F459271

General Info

Members Datasets Scaffolds Average Seq Length
525 290 1050 317

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10262124|Ga0157376_102621242
Length 355
Sequence MDFVGISADHLVRDVILSLPRSLQARLLNEQEHNMKAAVVGKNILEIREVPRPQPKSTEVLIKVRAIGMNRAELPGAYGSGHTRVTGTIPGIEWSGEVVECGAEVKGVKPGDRVMCNGQGGYAEYAVSDYGRTSPIPANNMSWEQAATYPGALGTMHDAIVTNAKLQRGETILIQGASSGVGLMGLQIAKLRGAKLVIGSSTNDARRARLKEFGADLVVDTRKANWSEEVLKATDGKGVAVIIDMVSGPVVNENMKATAVLGRIINVGRLGGGHVEFDCNLHANKRIAYIGVTHRTRSIDELRAQVSNMRADLWDAVTAGKLALPIDRVFKLDDAEAAQAHMRTNAHFGKIVMVP

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
197 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
198 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
288 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
289 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
290 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.19
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.38
Rhizoplane 8.76
Rhizosphere 85.33
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10262124 3300014969 Unclassified 1620
2 JGI25404J52841_10032656 3300003659 Bacteria 1110
3 Ga0070658_10007422 3300005327 Bacteria 8850
4 Ga0070690_100040082 3300005330 Bacteria 2961
5 Ga0070670_100007480 3300005331 Bacteria 9276
6 Ga0068869_100060348 3300005334 Bacteria 2779
7 Ga0070680_100012181 3300005336 Bacteria 6681
8 Ga0070680_100016365 3300005336 Bacteria 5836
9 Ga0070680_100017855 3300005336 Bacteria 5597
10 Ga0070680_100018258 3300005336 Bacteria 5539
11 Ga0070680_100193726 3300005336 Bacteria 1713
12 Ga0070680_100464101 3300005336 Bacteria 1082
13 Ga0070682_100154708 3300005337 Bacteria 1577
14 Ga0068868_100010205 3300005338 Bacteria 6788
15 Ga0068868_100336060 3300005338 Bacteria 1290
16 Ga0070660_100040037 3300005339 Bacteria 3564
17 Ga0070689_100009023 3300005340 Bacteria 7060
18 Ga0070689_100078976 3300005340 Bacteria 2580
19 Ga0070691_10023945 3300005341 Bacteria 2836
20 Ga0070691_10024180 3300005341 Bacteria 2823
21 Ga0070661_100050032 3300005344 Bacteria 3059
22 Ga0070669_100027048 3300005353 Bacteria 4128
23 Ga0070669_100157576 3300005353 Bacteria 1762
24 Ga0070669_100319864 3300005353 Bacteria 1252
25 Ga0070671_100076813 3300005355 Bacteria 2790
26 Ga0070674_100041844 3300005356 Bacteria 3108
27 Ga0070674_100109516 3300005356 Bacteria 2025
28 Ga0070688_100010373 3300005365 Bacteria 5135
29 Ga0070688_100267308 3300005365 Bacteria 1224
30 Ga0070659_100084760 3300005366 Bacteria 2534
31 Ga0070667_100044134 3300005367 Bacteria 3742
32 Ga0070703_10033952 3300005406 Bacteria 1555
33 Ga0070714_100559077 3300005435 Bacteria 1096
34 Ga0070713_100009440 3300005436 Bacteria 6986
35 Ga0070701_10002104 3300005438 Bacteria 7572
36 Ga0070711_100259930 3300005439 Bacteria 1365
37 Ga0070705_100001628 3300005440 Bacteria 11746
38 Ga0070705_100130213 3300005440 Bacteria 1640
39 Ga0070705_100263397 3300005440 Bacteria 1217
40 Ga0070700_100007411 3300005441 Bacteria 5923
41 Ga0070700_100173203 3300005441 Bacteria 1496
42 Ga0070694_100018164 3300005444 Bacteria 4460
43 Ga0070708_100141684 3300005445 Bacteria 2230
44 Ga0070708_100170098 3300005445 Bacteria 2034
45 Ga0070663_100005168 3300005455 Bacteria 7729
46 Ga0070662_100074710 3300005457 Bacteria 2508
47 Ga0070681_10083339 3300005458 Bacteria 3151
48 Ga0070681_10513063 3300005458 Bacteria 1112
49 Ga0068867_100084693 3300005459 Bacteria 2396
50 Ga0068867_100161282 3300005459 Bacteria 1768
51 Ga0068867_100261644 3300005459 Bacteria 1411
52 Ga0070685_10120309 3300005466 Bacteria 1630
53 Ga0070698_100066760 3300005471 Bacteria 3619
54 Ga0070699_100002070 3300005518 Bacteria 18148
55 Ga0070679_100054091 3300005530 Bacteria 3996
56 Ga0070679_100133807 3300005530 Bacteria 2460
57 Ga0070679_100297004 3300005530 Bacteria 1566
58 Ga0070697_100140094 3300005536 Bacteria 2034
59 Ga0070697_100145561 3300005536 Bacteria 1994
60 Ga0070686_100152551 3300005544 Bacteria 1619
61 Ga0070686_100254711 3300005544 Bacteria 1284
62 Ga0070695_100016568 3300005545 Bacteria 4462
63 Ga0070695_100029996 3300005545 Bacteria 3383
64 Ga0070695_100042109 3300005545 Bacteria 2898
65 Ga0070696_100010612 3300005546 Bacteria 6169
66 Ga0070696_100052245 3300005546 Bacteria 2843
67 Ga0070665_100088325 3300005548 Bacteria 3105
68 Ga0070665_100347160 3300005548 Bacteria 1489
69 Ga0070665_100504996 3300005548 Bacteria 1220
70 Ga0070704_100020064 3300005549 Bacteria 4303
71 Ga0070664_100063252 3300005564 Bacteria 3155
72 Ga0068857_100346316 3300005577 Bacteria 1375
73 Ga0070702_100128858 3300005615 Bacteria 1595
74 Ga0070702_100133114 3300005615 Bacteria 1573
75 Ga0068852_100356264 3300005616 Bacteria 1430
76 Ga0068859_100017257 3300005617 Bacteria 7249
77 Ga0068859_100347569 3300005617 Bacteria 1578
78 Ga0068864_100013607 3300005618 Bacteria 6746
79 Ga0068864_100090054 3300005618 Bacteria 2704
80 Ga0068864_100386789 3300005618 Bacteria 1327
81 Ga0068870_10120101 3300005840 Bacteria 1513
82 Ga0068863_100032089 3300005841 Bacteria 5008
83 Ga0068863_100233917 3300005841 Bacteria 1773
