F459294

General Info

Members Datasets Scaffolds Average Seq Length
525 191 1050 195

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100449937|Ga0307415_1004499371
Length 209
Sequence MRFHYNCDTPPMRWAARKGFRFGPDGFHFDWGDDGPGGFGGGHRRRDRKRMFEGGELRLVLLKLIADEPRHGYQLIKAVEDLTEGDYAPSPGIVYPTLTMLEDMGHIREQKSKDSKKVFEATDEGRAHLEENADEVDELFEKLEGHGRTRRHGQRPEIGRAIGNLMAAMRNRVAAEGWNDKLLEEVTDILDDAAQRIERARKGKRDEED

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
183 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
184 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
185 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
186 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
187 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4
Rhizosphere 95.81
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100449937 3300032126 Bacteria 1113
2 MBSR1b_contig_2933200 2162886012 Bacteria 990
3 JGI24746J21847_1007738 3300001977 Bacteria 1635
4 JGI24739J22299_10042427 3300001989 Bacteria 1509
5 JGI24737J22298_10053878 3300001990 Bacteria 1218
6 JGI24750J21931_1032392 3300002070 Bacteria 771
7 JGI24738J21930_10016704 3300002075 Bacteria 1547
8 JGI24749J21850_1007612 3300002076 Bacteria 1509
9 JGI24744J21845_10000079 3300002077 Bacteria 12357
10 Ga0065715_10000733 3300005293 Bacteria 14824
11 Ga0065715_10122837 3300005293 Bacteria 2194
12 Ga0070658_10041142 3300005327 Bacteria 3728
13 Ga0070658_10158355 3300005327 Bacteria 1899
14 Ga0070658_10375249 3300005327 Bacteria 1219
15 Ga0070658_10520258 3300005327 Bacteria 1028
16 Ga0070676_10006117 3300005328 Bacteria 6428
17 Ga0070683_100552509 3300005329 Bacteria 1101
18 Ga0070670_100004328 3300005331 Bacteria 11886
19 Ga0070670_100043409 3300005331 Bacteria 3864
20 Ga0070670_101123137 3300005331 Bacteria 717
21 Ga0070677_10003092 3300005333 Bacteria 5347
22 Ga0070677_10170815 3300005333 Bacteria 1027
23 Ga0068869_100125270 3300005334 Bacteria 1969
24 Ga0070666_10068191 3300005335 Bacteria 2417
25 Ga0070666_10803536 3300005335 Bacteria 693
26 Ga0070680_100001313 3300005336 Bacteria 18015
27 Ga0070680_100071053 3300005336 Bacteria 2859
28 Ga0070680_100180123 3300005336 Bacteria 1780
29 Ga0070680_100208760 3300005336 Bacteria 1647
30 Ga0068868_100142705 3300005338 Bacteria 1967
31 Ga0070660_100064232 3300005339 Bacteria 2855
32 Ga0070660_100076986 3300005339 Bacteria 2613
33 Ga0070660_100118743 3300005339 Bacteria 2109
34 Ga0070660_100130490 3300005339 Bacteria 2010
35 Ga0070660_100285329 3300005339 Bacteria 1351
36 Ga0070661_100032148 3300005344 Bacteria 3797
37 Ga0070661_100038351 3300005344 Bacteria 3487
38 Ga0070661_100082063 3300005344 Bacteria 2381
39 Ga0070668_100003373 3300005347 Bacteria 11777
40 Ga0070668_100057277 3300005347 Bacteria 3011
41 Ga0070668_100157807 3300005347 Bacteria 1839
42 Ga0070668_100317428 3300005347 Bacteria 1311
