 10712
487 Ga0501047_0014768 3300049581 Bacteria 7432
488 Ga0501047_0205077 3300049581 Bacteria 1831
489 Ga0501070_0050335 3300049586 Bacteria 3459
490 Ga0501077_0145042 3300049593 Bacteria 1506
491 Ga0501035_0001816 3300049822 Bacteria 21577
492 Ga0501035_0005013 3300049822 Bacteria 12539
493 Ga0501044_0013654 3300049823 Bacteria 8777
494 Ga0501044_0045810 3300049823 Bacteria 4530
495 Ga0501044_0054482 3300049823 Bacteria 4110
496 Ga0501044_0058971 3300049823 Bacteria 3934
497 Ga0501044_0163622 3300049823 Bacteria 2200
498 nmdc:mga0qj67_116912_c1 3300050509 Bacteria 2155
499 Ga0466962_0009172 3300061719 Bacteria 4738
500 Ga0466962_0019279 3300061719 Bacteria 3276
501 Ga0466962_0182492 3300061719 Bacteria 1023
502 2538832277 2537561836 Bacteria 3910579
503 2595446794 2593339238 Bacteria 4182970
504 2595449557 2593339239 Bacteria 4124669
505 2643830287 2643221562 Bacteria 4048635
506 2643896776 2643221577 Bacteria 3710843
507 2644305764 2643221654 Bacteria 5273570
508 2644478981 2643221685 Bacteria 3673288
509 2687583764 2687453130 Bacteria 4227172
510 2735833473 2734482264 Unclassified 5014763
511 2739229473 2738543009 Bacteria 4944499
512 2739730264 2739367700 Bacteria 4747630
513 2819563948 2818991440 Bacteria 4774720
514 2842918509 2842914999 Bacteria 4419378
515 2842919868 2842918807 Bacteria 4289178
516 2884341467 2884338543 Bacteria 4610696
517 2884412140 2884411467 Bacteria 5246714
518 2895397674 2895395659 Bacteria 3983269
519 2904464584 2904463128 Bacteria 4775606
520 2919088332 2919085039 Bacteria 4532964
521 2919406086 2919404418 Bacteria 4232372
522 2928967700 2928963466 Bacteria 5165703
523 2939612511 2939611941 Bacteria 3892017
524 2941472916 2941471342 Bacteria 5018624
525 2953995165 2953994433 Bacteria 4303959
526 Ga0157372_10066605
527 JGI24739J22299_10006098
528 JGI24737J22298_10003212
529 JGI25156J39149_1001926
530 JGI25156J39149_1004139
531 JGI25162J39368_1000163
532 JGI25162J39368_1000895
533 JGI25162J39368_1001009
534 JGI25162J39368_1001817
535 JGI25162J39368_1002271
536 JGI25154J39366_1002584
537 JGI25157J39369_1000229
538 JGI25157J39369_1000804
539 JGI25157J39369_1000996
540 JGI25157J39369_1001518
541 JGI25157J39369_1001578
542 JGI25163J39215_1001619
543 JGI25164J39214_1000045
544 JGI25164J39214_1000285
545 JGI25164J39214_1000895
546 JGI25164J39214_1001103
547 JGI25165J46597_1000072
548 JGI25165J46597_1000215
549 JGI25165J46597_1001691
550 JGI25153J46596_10055055
551 rootH1_10012190
552 rootH1_10058214
553 rootH2_10012587
554 rootH2_10076181
555 rootH2_10107780
556 rootH2_10157713
557 rootH2_10157714
558 rootL2_10172163
559 Ga0006562J51391_1014503
560 Ga0006562J51391_1014506
561 Ga0006562J51391_1182275
562 Ga0006562J51391_1182276
563 Ga0055538_1001562
564 Ga0055539_1002669
565 Ga0055539_1011031
566 Ga0055533_1000617
567 Ga0055533_1001642
568 Ga0055525_1000027
569 Ga0055527_1000082
570 Ga0055527_1000209
571 Ga0055527_1001667
572 Ga0055535_1000124
573 Ga0055535_1000143
574 Ga0055535_1000451
575 Ga0055535_1001467
576 Ga0055535_1001833
577 Ga0055542_1000190
578 Ga0055542_1000197
579 Ga0055542_1000466
580 Ga0055542_1001205
581 Ga0055542_1001440
582 Ga0055542_1001764
583 Ga0055542_1010406
584 Ga0055529_1000197
585 Ga0055529_1000204
586 Ga0055529_1000217
587 Ga0055529_1000671
588 Ga0065165_1000587
589 Ga0065165_1003615
590 Ga0070670_100062735
591 Ga0070666_10000005
592 Ga0070682_100005295
593 Ga0070682_100011835