84 Ga0068858_100213076 3300005842 Bacteria 1828
85 Ga0068858_100426971 3300005842 Bacteria 1275
86 Ga0068860_100008552 3300005843 Bacteria 10199
87 Ga0068860_100046355 3300005843 Bacteria 4145
88 Ga0068860_100093259 3300005843 Bacteria 2869
89 Ga0068862_100204248 3300005844 Bacteria 1783
90 Ga0068862_100530461 3300005844 Bacteria 1121
91 Ga0081455_10000079 3300005937 Bacteria 104277
92 Ga0081455_10016856 3300005937 Bacteria 7025
93 Ga0081538_10010437 3300005981 Bacteria 7615
94 Ga0081540_1013597 3300005983 Bacteria 5280
95 Ga0081539_10000462 3300005985 Bacteria 86060
96 Ga0081539_10008146 3300005985 Bacteria 9250
97 Ga0081539_10121622 3300005985 Bacteria 1295
98 Ga0070717_10040642 3300006028 Bacteria 3788
99 Ga0070717_10344467 3300006028 Bacteria 1331
100 Ga0075363_100000040 3300006048 Bacteria 24421
101 Ga0075363_100001967 3300006048 Bacteria 8163
102 Ga0075364_10067941 3300006051 Bacteria 2344
103 Ga0070715_10009156 3300006163 Bacteria 3480
104 Ga0070715_10117684 3300006163 Bacteria 1262
105 Ga0070716_100024143 3300006173 Bacteria 3233
106 Ga0070712_100007760 3300006175 Bacteria 6717
107 Ga0070712_100026460 3300006175 Bacteria 3864
108 Ga0075362_10019705 3300006177 Bacteria 2809
109 Ga0075367_10003515 3300006178 Bacteria 7487
110 Ga0075367_10055244 3300006178 Bacteria 2356
111 Ga0075366_10004942 3300006195 Bacteria 7192
112 Ga0075366_10007825 3300006195 Bacteria 5913
113 Ga0097621_100325797 3300006237 Bacteria 1361
114 Ga0075370_10001863 3300006353 Bacteria 9454
115 Ga0075370_10006035 3300006353 Bacteria 6070
116 Ga0075370_10009947 3300006353 Bacteria 4956
117 Ga0068871_100120799 3300006358 Bacteria 2213
118 Ga0075428_100012129 3300006844 Bacteria 9588
119 Ga0075428_100041983 3300006844 Bacteria 5030
120 Ga0075428_100070373 3300006844 Bacteria 3825
121 Ga0075428_100210545 3300006844 Bacteria 2101
122 Ga0075430_100160399 3300006846 Bacteria 1872
123 Ga0075431_100001360 3300006847 Bacteria 22412
124 Ga0075431_100004400 3300006847 Bacteria 13813
125 Ga0075431_100004730 3300006847 Bacteria 13378
126 Ga0075431_100086638 3300006847 Bacteria 3232
127 Ga0075431_100092347 3300006847 Bacteria 3124
128 Ga0075431_100153243 3300006847 Bacteria 2372
129 Ga0075433_10000516 3300006852 Bacteria 25196
130 Ga0075434_100002224 3300006871 Bacteria 16937
131 Ga0075434_100013116 3300006871 Bacteria 7871
132 Ga0075434_100079938 3300006871 Bacteria 3266
133 Ga0075429_100046632 3300006880 Bacteria 3771
134 Ga0097620_100017259 3300006931 Bacteria 7249
135 Ga0097620_100347584 3300006931 Bacteria 1578
136 Ga0075435_100143253 3300007076 Bacteria 2006
137 Ga0075435_100317811 3300007076 Bacteria 1333
138 Ga0099794_10009782 3300007265 Bacteria 4048
139 Ga0105240_10039979 3300009093 Bacteria 6004
140 Ga0105240_10055139 3300009093 Bacteria 4977
141 Ga0105240_10133366 3300009093 Unclassified 2976
142 Ga0111539_10002248 3300009094 Bacteria 25734
143 Ga0111539_10010209 3300009094 Bacteria 11832
144 Ga0111539_10014594 3300009094 Bacteria 9806
145 Ga0111539_10019373 3300009094 Bacteria 8399
146 Ga0111539_10028791 3300009094 Bacteria 6774
147 Ga0111539_10139191 3300009094 Bacteria 2842
148 Ga0105245_10378536 3300009098 Bacteria 1409
149 Ga0105245_10386808 3300009098 Bacteria 1394
150 Ga0105245_10669730 3300009098 Bacteria 1069
151 Ga0105247_10053237 3300009101 Bacteria 2496
152 Ga0114129_10006391 3300009147 Bacteria 16711
153 Ga0114129_10083799 3300009147 Bacteria 4427
154 Ga0114129_10115822 3300009147 Bacteria 3693
155 Ga0114129_10142963 3300009147 Bacteria 3278
156 Ga0114129_10482845 3300009147 Bacteria 1621
157 Ga0114129_10701810 3300009147 Bacteria 1300
158 Ga0105243_10000280 3300009148 Bacteria 56784
159 Ga0105241_10112386 3300009174 Bacteria 2182
160 Ga0105242_10190349 3300009176 Bacteria 1816
161 Ga0105242_10258841 3300009176 Bacteria 1571
162 Ga0105248_10001816 3300009177 Bacteria 23730
163 Ga0105248_10011975 3300009177 Bacteria 9566
164 Ga0105249_10319810 3300009553 Bacteria 1563
165 Ga0105239_10083745 3300010375 Bacteria 3513
166 Ga0157370_10029175 3300013104 Bacteria 5419
167 Ga0157370_10032725 3300013104 Bacteria 5075
168 Ga0157369_10019470 3300013105 Bacteria 7593
169 Ga0157374_10424843 3300013296 Bacteria 1328
170 Ga0163162_10431966 3300013306 Unclassified 1449
171 Ga0157375_10132810 3300013308 Bacteria 2610
172 Ga0157375_10178636 3300013308 Bacteria 2274
173 Ga0157375_10353868 3300013308 Bacteria 1634
174 Ga0163163_10033622 3300014325 Bacteria 4961
175 Ga0163163_10243322 3300014325 Bacteria 1849
176 Ga0163163_10538923 3300014325 Bacteria 1229
177 Ga0157380_10079279 3300014326 Bacteria 2682
178 Ga0182008_10031297 3300014497 Bacteria 2679
179 Ga0157379_10329120 3300014968 Bacteria 1396
180 Ga0206356_11690386 3300020070 Unclassified 1286
181 Ga0207697_10029464 3300025315 Bacteria 2246
182 Ga0207653_10001360 3300025885 Bacteria 7970
183 Ga0207710_10073408 3300025900 Bacteria 1573
184 Ga0207688_10059883 3300025901 Bacteria 2144
185 Ga0207680_10044956 3300025903 Bacteria 2600