43 Ga0070669_100000714 3300005353 Bacteria 24315
44 Ga0070669_100242622 3300005353 Bacteria 1432
45 Ga0070669_100315551 3300005353 Bacteria 1261
46 Ga0070669_100354331 3300005353 Bacteria 1192
47 Ga0070675_100000410 3300005354 Bacteria 29182
48 Ga0070675_100547970 3300005354 Bacteria 1046
49 Ga0070671_100002716 3300005355 Bacteria 13731
50 Ga0070671_100003073 3300005355 Bacteria 12979
51 Ga0070671_100073336 3300005355 Bacteria 2859
52 Ga0070671_100123093 3300005355 Bacteria 2183
53 Ga0070671_100271604 3300005355 Bacteria 1441
54 Ga0070674_100000855 3300005356 Bacteria 15805
55 Ga0070674_100024054 3300005356 Bacteria 3951
56 Ga0070673_100109852 3300005364 Bacteria 2285
57 Ga0070673_100131244 3300005364 Bacteria 2102
58 Ga0070673_100132789 3300005364 Bacteria 2091
59 Ga0070673_100288535 3300005364 Bacteria 1441
60 Ga0070673_100707949 3300005364 Bacteria 925
61 Ga0070659_100031589 3300005366 Bacteria 4102
62 Ga0070659_100047299 3300005366 Bacteria 3374
63 Ga0070659_100078966 3300005366 Bacteria 2626
64 Ga0070659_100086591 3300005366 Bacteria 2507
65 Ga0070659_100089122 3300005366 Bacteria 2471
66 Ga0070659_100384134 3300005366 Bacteria 1183
67 Ga0070659_100669248 3300005366 Bacteria 896
68 Ga0070667_100039219 3300005367 Bacteria 3970
69 Ga0070667_100195072 3300005367 Bacteria 1795
70 Ga0070714_100106078 3300005435 Bacteria 2482
71 Ga0070714_100553058 3300005435 Bacteria 1102
72 Ga0070713_100056673 3300005436 Bacteria 3259
73 Ga0070701_10108632 3300005438 Bacteria 1547
74 Ga0070700_100985282 3300005441 Bacteria 692
75 Ga0070663_100040535 3300005455 Bacteria 3261
76 Ga0070663_100054421 3300005455 Bacteria 2860
77 Ga0070663_100197635 3300005455 Bacteria 1568
78 Ga0070663_100374382 3300005455 Bacteria 1158
79 Ga0070678_100008631 3300005456 Bacteria 6110
80 Ga0070678_100505515 3300005456 Bacteria 1067
81 Ga0070662_100000230 3300005457 Bacteria 32939
82 Ga0070662_100007321 3300005457 Bacteria 7149
83 Ga0070662_100033130 3300005457 Bacteria 3636
84 Ga0070662_100033215 3300005457 Bacteria 3631
85 Ga0070662_100064386 3300005457 Bacteria 2684
86 Ga0070662_100072267 3300005457 Bacteria 2546
87 Ga0070681_10010885 3300005458 Bacteria 8992
88 Ga0070681_10038415 3300005458 Bacteria 4800
89 Ga0070681_10102974 3300005458 Bacteria 2799
90 Ga0070681_10219383 3300005458 Bacteria 1817
91 Ga0070681_10567366 3300005458 Bacteria 1049
92 Ga0068867_100010095 3300005459 Bacteria 6654
93 Ga0068867_100050293 3300005459 Bacteria 3071
94 Ga0068867_100301117 3300005459 Bacteria 1322
95 Ga0070679_100032785 3300005530 Bacteria 5141
96 Ga0070679_100059664 3300005530 Bacteria 3802
97 Ga0070679_100074065 3300005530 Bacteria 3396
98 Ga0070679_100213668 3300005530 Bacteria 1892
99 Ga0068853_100103225 3300005539 Bacteria 2523
100 Ga0068853_100231927 3300005539 Bacteria 1689
101 Ga0068853_100566497 3300005539 Bacteria 1077
102 Ga0070672_100002028 3300005543 Bacteria 12733