594 Ga0070682_100635572
595 Ga0070660_100015081
596 Ga0070660_100015362
597 Ga0070689_100000503
598 Ga0070661_100007160
599 Ga0070661_100019917
600 Ga0070661_100027284
601 Ga0070692_10017423
602 Ga0070688_100406052
603 Ga0070659_100008535
604 Ga0070659_100045224
605 Ga0070659_100250726
606 Ga0070659_100486487
607 Ga0070709_10408452
608 Ga0070714_100002041
609 Ga0070714_100003673
610 Ga0070713_100002146
611 Ga0070710_10076724
612 Ga0070694_100074176
613 Ga0070694_100428025
614 Ga0070663_100024906
615 Ga0070663_100114572
616 Ga0070662_100097095
617 Ga0070662_100193969
618 Ga0070681_10033942
619 Ga0070681_10313268
620 Ga0070685_10002217
621 Ga0070679_100447160
622 Ga0068853_100002365
623 Ga0070696_100002542
624 Ga0070693_100020439
625 Ga0070665_100031284
626 Ga0068855_100020454
627 Ga0068855_100031508
628 Ga0070664_100056433
629 Ga0068857_100000591
630 Ga0068854_100001805
631 Ga0068856_100008712
632 Ga0068852_100321382
633 Ga0068859_100526224
634 Ga0068858_100026962
635 Ga0068858_100074036
636 Ga0068860_100777556
637 Ga0070712_100347410
638 Ga0075369_10046397
639 Ga0097620_100526179
640 Ga0105240_10017472
641 Ga0105240_10017515
642 Ga0105240_10025699
643 Ga0105240_10032828
644 Ga0105241_10038015
645 Ga0105241_10527186
646 Ga0105237_10000064
647 Ga0105237_10104031
648 Ga0105238_10000924
649 Ga0105238_10012802
650 Ga0105239_10000030
651 Ga0105239_10010561
652 Ga0105239_10181121
653 Ga0157314_1000130
654 Ga0157373_10037776
655 Ga0157373_10309838
656 Ga0157373_10342836
657 Ga0157371_10007084
658 Ga0157370_10000293
659 Ga0157370_10001525
660 Ga0157370_10019471
661 Ga0157370_10044325
662 Ga0157370_10070652
663 Ga0157370_10075220
664 Ga0157370_10080786
665 Ga0157369_10000509
666 Ga0157369_10053631
667 Ga0163162_10048390
668 Ga0163162_10250103
669 Ga0157372_10001376
670 Ga0182008_10002353
671 Ga0182008_10004608
672 Ga0182008_10021939
673 Ga0182008_10068585
674 Ga0182008_10091421
675 Ga0157379_10378592
676 Ga0157376_10041966
677 Ga0182006_1000085
678 Ga0182006_1001993
679 Ga0182006_1009764
680 Ga0182007_10023128
681 Ga0182007_10025262
682 Ga0182005_1000028
683 Ga0182005_1001312
684 Ga0182005_1040505
685 Ga0183369_1007
686 Ga0183368_1003
687 Ga0163161_10001533
688 Ga0209435_103139
689 Ga0209760_100451
690 Ga0209784_100120
691 Ga0209566_106276
692 Ga0209674_100012
693 Ga0209674_100119
694 Ga0209674_101621
695 Ga0209674_101928
696 Ga0209672_100005
697 Ga0209672_100016
698 Ga0209672_100277
699 Ga0209672_100887
700 Ga0209672_101154
701 Ga0209672_103907
702 Ga0209563_100023
703 Ga0207427_100013
704 Ga0207427_100055
705 Ga0207427_100244
706 Ga0207427_100248
707 Ga0207427_102252
708 Ga0209437_100015
709 Ga0209437_100020
710 Ga0209437_100079
711 Ga0209437_100161
712 Ga0209437_100224
713 Ga0209437_100476
714 Ga0209258_100006
715 Ga0209258_100012
716 Ga0209258_100049
717 Ga0209258_100064
718 Ga0209258_100186
719 Ga0209258_101044
720 Ga0209646_1001157
721 Ga0209646_1001176
722 Ga0209646_1023248
723 Ga0209026_1000037
724 Ga0209026_1000204
725 Ga0209026_1000375
726 Ga0209026_1000541
727 Ga0209026_1002787
728 Ga0209677_111543
729 Ga0209148_1000005
730 Ga0209148_1000010
731 Ga0209148_1000012
732 Ga0209148_1000014
733 Ga0209148_1000073
734 Ga0209148_1000142
735 Ga0209148_1004544
736 Ga0209759_1000103
737 Ga0209759_1000672
738 Ga0209759_1000792
739 Ga0209759_1014900
740 Ga0209129_1001735
741 Ga0209129_1005774
742 Ga0209233_1000009
743 Ga0209233_1000020