186 Ga0207647_10081181 3300025904 Bacteria 1943
187 Ga0207645_10200455 3300025907 Bacteria 1313
188 Ga0207643_10033384 3300025908 Bacteria 2879
189 Ga0207705_10097461 3300025909 Bacteria 2160
190 Ga0207654_10093051 3300025911 Bacteria 1842
191 Ga0207707_10012965 3300025912 Bacteria 7257
192 Ga0207707_10048496 3300025912 Bacteria 3699
193 Ga0207707_10067161 3300025912 Bacteria 3123
194 Ga0207695_10118192 3300025913 Unclassified 2622
195 Ga0207693_10004903 3300025915 Bacteria 11246
196 Ga0207693_10039498 3300025915 Bacteria 3717
197 Ga0207693_10047086 3300025915 Bacteria 3389
198 Ga0207693_10067394 3300025915 Bacteria 2803
199 Ga0207693_10069037 3300025915 Bacteria 2766
200 Ga0207663_10067877 3300025916 Bacteria 2288
201 Ga0207660_10003151 3300025917 Bacteria 10796
202 Ga0207660_10012446 3300025917 Bacteria 5567
203 Ga0207660_10136287 3300025917 Bacteria 1873
204 Ga0207660_10271990 3300025917 Bacteria 1342
205 Ga0207662_10015023 3300025918 Bacteria 4350
206 Ga0207662_10087165 3300025918 Bacteria 1914
207 Ga0207662_10168468 3300025918 Bacteria 1403
208 Ga0207652_10004363 3300025921 Bacteria 11526
209 Ga0207652_10071228 3300025921 Bacteria 3020
210 Ga0207652_10145596 3300025921 Bacteria 2120
211 Ga0207652_10156750 3300025921 Bacteria 2040
212 Ga0207652_10157624 3300025921 Bacteria 2034
213 Ga0207681_10017075 3300025923 Bacteria 4554
214 Ga0207681_10052111 3300025923 Bacteria 2774
215 Ga0207650_10175780 3300025925 Bacteria 1704
216 Ga0207687_10230823 3300025927 Bacteria 1462
217 Ga0207687_10289148 3300025927 Bacteria 1317
218 Ga0207687_10424781 3300025927 Bacteria 1097
219 Ga0207700_10015443 3300025928 Bacteria 5038
220 Ga0207700_10023752 3300025928 Bacteria 4234
221 Ga0207664_10409357 3300025929 Bacteria 1207
222 Ga0207644_10073450 3300025931 Bacteria 2508
223 Ga0207690_10056010 3300025932 Bacteria 2658
224 Ga0207706_10049675 3300025933 Bacteria 3706
225 Ga0207706_10101416 3300025933 Bacteria 2532
226 Ga0207686_10020649 3300025934 Bacteria 3766
227 Ga0207709_10000181 3300025935 Bacteria 83629
228 Ga0207670_10002474 3300025936 Bacteria 9695
229 Ga0207670_10061693 3300025936 Bacteria 2559
230 Ga0207669_10020822 3300025937 Bacteria 3448
231 Ga0207669_10043215 3300025937 Bacteria 2638
232 Ga0207669_10048607 3300025937 Bacteria 2521
233 Ga0207704_10176632 3300025938 Bacteria 1539
234 Ga0207665_10005479 3300025939 Bacteria 8472
235 Ga0207691_10112630 3300025940 Bacteria 2418
236 Ga0207691_10408335 3300025940 Bacteria 1158
237 Ga0207711_10001186 3300025941 Bacteria 24752
238 Ga0207689_10055001 3300025942 Bacteria 3276
239 Ga0207689_10108686 3300025942 Bacteria 2279
240 Ga0207661_10338667 3300025944 Bacteria 1355
241 Ga0207679_10526010 3300025945 Bacteria 1058
242 Ga0207712_10006355 3300025961 Bacteria 7455
243 Ga0207668_10088438 3300025972 Bacteria 2269
244 Ga0207668_10339666 3300025972 Bacteria 1252
245 Ga0207703_10163635 3300026035 Bacteria 1951
246 Ga0207703_10263522 3300026035 Bacteria 1558
247 Ga0207639_10159252 3300026041 Unclassified 1900
248 Ga0207639_10406103 3300026041 Bacteria 1228
249 Ga0207678_10008321 3300026067 Bacteria 9141
250 Ga0207678_10066665 3300026067 Bacteria 3091
251 Ga0207708_10050976 3300026075 Bacteria 3151
252 Ga0207641_10098660 3300026088 Bacteria 2569
253 Ga0207641_10167552 3300026088 Bacteria 2002
254 Ga0207641_10418176 3300026088 Bacteria 1290
255 Ga0207648_10005320 3300026089 Bacteria 12983
256 Ga0207648_10067325 3300026089 Bacteria 3122
257 Ga0207648_10124593 3300026089 Bacteria 2266
258 Ga0207648_10206796 3300026089 Bacteria 1742
259 Ga0207676_10009948 3300026095 Bacteria 6764
260 Ga0207676_10063040 3300026095 Bacteria 2943
261 Ga0207674_10016947 3300026116 Bacteria 7956
262 Ga0207674_10125848 3300026116 Bacteria 2528
263 Ga0207674_10149064 3300026116 Bacteria 2297
264 Ga0207674_10543222 3300026116 Bacteria 1123
265 Ga0207675_100502026 3300026118 Bacteria 1208
266 Ga0207683_10053069 3300026121 Bacteria 3553
267 Ga0207428_10015210 3300027907 Bacteria 6660
268 Ga0207428_10033993 3300027907 Bacteria 4181
269 Ga0268266_10211657 3300028379 Bacteria 1778
270 Ga0268265_10003237 3300028380 Bacteria 11829
271 Ga0268265_10184716 3300028380 Bacteria 1795
272 Ga0268265_10298375 3300028380 Bacteria 1450
273 Ga0268265_10651939 3300028380 Bacteria 1012
274 Ga0268264_10015635 3300028381 Bacteria 6217
275 Ga0268264_10041042 3300028381 Bacteria 3825
276 Ga0265318_10005966 3300028577 Bacteria 5659
277 Ga0307517_10000710 3300028786 Bacteria 57392
278 Ga0307515_10007276 3300028794 Bacteria 21919
279 Ga0265332_10073076 3300031238 Bacteria 1460
280 Ga0265325_10002608 3300031241 Bacteria 12073
281 Ga0265325_10016650 3300031241 Bacteria 4105
282 Ga0265327_10000402 3300031251 Bacteria 80983
283 Ga0265327_10039455 3300031251 Bacteria 2565
284 Ga0265316_10024953 3300031344 Bacteria 4997
285 Ga0307513_10001313 3300031456 Bacteria 35941
286 Ga0265342_10000674 3300031712 Bacteria 35642
287 Ga0307416_100404757 3300032002 Bacteria 1403
288 Ga0307510_10011803 3300033180 Bacteria 10365
289 Ga0373938_0023537 3300034957 Bacteria 1267