103 Ga0070672_100020660 3300005543 Bacteria 4806
104 Ga0070672_100054735 3300005543 Bacteria 3124
105 Ga0070672_100416203 3300005543 Bacteria 1154
106 Ga0070704_100097113 3300005549 Bacteria 2210
107 Ga0068855_100225536 3300005563 Bacteria 2100
108 Ga0070664_100019027 3300005564 Bacteria 5647
109 Ga0070664_100021419 3300005564 Bacteria 5328
110 Ga0070664_100031253 3300005564 Bacteria 4447
111 Ga0070664_100068993 3300005564 Bacteria 3024
112 Ga0070664_100273653 3300005564 Bacteria 1521
113 Ga0068857_100226359 3300005577 Bacteria 1709
114 Ga0068857_100931333 3300005577 Bacteria 834
115 Ga0068854_100032155 3300005578 Bacteria 3649
116 Ga0068854_100038416 3300005578 Bacteria 3367
117 Ga0068854_100058992 3300005578 Bacteria 2772
118 Ga0068854_100986280 3300005578 Bacteria 745
119 Ga0068856_100045520 3300005614 Bacteria 4321
120 Ga0068852_100072470 3300005616 Bacteria 3027
121 Ga0068852_100482772 3300005616 Bacteria 1232
122 Ga0068852_101037627 3300005616 Bacteria 839
123 Ga0068859_100016407 3300005617 Bacteria 7440
124 Ga0068859_100908229 3300005617 Bacteria 965
125 Ga0068864_100024183 3300005618 Bacteria 5107
126 Ga0068864_100051540 3300005618 Bacteria 3546
127 Ga0068864_100965957 3300005618 Bacteria 844
128 Ga0068866_10023584 3300005718 Bacteria 2865
129 Ga0068866_10242788 3300005718 Bacteria 1098
130 Ga0068861_101136565 3300005719 Bacteria 752
131 Ga0068851_10109534 3300005834 Bacteria 1473
132 Ga0068870_10067179 3300005840 Bacteria 1944
133 Ga0068863_100106630 3300005841 Bacteria 2666
134 Ga0068858_100249944 3300005842 Bacteria 1684
135 Ga0068858_100799760 3300005842 Bacteria 920
136 Ga0068860_100071380 3300005843 Bacteria 3300
137 Ga0068862_100020853 3300005844 Bacteria 5474
138 Ga0068862_100116174 3300005844 Bacteria 2354
139 Ga0068862_101012889 3300005844 Bacteria 822
140 Ga0097621_100119720 3300006237 Bacteria 2232
141 Ga0097621_100440632 3300006237 Bacteria 1172
142 Ga0075431_100073975 3300006847 Bacteria 3516
143 Ga0068865_100035287 3300006881 Bacteria 3361
144 Ga0068865_100175050 3300006881 Bacteria 1648
145 Ga0097620_100016407 3300006931 Bacteria 7440
146 Ga0097620_100908212 3300006931 Bacteria 965
147 Ga0111539_10028693 3300009094 Bacteria 6787
148 Ga0111539_10594412 3300009094 Bacteria 1289
149 Ga0105248_10002873 3300009177 Bacteria 19111
150 Ga0105248_10015455 3300009177 Bacteria 8413
151 Ga0105248_10041406 3300009177 Bacteria 5164
152 Ga0105248_10168485 3300009177 Bacteria 2469
153 Ga0105248_10230880 3300009177 Bacteria 2083
154 Ga0105249_10010976 3300009553 Bacteria 7959
155 Ga0157373_10057023 3300013100 Bacteria 2771
156 Ga0157373_10057275 3300013100 Bacteria 2765
157 Ga0157373_10136847 3300013100 Bacteria 1722
158 Ga0157373_10187908 3300013100 Bacteria 1455
159 Ga0157373_10244735 3300013100 Bacteria 1268
160 Ga0157369_10356362 3300013105 Bacteria 1519
161 Ga0157369_10505986 3300013105 Bacteria 1250