744 Ga0209233_1000063
745 Ga0209233_1000147
746 Ga0209233_1006986
747 Ga0209233_1026589
748 Ga0209455_1000008
749 Ga0209455_1000014
750 Ga0209455_1000082
751 Ga0209455_1000177
752 Ga0209455_1002695
753 Ga0209758_1003436
754 Ga0209051_1034134
755 Ga0207692_10052783
756 Ga0207710_10009627
757 Ga0207680_10000005
758 Ga0207647_10000512
759 Ga0207647_10001940
760 Ga0207647_10014059
761 Ga0207647_10022890
762 Ga0207705_10002446
763 Ga0207705_10013387
764 Ga0207707_10008818
765 Ga0207707_10720695
766 Ga0207695_10003105
767 Ga0207695_10004047
768 Ga0207695_10004907
769 Ga0207695_10050523
770 Ga0207671_10000061
771 Ga0207671_10275600
772 Ga0207663_10311405
773 Ga0207657_10028402
774 Ga0207657_10035345
775 Ga0207649_10011726
776 Ga0207649_10016581
777 Ga0207649_10033090
778 Ga0207694_10001362
779 Ga0207694_10029488
780 Ga0207694_10341797
781 Ga0207650_10034988
782 Ga0207650_10406289
783 Ga0207700_10057819
784 Ga0207664_10000026
785 Ga0207664_10001714
786 Ga0207664_10203153
787 Ga0207690_10002499
788 Ga0207690_10003314
789 Ga0207690_10003820
790 Ga0207690_10062025
791 Ga0207690_10200575
792 Ga0207706_10077962
793 Ga0207670_10000709
794 Ga0207679_10284779
795 Ga0207667_10000119
796 Ga0207667_10003156
797 Ga0207667_10005743
798 Ga0207640_10000797
799 Ga0207640_10009780
800 Ga0207658_10861819
801 Ga0207703_10029561
802 Ga0207703_10058077
803 Ga0207639_10013353
804 Ga0207678_10016567
805 Ga0207678_10080190
806 Ga0207678_10119809
807 Ga0207678_10362607
808 Ga0207678_10422438
809 Ga0207702_10000937
810 Ga0207674_10000226
811 Ga0207674_10020397
812 Ga0207698_10421184
813 Ga0268266_10000004
814 Ga0268264_10703055
815 Ga0307405_10052926
816 Ga0307412_10002224
817 Ga0307510_10006545
818 Ga0307510_10142629
819 Ga0395899_0000108
820 Ga0395899_0003966
821 Ga0395899_0025215
822 Ga0395899_0041216
823 Ga0395899_0151192
824 Ga0395900_0000144
825 Ga0395900_0002611
826 Ga0395900_0004074
827 Ga0395900_0094595
828 Ga0395900_0311818
829 Ga0395898_0000018
830 Ga0395898_0000049
831 Ga0395898_0010041
832 Ga0395898_0010070
833 Ga0395898_0095680
834 Ga0395905_0147239
835 Ga0395901_0007439
836 Ga0395901_0007941
837 Ga0395901_0026088
838 Ga0395901_0046899
839 Ga0395901_0068848
840 Ga0395901_0077574
841 Ga0395901_0161973
842 Ga0395901_0209993
843 Ga0395901_0370010
844 Ga0439436_0000030
845 Ga0439465_0005693
846 Ga0451793_1722862
847 Ga0439437_004686
848 Ga0439432_034934
849 Ga0450908_000350
850 Ga0439459_0014893
851 Ga0439459_0021406
852 Ga0466969_0001731
853 Ga0466969_0006502
854 Ga0466969_0006507
855 Ga0466982_0000003
856 Ga0466982_0000612
857 Ga0466965_0032619
858 Ga0466965_0386360
859 Ga0466966_0003978
860 Ga0466966_0009639
861 Ga0466961_0008586
862 Ga0466961_0009792
863 Ga0466961_0075908
864 Ga0466961_0156412
865 Ga0466961_0168091
866 Ga0466963_0110486
867 Ga0466971_0001052
868 Ga0466971_0003433
869 Ga0466971_0009181
870 Ga0466968_0001048
871 Ga0466968_0002071
872 Ga0466970_0014209
873 Ga0466970_0033957
874 Ga0466970_0063659
875 Ga0466970_0069613
876 Ga0466970_0118079
877 Ga0466957_0007781
878 Ga0466957_0237061
879 Ga0466959_0000194
880 Ga0466959_0043088
881 Ga0466959_0088600
882 Ga0466959_0348059
883 Ga0466958_0125933
884 Ga0466958_0170890
885 Ga0466958_0246863
886 Ga0466967_0094326
887 Ga0466967_0454074
888 Ga0466967_0598586
889 Ga0466967_0868115
890 Ga0495617_002295
891 Ga0495638_0000038
892 Ga0495638_0000234
893 Ga0495638_0001171
894 Ga0495650_0000337