290 Ga0373929_0005995 3300035085 Bacteria 2195
291 Ga0373944_0040300 3300035089 Bacteria 1441
292 Ga0373951_0006223 3300035091 Bacteria 2734
293 Ga0373939_0008871 3300035114 Bacteria 2478
294 Ga0373943_0024265 3300035170 Unclassified 2827
295 Ga0373946_0159895 3300035171 Bacteria 1057
296 Ga0373955_0141801 3300035172 Bacteria 1410
297 Ga0373955_0210148 3300035172 Bacteria 1160
298 Ga0373961_0008453 3300035241 Bacteria 2503
299 Ga0373962_0004426 3300035242 Bacteria 3395
300 Ga0373962_0037874 3300035242 Bacteria 1348
301 Ga0373931_0002198 3300035691 Bacteria 8618
302 Ga0373931_0012398 3300035691 Bacteria 4129
303 Ga0373927_0049962 3300035695 Bacteria 2703
304 Ga0373927_0200185 3300035695 Bacteria 1311
305 Ga0373933_0217097 3300035724 Bacteria 1226
306 Ga0373937_0037871 3300036401 Bacteria 4395
307 Ga0373925_0109411 3300037068 Bacteria 2133
308 Ga0373925_0153460 3300037068 Bacteria 1810
309 Ga0395899_0000496 3300037312 Bacteria 43823
310 Ga0395900_0003346 3300037418 Bacteria 17317
311 Ga0395898_0001365 3300037466 Bacteria 35163
312 Ga0395898_0382996 3300037466 Bacteria 1341
313 Ga0395905_0000042 3300037471 Bacteria 247894
314 Ga0395901_0001423 3300038443 Bacteria 24941
315 Ga0436365_1858167 3300039437 Bacteria 8849
316 Ga0436360_1265717 3300039438 Bacteria 1098
317 Ga0436360_1321288 3300039438 Bacteria 1084
318 Ga0436361_0896018 3300039447 Bacteria 14706
319 Ga0436361_1154190 3300039447 Bacteria 3745
320 Ga0439436_0005917 3300041404 Bacteria 3750
321 Ga0439436_0008143 3300041404 Bacteria 3222
322 Ga0439447_029342 3300041407 Bacteria 1393
323 Ga0439466_0009576 3300041411 Bacteria 3621
324 Ga0439466_0015021 3300041411 Bacteria 2814
325 Ga0439465_0003300 3300041413 Bacteria 5271
326 Ga0439441_020888 3300042001 Bacteria 1204
327 Ga0439443_016319 3300042003 Bacteria 1134
328 Ga0439432_005930 3300042006 Bacteria 4387
329 Ga0439449_0002779 3300042007 Bacteria 6803
330 Ga0439449_0040380 3300042007 Bacteria 1734
331 Ga0439452_007384 3300042010 Bacteria 3370
332 Ga0439457_012420 3300042014 Bacteria 1920
333 Ga0450923_000732 3300042125 Bacteria 3893
334 Ga0450894_004041 3300042131 Bacteria 1915
335 Ga0450898_006754 3300042134 Bacteria 1771
336 Ga0439446_0004210 3300042156 Bacteria 3633
337 Ga0439460_0070383 3300042461 Bacteria 1083
338 Ga0451577_0086780 3300042876 Bacteria 2792
339 Ga0451576_0058643 3300045051 Bacteria 4022
340 Ga0495629_0034648 3300046459 Bacteria 3569
341 Ga0495638_0009733 3300046460 Bacteria 6715
342 Ga0495580_0062771 3300046472 Bacteria 2606
343 Ga0495582_0044944 3300046473 Bacteria 2432
344 Ga0495605_0016451 3300046474 Bacteria 4004
345 Ga0495584_0074943 3300046491 Bacteria 1701
346 Ga0495585_0046000 3300046492 Bacteria 2435
347 Ga0495620_0102370 3300046515 Bacteria 1141
348 Ga0495628_0110410 3300046516 Bacteria 2116
349 Ga0495630_0092944 3300046517 Bacteria 2280
350 Ga0495648_0009462 3300046524 Bacteria 7547
351 Ga0495598_0001635 3300046537 Bacteria 4494
352 Ga0495645_0012506 3300046543 Bacteria 5982
353 Ga0495656_0030023 3300046615 Bacteria 2194
354 Ga0495668_0109989 3300046616 Bacteria 1507
355 Ga0495599_0281751 3300046678 Bacteria 1007
356 Ga0495658_0064713 3300046683 Bacteria 2107
357 Ga0495676_0046812 3300047321 Bacteria 3505
358 Ga0495680_0233235 3300047322 Bacteria 1310
359 Ga0495602_0254138 3300048088 Bacteria 1308
360 Ga0495615_0005203 3300048090 Bacteria 2325
361 Ga0496100_0025730 3300048903 Bacteria 3600
362 Ga0496100_0214672 3300048903 Bacteria 1409
363 Ga0496101_0037733 3300048904 Bacteria 3429
364 Ga0496101_0116116 3300048904 Bacteria 2019
365 Ga0496101_0195565 3300048904 Bacteria 1562
366 Ga0496102_0005983 3300048905 Bacteria 10361
367 Ga0496102_0019183 3300048905 Bacteria 6020
368 Ga0496102_0032326 3300048905 Bacteria 4700
369 Ga0496103_0057407 3300048906 Bacteria 2417
370 Ga0496103_0269833 3300048906 Bacteria 1095
371 Ga0496104_0001111 3300048907 Bacteria 23019
372 Ga0496104_0028234 3300048907 Bacteria 5200
373 Ga0496105_0009635 3300048908 Bacteria 7560
374 Ga0496106_0009394 3300048909 Bacteria 7227
375 Ga0496106_0010278 3300048909 Bacteria 6919
376 Ga0496106_0038436 3300048909 Unclassified 3581
377 Ga0496106_0054072 3300048909 Bacteria 3033
378 Ga0496107_0002409 3300048910 Bacteria 12112
379 Ga0496107_0033626 3300048910 Bacteria 3669
380 Ga0496107_0233642 3300048910 Bacteria 1368
381 Ga0496108_0005412 3300048911 Bacteria 10321
382 Ga0496108_0015120 3300048911 Bacteria 6297
383 Ga0496108_0123336 3300048911 Unclassified 2223
384 Ga0496108_0332827 3300048911 Bacteria 1324
385 Ga0496109_0001688 3300048912 Bacteria 18388
386 Ga0496109_0043090 3300048912 Bacteria 4091
387 Ga0496109_0048349 3300048912 Bacteria 3870
388 Ga0496110_0015039 3300048913 Bacteria 6435
389 Ga0496110_0030620 3300048913 Bacteria 4639
390 Ga0496111_0001195 3300048914 Bacteria 14487
391 Ga0496111_0012579 3300048914 Bacteria 5735
392 Ga0496111_0033108 3300048914 Bacteria 3686
393 Ga0496111_0073703 3300048914 Bacteria 2486
394 Ga0496111_0142547 3300048914 Bacteria 1776