162 Ga0157369_10521906 3300013105 Bacteria 1229
163 Ga0157378_10036975 3300013297 Bacteria 4322
164 Ga0163162_10025551 3300013306 Bacteria 5836
165 Ga0157375_10002721 3300013308 Bacteria 15280
166 Ga0157375_10844328 3300013308 Bacteria 1063
167 Ga0157380_10000743 3300014326 Bacteria 20330
168 Ga0157380_10002497 3300014326 Bacteria 12394
169 Ga0157380_10693907 3300014326 Bacteria 1022
170 Ga0157380_10912323 3300014326 Bacteria 905
171 Ga0163161_10005605 3300017792 Bacteria 8705
172 Ga0163161_10005788 3300017792 Bacteria 8570
173 Ga0163161_10010334 3300017792 Bacteria 6463
174 Ga0207697_10001412 3300025315 Bacteria 13151
175 Ga0207697_10084843 3300025315 Bacteria 1337
176 Ga0207697_10168778 3300025315 Bacteria 957
177 Ga0207656_10154208 3300025321 Bacteria 1089
178 Ga0207682_10000869 3300025893 Bacteria 14040
179 Ga0207682_10013481 3300025893 Bacteria 3184
180 Ga0207682_10106153 3300025893 Bacteria 1232
181 Ga0207642_10007534 3300025899 Bacteria 3683
182 Ga0207688_10007823 3300025901 Bacteria 5816
183 Ga0207688_10043506 3300025901 Bacteria 2501
184 Ga0207688_10059031 3300025901 Bacteria 2160
185 Ga0207680_10521686 3300025903 Bacteria 847
186 Ga0207647_10044274 3300025904 Bacteria 2782
187 Ga0207645_10062732 3300025907 Bacteria 2374
188 Ga0207645_10064192 3300025907 Bacteria 2346
189 Ga0207645_10066220 3300025907 Bacteria 2309
190 Ga0207643_10058843 3300025908 Bacteria 2191
191 Ga0207705_10104914 3300025909 Bacteria 2083
192 Ga0207705_10205406 3300025909 Bacteria 1493
193 Ga0207705_10437192 3300025909 Bacteria 1014
194 Ga0207707_10009893 3300025912 Bacteria 8269
195 Ga0207707_10199167 3300025912 Bacteria 1746
196 Ga0207707_10217198 3300025912 Bacteria 1665
197 Ga0207660_10261431 3300025917 Bacteria 1369
198 Ga0207662_10204551 3300025918 Bacteria 1279
199 Ga0207657_10002445 3300025919 Bacteria 20068
200 Ga0207657_10059384 3300025919 Bacteria 3286
201 Ga0207657_10078612 3300025919 Bacteria 2777
202 Ga0207657_10121060 3300025919 Bacteria 2153
203 Ga0207649_10020613 3300025920 Bacteria 3782
204 Ga0207649_10036061 3300025920 Bacteria 2975
205 Ga0207652_10018851 3300025921 Bacteria 5663
206 Ga0207652_10180092 3300025921 Bacteria 1899
207 Ga0207652_10663514 3300025921 Bacteria 932
208 Ga0207652_10849844 3300025921 Bacteria 808
209 Ga0207681_10000376 3300025923 Bacteria 31532
210 Ga0207681_10074964 3300025923 Bacteria 2372
211 Ga0207681_10170124 3300025923 Bacteria 1651
212 Ga0207681_10220365 3300025923 Bacteria 1467
213 Ga0207650_10003665 3300025925 Bacteria 10507
214 Ga0207650_10055903 3300025925 Bacteria 2931
215 Ga0207650_10754342 3300025925 Bacteria 824
216 Ga0207659_10000215 3300025926 Bacteria 34824
217 Ga0207659_10283294 3300025926 Bacteria 1356
218 Ga0207664_10216916 3300025929 Bacteria 1657
219 Ga0207644_10001983 3300025931 Bacteria 13239
220 Ga0207644_10002558 3300025931 Bacteria 11707