895 Ga0495650_0001325
896 Ga0495584_0122061
897 Ga0495585_0000104
898 Ga0495585_0024980
899 Ga0495607_0120125
900 Ga0495606_0000338
901 Ga0495606_0000401
902 Ga0495606_0012374
903 Ga0495606_0262276
904 Ga0495610_0000482
905 Ga0495616_0000086
906 Ga0495620_0001045
907 Ga0495631_0000974
908 Ga0495632_0000004
909 Ga0495632_0014432
910 Ga0495648_0000914
911 Ga0495597_0062199
912 Ga0495622_0019037
913 Ga0495668_0007971
914 Ga0495625_0013223
915 Ga0495625_0015363
916 Ga0495625_0051026
917 Ga0495661_0000199
918 Ga0495670_0003561
919 Ga0495670_0010407
920 Ga0495649_0000553
921 Ga0495660_0005305
922 Ga0495683_0001981
923 Ga0495673_0000004
924 Ga0495673_0192013
925 Ga0495686_0000017
926 Ga0495686_0001206
927 Ga0495686_0018752
928 Ga0495686_0047312
929 Ga0496100_0001852
930 Ga0496100_0069201
931 Ga0496100_0187343
932 Ga0496101_0000776
933 Ga0496101_0147317
934 Ga0496104_0158978
935 Ga0496105_0008971
936 Ga0496106_0001299
937 Ga0496107_0015203
938 Ga0496112_0163509
939 Ga0496113_0007592
940 Ga0496114_0555487
941 Ga0496115_0000503
942 Ga0496115_0002471
943 Ga0496115_0012375
944 Ga0496115_0076332
945 Ga0496116_0170615
946 Ga0496117_0002308
947 Ga0496117_0022702
948 Ga0496117_0096322
949 Ga0496118_0001694
950 Ga0496118_0005974
951 Ga0496118_0018381
952 Ga0496118_0018478
953 Ga0496118_0075542
954 Ga0496118_0079530
955 Ga0496119_0000430
956 Ga0496119_0008458
957 Ga0496119_0031460
958 Ga0496120_0001482
959 Ga0496120_0002085
960 Ga0496121_0000743
961 Ga0496121_0000878
962 Ga0496121_0013621
963 Ga0496121_0015192
964 Ga0496121_0015809
965 Ga0496121_0034829
966 Ga0496121_0045856
967 Ga0496121_0111283
968 Ga0496121_0182438
969 Ga0496122_0021496
970 Ga0496122_0025814
971 Ga0496122_0120671
972 Ga0496123_0044054
973 Ga0496123_0053361
974 Ga0496123_0126132
975 Ga0496124_0001044
976 Ga0496124_0007573
977 Ga0496125_0000330
978 Ga0496126_0003181
979 Ga0496126_0013428
980 Ga0496126_0039582
981 Ga0496126_0040236
982 Ga0496126_0150674
983 Ga0496126_0166085
984 Ga0496126_0258780
985 Ga0495682_0012370
986 Ga0495682_0017100
987 Ga0501031_0177696
988 Ga0501031_0220780
989 Ga0501032_0016603
990 Ga0501032_0063787
991 Ga0501032_0350047
992 Ga0501033_0010485
993 Ga0501033_0245882
994 Ga0501034_0004365
995 Ga0501034_0171258
996 Ga0501034_0271332
997 Ga0501036_0033958
998 Ga0501036_0166283
999 Ga0501037_0005496
1000 Ga0501037_0081979
1001 Ga0501037_0177519
1002 Ga0501038_0044973
1003 Ga0501038_0309519
1004 Ga0501043_0019217
1005 Ga0501043_0058545
1006 Ga0501043_0059933
1007 Ga0501043_0185975
1008 Ga0501046_0050304
1009 Ga0501046_0189508
1010 Ga0501046_0341911
1011 Ga0501047_0006844
1012 Ga0501047_0014768
1013 Ga0501047_0205077
1014 Ga0501070_0050335
1015 Ga0501077_0145042
1016 Ga0501035_0001816
1017 Ga0501035_0005013
1018 Ga0501044_0013654
1019 Ga0501044_0045810
1020 Ga0501044_0054482
1021 Ga0501044_0058971
1022 Ga0501044_0163622
1023 nmdc:mga0qj67_116912_c1
1024 Ga0466962_0009172
1025 Ga0466962_0019279
1026 Ga0466962_0182492
1027 2538832277
1028 2595446794
1029 2595449557
1030 2643830287
1031 2643896776
1032 2644305764
1033 2644478981
1034 2687583764
1035 2735833473
1036 2739229473
1037 2739730264
1038 2819563948
1039 2842918509
1040 2842919868
1041 2884341467
1042 2884412140
1043 2895397674
1044 2904464584
1045 2919088332
1046 2919406086
1047 2928967700
1048 2939612511
1049 2941472916
1050 2953995165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