395 Ga0496112_0000632 3300048915 Bacteria 24448
396 Ga0496112_0131730 3300048915 Bacteria 2471
397 Ga0496112_0357488 3300048915 Bacteria 1403
398 Ga0496112_0365386 3300048915 Bacteria 1385
399 Ga0496114_0007847 3300048917 Bacteria 8442
400 Ga0496114_0287328 3300048917 Bacteria 1451
401 Ga0496114_0451233 3300048917 Unclassified 1139
402 Ga0496115_0003972 3300048918 Bacteria 10670
403 Ga0496115_0033830 3300048918 Bacteria 4037
404 Ga0496115_0180354 3300048918 Bacteria 1746
405 Ga0496115_0233174 3300048918 Bacteria 1517
406 Ga0496115_0361660 3300048918 Unclassified 1182
407 Ga0501033_0032693 3300049570 Bacteria 3907
408 Ga0501034_0072518 3300049571 Bacteria 3452
409 Ga0501034_0112462 3300049571 Bacteria 2713
410 Ga0501034_0189786 3300049571 Bacteria 2017
411 Ga0501036_0004299 3300049572 Bacteria 11505
412 Ga0501038_0070573 3300049574 Bacteria 2965
413 Ga0501039_0023785 3300049575 Bacteria 4703
414 Ga0501039_0183016 3300049575 Bacteria 1648
415 Ga0501040_0040441 3300049576 Bacteria 3173
416 Ga0501040_0191401 3300049576 Bacteria 1451
417 Ga0501041_0017510 3300049577 Bacteria 4264
418 Ga0501042_0109747 3300049578 Bacteria 1987
419 Ga0501046_0047940 3300049580 Bacteria 3385
420 Ga0501046_0100249 3300049580 Bacteria 2222
421 Ga0501047_0029984 3300049581 Bacteria 5244
422 Ga0501047_0133206 3300049581 Bacteria 2365
423 Ga0501048_0093657 3300049582 Bacteria 2119
424 Ga0501048_0114828 3300049582 Bacteria 1902
425 Ga0501048_0163527 3300049582 Bacteria 1575
426 Ga0501067_0080161 3300049583 Bacteria 1809
427 Ga0501068_0131760 3300049584 Bacteria 1564
428 Ga0501070_0015678 3300049586 Bacteria 6370
429 Ga0501070_0314039 3300049586 Bacteria 1275
430 Ga0501070_0366576 3300049586 Bacteria 1168
431 Ga0501070_0379402 3300049586 Bacteria 1145
432 Ga0501072_0029097 3300049588 Bacteria 4313
433 Ga0501072_0067205 3300049588 Bacteria 2828
434 Ga0501072_0224279 3300049588 Bacteria 1498
435 Ga0501072_0308638 3300049588 Bacteria 1258
436 Ga0501073_0157338 3300049589 Bacteria 1574
437 Ga0501074_0031636 3300049590 Bacteria 3833
438 Ga0501074_0118120 3300049590 Bacteria 1897
439 Ga0501075_0011769 3300049591 Bacteria 6203
440 Ga0501075_0056916 3300049591 Bacteria 2944
441 Ga0501075_0188036 3300049591 Bacteria 1575
442 Ga0501076_0138428 3300049592 Bacteria 1977
443 Ga0501076_0165826 3300049592 Bacteria 1800
444 Ga0501076_0192551 3300049592 Bacteria 1664
445 Ga0501077_0101379 3300049593 Bacteria 1824
446 Ga0501077_0191476 3300049593 Bacteria 1299
447 Ga0501079_0008709 3300049741 Bacteria 7692
448 Ga0501079_0016599 3300049741 Bacteria 5623
449 Ga0501079_0043553 3300049741 Bacteria 3465
450 Ga0501079_0075285 3300049741 Bacteria 2610
451 Ga0501079_0220800 3300049741 Bacteria 1481
452 Ga0501080_0163777 3300049742 Bacteria 2053
453 Ga0501081_0007528 3300049743 Bacteria 7063
454 Ga0501081_0395264 3300049743 Bacteria 1023
455 Ga0501083_0006890 3300049744 Bacteria 8069
456 Ga0501083_0019920 3300049744 Bacteria 4669
457 Ga0501083_0022375 3300049744 Bacteria 4388
458 Ga0501083_0161429 3300049744 Bacteria 1466
459 Ga0501035_0099701 3300049822 Bacteria 2550
460 Ga0501035_0141972 3300049822 Bacteria 2087
461 Ga0501044_0000351 3300049823 Bacteria 57748
462 Ga0501044_0094905 3300049823 Bacteria 3006
463 nmdc:mga03683_4151_c1 3300050489 Bacteria 2727
464 nmdc:mga03n38_4859_c1 3300050490 Unclassified 4502
465 nmdc:mga0yw44_141795_c1 3300050492 Bacteria 1562
466 nmdc:mga0yw44_27310_c1 3300050492 Bacteria 3268
467 nmdc:mga0k408_1355_c1 3300050493 Bacteria 13214
468 nmdc:mga0k408_43590_c1 3300050493 Bacteria 2586
469 nmdc:mga06z11_7706_c1 3300050494 Bacteria 4445
470 nmdc:mga07m45_28_c1 3300050496 Bacteria 90620
471 nmdc:mga07m45_87968_c1 3300050496 Bacteria 1778
472 nmdc:mga05p37_171325_c1 3300050507 Bacteria 2647
473 nmdc:mga05p37_174886_c1 3300050507 Bacteria 2616
474 nmdc:mga05p37_23988_c1 3300050507 Bacteria 7408
475 nmdc:mga05p37_34589_c1 3300050507 Bacteria 6190
476 nmdc:mga05p37_53574_c1 3300050507 Bacteria 4961
477 nmdc:mga05p37_56275_c1 3300050507 Bacteria 4842
478 nmdc:mga05p37_93783_c1 3300050507 Bacteria 3699
479 nmdc:mga09592_287646_c1 3300050508 Bacteria 1425
480 nmdc:mga09592_78988_c1 3300050508 Bacteria 2801
481 nmdc:mga0qj67_65286_c1 3300050509 Bacteria 2897
482 nmdc:mga06r32_126078_c1 3300050510 Bacteria 2529
483 nmdc:mga06r32_152878_c1 3300050510 Bacteria 2287
484 nmdc:mga06r32_19361_c1 3300050510 Bacteria 6244
485 nmdc:mga06r32_542578_c1 3300050510 Bacteria 1137
486 nmdc:mga08y16_102129_c1 3300050511 Bacteria 2985
487 nmdc:mga08y16_106816_c1 3300050511 Bacteria 2914
488 nmdc:mga08y16_227617_c1 3300050511 Bacteria 1929
489 nmdc:mga08y16_32874_c1 3300050511 Bacteria 5453
490 nmdc:mga08y16_5213_c1 3300050511 Bacteria 13571
491 nmdc:mga0n895_4199_c1 3300050512 Bacteria 7300
492 nmdc:mga0n895_5663_c1 3300050512 Bacteria 10469
493 nmdc:mga0n895_64462_c1 3300050512 Bacteria 3624
494 nmdc:mga0rr50_138104_c1 3300050513 Bacteria 1958
495 nmdc:mga0rr50_169295_c1 3300050513 Bacteria 1779
496 nmdc:mga0rr50_8119_c1 3300050513 Bacteria 3946