221 Ga0207644_10015737 3300025931 Bacteria 5082
222 Ga0207644_10054326 3300025931 Bacteria 2884
223 Ga0207644_10057571 3300025931 Bacteria 2807
224 Ga0207644_10142042 3300025931 Bacteria 1849
225 Ga0207644_10295201 3300025931 Bacteria 1304
226 Ga0207644_11034895 3300025931 Bacteria 689
227 Ga0207690_10033129 3300025932 Bacteria 3320
228 Ga0207690_10137727 3300025932 Bacteria 1794
229 Ga0207690_10149230 3300025932 Bacteria 1732
230 Ga0207690_10332530 3300025932 Bacteria 1197
231 Ga0207690_10724160 3300025932 Bacteria 819
232 Ga0207706_10000378 3300025933 Bacteria 48430
233 Ga0207706_10000557 3300025933 Bacteria 39725
234 Ga0207706_10011585 3300025933 Bacteria 8031
235 Ga0207706_10116711 3300025933 Bacteria 2348
236 Ga0207706_10124000 3300025933 Bacteria 2273
237 Ga0207706_10178493 3300025933 Bacteria 1865
238 Ga0207706_10211192 3300025933 Bacteria 1701
239 Ga0207706_10368332 3300025933 Bacteria 1248
240 Ga0207706_10677029 3300025933 Bacteria 882
241 Ga0207669_10003525 3300025937 Bacteria 6777
242 Ga0207669_10311252 3300025937 Bacteria 1201
243 Ga0207704_10014668 3300025938 Bacteria 3965
244 Ga0207691_10001956 3300025940 Bacteria 20121
245 Ga0207691_10085412 3300025940 Bacteria 2832
246 Ga0207691_10123293 3300025940 Bacteria 2294
247 Ga0207691_10318130 3300025940 Bacteria 1335
248 Ga0207711_10000055 3300025941 Bacteria 136126
249 Ga0207711_10026817 3300025941 Bacteria 4836
250 Ga0207711_10031426 3300025941 Bacteria 4482
251 Ga0207711_10089903 3300025941 Bacteria 2699
252 Ga0207689_10011938 3300025942 Bacteria 7445
253 Ga0207689_10109530 3300025942 Bacteria 2269
254 Ga0207661_10441819 3300025944 Bacteria 1184
255 Ga0207679_10007501 3300025945 Bacteria 6923
256 Ga0207679_10054548 3300025945 Bacteria 2943
257 Ga0207679_10059284 3300025945 Bacteria 2839
258 Ga0207679_10117907 3300025945 Bacteria 2107
259 Ga0207679_10367097 3300025945 Bacteria 1259
260 Ga0207667_10309098 3300025949 Bacteria 1615
261 Ga0207651_10016944 3300025960 Bacteria 4288
262 Ga0207651_10029479 3300025960 Bacteria 3478
263 Ga0207651_10120528 3300025960 Bacteria 1988
264 Ga0207712_10017790 3300025961 Bacteria 4621
265 Ga0207668_10000233 3300025972 Bacteria 37280
266 Ga0207668_10141127 3300025972 Bacteria 1853
267 Ga0207668_10144269 3300025972 Bacteria 1835
268 Ga0207640_10008846 3300025981 Bacteria 5606
269 Ga0207640_10032594 3300025981 Bacteria 3232
270 Ga0207640_10112017 3300025981 Bacteria 1936
271 Ga0207658_10165145 3300025986 Bacteria 1818
272 Ga0207677_10061429 3300026023 Bacteria 2602
273 Ga0207677_10189787 3300026023 Bacteria 1624
274 Ga0207703_10296770 3300026035 Bacteria 1473
275 Ga0207639_10087102 3300026041 Bacteria 2489
276 Ga0207639_10315813 3300026041 Bacteria 1386
277 Ga0207678_10018879 3300026067 Bacteria 6057
278 Ga0207678_10039635 3300026067 Bacteria 4088
279 Ga0207678_10053088 3300026067 Bacteria 3494