17

196

0.97

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

14

190

0.89

PF13242

Hydrolase_like

HAD-hyrolase-like

150

220

0.87

PF12710

HAD

haloacid dehalogenase-like hydrolase

17

186

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.834 87 214
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.8155 81 215
2fi1-assembly1.cif.gz_A the crystal structure of a hydrolase from streptococcus pneumoniae tigr4 0.8102 7 181
2oda-assembly1.cif.gz_A crystal structure of pspto_2114 0.8081 85 218
1u7p-assembly4.cif.gz_D x-ray crystal structure of the hypothetical phosphotyrosine phosphatase mdp-1 of the haloacid dehalogenase superfamily 0.8017 84 217
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.95 85 200 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9345 85 200 3.40.50.1000
2hdoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9081 85 212 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9057 80 212 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.901 87 181 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A4P7CU27-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.8543 1 213 GO:0005829
GO:0006281
GO:0008967
AF-A0A2E7RP04-F1-model_v4 Phosphoglycolate phosphatase 0.8517 7 213 GO:0005829
GO:0006281
GO:0008967
AF-A0A7V1FTE6-F1-model_v4 HAD family hydrolase 0.8282 8 215 GO:0005829
GO:0006281
GO:0008967
AF-A0A1V5G053-F1-model_v4 Phosphoglycolate phosphatase (EC 3.1.3.18) 0.8279 54 210 GO:0005829
GO:0006281
GO:0008967
AF-A0A099PAU7-F1-model_v4 Phosphoglycolate phosphatase 0.824 3 215 GO:0005829
GO:0006281
GO:0008967

Map