497 nmdc:mga0a205_14086_c1 3300050515 Bacteria 7461
498 nmdc:mga0a205_230896_c1 3300050515 Bacteria 1733
499 nmdc:mga0a205_4684_c1 3300050515 Bacteria 12274
500 nmdc:mga0a205_496077_c1 3300050515 Bacteria 1078
501 Ga0495601_0054270 3300053077 Bacteria 2535
502 Ga0495655_0038225 3300053083 Bacteria 1210
503 Ga0495619_0018408 3300053085 Bacteria 4433
504 Ga0495619_0046075 3300053085 Bacteria 2866
505 Ga0495619_0062626 3300053085 Bacteria 2476
506 Ga0500651_0069354 3300053093 Bacteria 2195
507 Ga0500559_0000149 3300053136 Bacteria 55058
508 Ga0501084_0000417 3300054114 Bacteria 32966
509 Ga0501084_0067087 3300054114 Bacteria 3003
510 Ga0501084_0160964 3300054114 Unclassified 1893
511 Ga0501084_0305487 3300054114 Bacteria 1344
512 Ga0501082_0000077 3300060353 Bacteria 72496
513 Ga0501082_0013934 3300060353 Bacteria 6914
514 Ga0501082_0040824 3300060353 Bacteria 4001
515 Ga0501082_0046431 3300060353 Bacteria 3744
516 Ga0501082_0337133 3300060353 Bacteria 1314
517 Ga0501082_0341856 3300060353 Bacteria 1304
518 Ga0501082_0345156 3300060353 Bacteria 1297
519 Ga0530510_0032907 3300061734 Bacteria 3731
520 Ga0530510_0086503 3300061734 Bacteria 2284
521 Ga0530510_0370816 3300061734 Bacteria 1077
522 2509147669 2508501128 Bacteria 8613869
523 2842334464 2842333319 Bacteria 8899485
524 2881413354 2881412998 Bacteria 6492157
525 2996312482 2996310559 Bacteria 6357320
526 Ga0157376_10262124
527 JGI25404J52841_10032656
528 Ga0070658_10007422
529 Ga0070690_100040082
530 Ga0070670_100007480
531 Ga0068869_100060348
532 Ga0070680_100012181
533 Ga0070680_100016365
534 Ga0070680_100017855
535 Ga0070680_100018258
536 Ga0070680_100193726
537 Ga0070680_100464101
538 Ga0070682_100154708
539 Ga0068868_100010205
540 Ga0068868_100336060
541 Ga0070660_100040037
542 Ga0070689_100009023
543 Ga0070689_100078976
544 Ga0070691_10023945
545 Ga0070691_10024180
546 Ga0070661_100050032
547 Ga0070669_100027048
548 Ga0070669_100157576
549 Ga0070669_100319864
550 Ga0070671_100076813
551 Ga0070674_100041844
552 Ga0070674_100109516
553 Ga0070688_100010373
554 Ga0070688_100267308
555 Ga0070659_100084760
556 Ga0070667_100044134
557 Ga0070703_10033952
558 Ga0070714_100559077
559 Ga0070713_100009440
560 Ga0070701_10002104
561 Ga0070711_100259930
562 Ga0070705_100001628
563 Ga0070705_100130213
564 Ga0070705_100263397
565 Ga0070700_100007411
566 Ga0070700_100173203
567 Ga0070694_100018164
568 Ga0070708_100141684
569 Ga0070708_100170098
570 Ga0070663_100005168
571 Ga0070662_100074710
572 Ga0070681_10083339
573 Ga0070681_10513063
574 Ga0068867_100084693
575 Ga0068867_100161282
576 Ga0068867_100261644
577 Ga0070685_10120309
578 Ga0070698_100066760
579 Ga0070699_100002070
580 Ga0070679_100054091
581 Ga0070679_100133807
582 Ga0070679_100297004
583 Ga0070697_100140094
584 Ga0070697_100145561
585 Ga0070686_100152551
586 Ga0070686_100254711
587 Ga0070695_100016568
588 Ga0070695_100029996
589 Ga0070695_100042109
590 Ga0070696_100010612
591 Ga0070696_100052245
592 Ga0070665_100088325
593 Ga0070665_100347160
594 Ga0070665_100504996
595 Ga0070704_100020064
596 Ga0070664_100063252
597 Ga0068857_100346316
598 Ga0070702_100128858
599 Ga0070702_100133114
600 Ga0068852_100356264
601 Ga0068859_100017257
602 Ga0068859_100347569
603 Ga0068864_100013607
604 Ga0068864_100090054
605 Ga0068864_100386789
606 Ga0068870_10120101
607 Ga0068863_100032089
608 Ga0068863_100233917
609 Ga0068858_100213076
610 Ga0068858_100426971
611 Ga0068860_100008552
612 Ga0068860_100046355
613 Ga0068860_100093259
614 Ga0068862_100204248
615 Ga0068862_100530461
616 Ga0081455_10000079
617 Ga0081455_10016856
618 Ga0081538_10010437
619 Ga0081540_1013597
620 Ga0081539_10000462
621 Ga0081539_10008146
622 Ga0081539_10121622
623 Ga0070717_10040642
624 Ga0070717_10344467
625 Ga0075363_100000040
626 Ga0075363_100001967
627 Ga0075364_10067941
628 Ga0070715_10009156
629 Ga0070715_10117684
630 Ga0070716_100024143
631 Ga0070712_100007760
632 Ga0070712_100026460
633 Ga0075362_10019705
634 Ga0075367_10003515
635 Ga0075367_10055244
636 Ga0075366_10004942
637 Ga0075366_10007825
638 Ga0097621_100325797
639 Ga0075370_10001863
640 Ga0075370_10006035
641 Ga0075370_10009947
642 Ga0068871_100120799
643 Ga0075428_100012129
644 Ga0075428_100041983
645 Ga0075428_100070373
646 Ga0075428_100210545
647 Ga0075430_100160399
648 Ga0075431_100001360
649 Ga0075431_100004400
650 Ga0075431_100004730
651 Ga0075431_100086638
652 Ga0075431_100092347
653 Ga0075431_100153243
654 Ga0075433_10000516
655 Ga0075434_100002224
656 Ga0075434_100013116
657 Ga0075434_100079938
658 Ga0075429_100046632
659 Ga0097620_100017259
660 Ga0097620_100347584
661 Ga0075435_100143253
662 Ga0075435_100317811
663 Ga0099794_10009782
664 Ga0105240_10039979
665 Ga0105240_10055139
666 Ga0105240_10133366
667 Ga0111539_10002248
668 Ga0111539_10010209
669 Ga0111539_10014594
670 Ga0111539_10019373
671 Ga0111539_10028791
672 Ga0111539_10139191
673 Ga0105245_10378536
674 Ga0105245_10386808
675 Ga0105245_10669730
676 Ga0105247_10053237
677 Ga0114129_10006391
678 Ga0114129_10083799
679 Ga0114129_10115822
680 Ga0114129_10142963
681 Ga0114129_10482845
682 Ga0114129_10701810
683 Ga0105243_10000280
684 Ga0105241_10112386
685 Ga0105242_10190349
686 Ga0105242_10258841
687 Ga0105248_10001816
688 Ga0105248_10011975
689 Ga0105249_10319810
690 Ga0105239_10083745
691 Ga0157370_10029175
692 Ga0157370_10032725
693 Ga0157369_10019470
694 Ga0157374_10424843
695 Ga0163162_10431966
696 Ga0157375_10132810
697 Ga0157375_10178636
698 Ga0157375_10353868
699 Ga0163163_10033622
700 Ga0163163_10243322
701 Ga0163163_10538923
702 Ga0157380_10079279
703 Ga0182008_10031297
704 Ga0157379_10329120
705 Ga0206356_11690386
706 Ga0207697_10029464
707 Ga0207653_10001360
708 Ga0207710_10073408
709 Ga0207688_10059883
710 Ga0207680_10044956
711 Ga0207647_10081181
712 Ga0207645_10200455
713 Ga0207643_10033384
714 Ga0207705_10097461
715 Ga0207654_10093051
716 Ga0207707_10012965
717 Ga0207707_10048496
718 Ga0207707_10067161
719 Ga0207695_10118192
720 Ga0207693_10004903
721 Ga0207693_10039498
722 Ga0207693_10047086
723 Ga0207693_10067394
724 Ga0207693_10069037
725 Ga0207663_10067877
726 Ga0207660_10003151
727 Ga0207660_10012446
728 Ga0207660_10136287
729 Ga0207660_10271990
730 Ga0207662_10015023
731 Ga0207662_10087165
732 Ga0207662_10168468
733 Ga0207652_10004363
734 Ga0207652_10071228
735 Ga0207652_10145596
736 Ga0207652_10156750
737 Ga0207652_10157624
738 Ga0207681_10017075
739 Ga0207681_10052111
740 Ga0207650_10175780
741 Ga0207687_10230823
742 Ga0207687_10289148
743 Ga0207687_10424781
744 Ga0207700_10015443
745 Ga0207700_10023752
746 Ga0207664_10409357
747 Ga0207644_10073450
748 Ga0207690_10056010
749 Ga0207706_10049675
750 Ga0207706_10101416
751 Ga0207686_10020649
752 Ga0207709_10000181
753 Ga0207670_10002474
754 Ga0207670_10061693
755 Ga0207669_10020822
756 Ga0207669_10043215
757 Ga0207669_10048607
758 Ga0207704_10176632
759 Ga0207665_10005479
760 Ga0207691_10112630
761 Ga0207691_10408335
762 Ga0207711_10001186
763 Ga0207689_10055001
764 Ga0207689_10108686
765 Ga0207661_10338667
766 Ga0207679_10526010
767 Ga0207712_10006355
768 Ga0207668_10088438
769 Ga0207668_10339666
770 Ga0207703_10163635
771 Ga0207703_10263522
772 Ga0207639_10159252
773 Ga0207639_10406103
774 Ga0207678_10008321
775 Ga0207678_10066665
776 Ga0207708_10050976
777 Ga0207641_10098660
778 Ga0207641_10167552
779 Ga0207641_10418176
780 Ga0207648_10005320
781 Ga0207648_10067325
782 Ga0207648_10124593
783 Ga0207648_10206796
784 Ga0207676_10009948
785 Ga0207676_10063040
786 Ga0207674_10016947
787 Ga0207674_10125848
788 Ga0207674_10149064
789 Ga0207674_10543222
790 Ga0207675_100502026
791 Ga0207683_10053069
792 Ga0207428_10015210
793 Ga0207428_10033993
794 Ga0268266_10211657
795 Ga0268265_10003237
796 Ga0268265_10184716
797 Ga0268265_10298375
798 Ga0268265_10651939
799 Ga0268264_10015635
800 Ga0268264_10041042
801 Ga0265318_10005966
802 Ga0307517_10000710
803 Ga0307515_10007276
804 Ga0265332_10073076
805 Ga0265325_10002608
806 Ga0265325_10016650
807 Ga0265327_10000402
808 Ga0265327_10039455
809 Ga0265316_10024953
810 Ga0307513_10001313
811 Ga0265342_10000674
812 Ga0307416_100404757
813 Ga0307510_10011803
814 Ga0373938_0023537
815 Ga0373929_0005995
816 Ga0373944_0040300
817 Ga0373951_0006223
818 Ga0373939_0008871
819 Ga0373943_0024265
820 Ga0373946_0159895
821 Ga0373955_0141801
822 Ga0373955_0210148
823 Ga0373961_0008453
824 Ga0373962_0004426
825 Ga0373962_0037874
826 Ga0373931_0002198
827 Ga0373931_0012398
828 Ga0373927_0049962
829 Ga0373927_0200185
830 Ga0373933_0217097
831 Ga0373937_0037871
832 Ga0373925_0109411
833 Ga0373925_0153460
834 Ga0395899_0000496
835 Ga0395900_0003346
836 Ga0395898_0001365
837 Ga0395898_0382996
838 Ga0395905_0000042
839 Ga0395901_0001423
840 Ga0436365_1858167
841 Ga0436360_1265717
842 Ga0436360_1321288
843 Ga0436361_0896018
844 Ga0436361_1154190
845 Ga0439436_0005917
846 Ga0439436_0008143
847 Ga0439447_029342
848 Ga0439466_0009576
849 Ga0439466_0015021
850 Ga0439465_0003300
851 Ga0439441_020888
852 Ga0439443_016319
853 Ga0439432_005930
854 Ga0439449_0002779
855 Ga0439449_0040380
856 Ga0439452_007384
857 Ga0439457_012420
858 Ga0450923_000732
859 Ga0450894_004041
860 Ga0450898_006754
861 Ga0439446_0004210
862 Ga0439460_0070383
863 Ga0451577_0086780
864 Ga0451576_0058643
865 Ga0495629_0034648
866 Ga0495638_0009733
867 Ga0495580_0062771
868 Ga0495582_0044944
869 Ga0495605_0016451
870 Ga0495584_0074943
871 Ga0495585_0046000
872 Ga0495620_0102370
873 Ga0495628_0110410
874 Ga0495630_0092944
875 Ga0495648_0009462
876 Ga0495598_0001635
877 Ga0495645_0012506
878 Ga0495656_0030023
879 Ga0495668_0109989
880 Ga0495599_0281751
881 Ga0495658_0064713
882 Ga0495676_0046812
883 Ga0495680_0233235
884 Ga0495602_0254138
885 Ga0495615_0005203
886 Ga0496100_0025730
887 Ga0496100_0214672
888 Ga0496101_0037733
889 Ga0496101_0116116
890 Ga0496101_0195565
891 Ga0496102_0005983
892 Ga0496102_0019183
893 Ga0496102_0032326
894 Ga0496103_0057407
895 Ga0496103_0269833
896 Ga0496104_0001111
897 Ga0496104_0028234
898 Ga0496105_0009635
899 Ga0496106_0009394
900 Ga0496106_0010278
901 Ga0496106_0038436
902 Ga0496106_0054072
903 Ga0496107_0002409
904 Ga0496107_0033626
905 Ga0496107_0233642
906 Ga0496108_0005412
907 Ga0496108_0015120
908 Ga0496108_0123336
909 Ga0496108_0332827
910 Ga0496109_0001688
911 Ga0496109_0043090
912 Ga0496109_0048349
913 Ga0496110_0015039
914 Ga0496110_0030620
915 Ga0496111_0001195
916 Ga0496111_0012579
917 Ga0496111_0033108
918 Ga0496111_0073703
919 Ga0496111_0142547
920 Ga0496112_0000632
921 Ga0496112_0131730
922 Ga0496112_0357488
923 Ga0496112_0365386
924 Ga0496114_0007847
925 Ga0496114_0287328
926 Ga0496114_0451233
927 Ga0496115_0003972
928 Ga0496115_0033830
929 Ga0496115_0180354
930 Ga0496115_0233174
931 Ga0496115_0361660
932 Ga0501033_0032693
933 Ga0501034_0072518
934 Ga0501034_0112462
935 Ga0501034_0189786
936 Ga0501036_0004299
937 Ga0501038_0070573
938 Ga0501039_0023785
939 Ga0501039_0183016
940 Ga0501040_0040441
941 Ga0501040_0191401
942 Ga0501041_0017510
943 Ga0501042_0109747
944 Ga0501046_0047940
945 Ga0501046_0100249
946 Ga0501047_0029984
947 Ga0501047_0133206
948 Ga0501048_0093657
949 Ga0501048_0114828
950 Ga0501048_0163527
951 Ga0501067_0080161
952 Ga0501068_0131760
953 Ga0501070_0015678
954 Ga0501070_0314039
955 Ga0501070_0366576
956 Ga0501070_0379402
957 Ga0501072_0029097
958 Ga0501072_0067205
959 Ga0501072_0224279
960 Ga0501072_0308638
961 Ga0501073_0157338
962 Ga0501074_0031636
963 Ga0501074_0118120
964 Ga0501075_0011769
965 Ga0501075_0056916
966 Ga0501075_0188036
967 Ga0501076_0138428
968 Ga0501076_0165826
969 Ga0501076_0192551
970 Ga0501077_0101379
971 Ga0501077_0191476
972 Ga0501079_0008709
973 Ga0501079_0016599
974 Ga0501079_0043553
975 Ga0501079_0075285
976 Ga0501079_0220800
977 Ga0501080_0163777
978 Ga0501081_0007528
979 Ga0501081_0395264
980 Ga0501083_0006890
981 Ga0501083_0019920
982 Ga0501083_0022375
983 Ga0501083_0161429
984 Ga0501035_0099701
985 Ga0501035_0141972
986 Ga0501044_0000351
987 Ga0501044_0094905
988 nmdc:mga03683_4151_c1
989 nmdc:mga03n38_4859_c1
990 nmdc:mga0yw44_141795_c1
991 nmdc:mga0yw44_27310_c1
992 nmdc:mga0k408_1355_c1
993 nmdc:mga0k408_43590_c1
994 nmdc:mga06z11_7706_c1
995 nmdc:mga07m45_28_c1
996 nmdc:mga07m45_87968_c1
997 nmdc:mga05p37_171325_c1
998 nmdc:mga05p37_174886_c1
999 nmdc:mga05p37_23988_c1
1000 nmdc:mga05p37_34589_c1
1001 nmdc:mga05p37_53574_c1
1002 nmdc:mga05p37_56275_c1
1003 nmdc:mga05p37_93783_c1
1004 nmdc:mga09592_287646_c1
1005 nmdc:mga09592_78988_c1
1006 nmdc:mga0qj67_65286_c1
1007 nmdc:mga06r32_126078_c1
1008 nmdc:mga06r32_152878_c1
1009 nmdc:mga06r32_19361_c1
1010 nmdc:mga06r32_542578_c1
1011 nmdc:mga08y16_102129_c1
1012 nmdc:mga08y16_106816_c1
1013 nmdc:mga08y16_227617_c1
1014 nmdc:mga08y16_32874_c1
1015 nmdc:mga08y16_5213_c1
1016 nmdc:mga0n895_4199_c1
1017 nmdc:mga0n895_5663_c1
1018 nmdc:mga0n895_64462_c1
1019 nmdc:mga0rr50_138104_c1
1020 nmdc:mga0rr50_169295_c1
1021 nmdc:mga0rr50_8119_c1
1022 nmdc:mga0a205_14086_c1
1023 nmdc:mga0a205_230896_c1
1024 nmdc:mga0a205_4684_c1
1025 nmdc:mga0a205_496077_c1
1026 Ga0495601_0054270
1027 Ga0495655_0038225
1028 Ga0495619_0018408
1029 Ga0495619_0046075
1030 Ga0495619_0062626
1031 Ga0500651_0069354
1032 Ga0500559_0000149
1033 Ga0501084_0000417
1034 Ga0501084_0067087
1035 Ga0501084_0160964
1036 Ga0501084_0305487
1037 Ga0501082_0000077
1038 Ga0501082_0013934
1039 Ga0501082_0040824
1040 Ga0501082_0046431
1041 Ga0501082_0337133
1042 Ga0501082_0341856
1043 Ga0501082_0345156
1044 Ga0530510_0032907
1045 Ga0530510_0086503
1046 Ga0530510_0370816
1047 2509147669
1048 2842334464
1049 2881413354
1050 2996312482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

180

310

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

56

138

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

213

353

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9381 1 323
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9353 1 323
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9331 2 322
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9302 2 322
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9247 2 322
ID Description Score Start End Superfamily
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 117 260 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9421 117 260 3.40.50.720
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9403 125 262 3.40.50.720
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 118 261 3.40.50.720
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.933 1 322 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A0A0BYB4-F1-model_v4 NADPH:quinone oxidoreductase 0.9568 137 323 GO:0016651
GO:0070402
AF-A0A6G7LN29-F1-model_v4 Zinc-binding dehydrogenase 0.9522 1 323 GO:0016651
GO:0070402
AF-Q46NP1-F1-model_v4 Zinc-containing alcohol dehydrogenase superfamily 0.9508 1 323 GO:0016651
GO:0070402
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9504 120 234 GO:0016491
AF-A0A6G7LN29-F1-model_v4 Zinc-binding dehydrogenase 0.9494 1 323 GO:0016651
GO:0070402

Map