280 Ga0207678_10109077 3300026067 Bacteria 2361
281 Ga0207678_10271437 3300026067 Bacteria 1454
282 Ga0207678_10325698 3300026067 Bacteria 1322
283 Ga0207708_10244654 3300026075 Bacteria 1444
284 Ga0207702_10052958 3300026078 Bacteria 3435
285 Ga0207641_10099229 3300026088 Bacteria 2562
286 Ga0207641_10666141 3300026088 Bacteria 1023
287 Ga0207648_10002819 3300026089 Bacteria 18431
288 Ga0207648_10005688 3300026089 Bacteria 12503
289 Ga0207648_10193143 3300026089 Bacteria 1805
290 Ga0207648_10221516 3300026089 Bacteria 1682
291 Ga0207676_10021148 3300026095 Bacteria 4771
292 Ga0207676_10045195 3300026095 Bacteria 3402
293 Ga0207676_10117544 3300026095 Bacteria 2236
294 Ga0207674_10011365 3300026116 Bacteria 10005
295 Ga0207674_10222297 3300026116 Bacteria 1836
296 Ga0207674_10248078 3300026116 Bacteria 1727
297 Ga0207675_100337126 3300026118 Bacteria 1475
298 Ga0207683_10063894 3300026121 Bacteria 3243
299 Ga0207683_10125289 3300026121 Bacteria 2308
300 Ga0207683_10157029 3300026121 Bacteria 2055
301 Ga0207683_10297113 3300026121 Bacteria 1477
302 Ga0207683_10694825 3300026121 Bacteria 943
303 Ga0207698_10384933 3300026142 Bacteria 1336
304 Ga0207698_10405690 3300026142 Bacteria 1304
305 Ga0207698_10856131 3300026142 Bacteria 914
306 Ga0209971_1025046 3300027682 Bacteria 1425
307 Ga0209974_10000170 3300027876 Bacteria 20007
308 Ga0207428_10123455 3300027907 Bacteria 1984
309 Ga0268266_10365191 3300028379 Bacteria 1359
310 Ga0268265_10195492 3300028380 Bacteria 1750
311 Ga0268265_10231729 3300028380 Bacteria 1623
312 Ga0316181_1064600 3300030744 Bacteria 1055
313 Ga0316182_1074158 3300030745 Bacteria 4099
314 Ga0307408_100095562 3300031548 Bacteria 2253
315 Ga0307408_100156468 3300031548 Bacteria 1805
316 Ga0307408_100167680 3300031548 Bacteria 1751
317 Ga0307408_100231015 3300031548 Bacteria 1515
318 Ga0307408_100558087 3300031548 Bacteria 1011
319 Ga0307405_10002439 3300031731 Bacteria 8198
320 Ga0307405_10004000 3300031731 Bacteria 6909
321 Ga0307405_10008327 3300031731 Bacteria 5246
322 Ga0307405_10052449 3300031731 Bacteria 2536
323 Ga0307405_10130708 3300031731 Bacteria 1734
324 Ga0307405_10219263 3300031731 Bacteria 1394
325 Ga0307405_10522836 3300031731 Bacteria 955
326 Ga0307413_10004882 3300031824 Bacteria 5898
327 Ga0307413_10008551 3300031824 Bacteria 4842
328 Ga0307413_10012194 3300031824 Bacteria 4269
329 Ga0307413_10027348 3300031824 Bacteria 3159
330 Ga0307413_10027756 3300031824 Bacteria 3142
331 Ga0307413_10035286 3300031824 Bacteria 2867
332 Ga0307413_10109112 3300031824 Bacteria 1848
333 Ga0307413_10152183 3300031824 Bacteria 1614
334 Ga0307413_10154148 3300031824 Bacteria 1605
335 Ga0307413_10277311 3300031824 Bacteria 1259
336 Ga0307413_10517655 3300031824 Bacteria 961
337 Ga0307413_10761154 3300031824 Bacteria 810
338 Ga0307413_11007247 3300031824 Bacteria 714
339 Ga0307410_10016156 3300031852 Bacteria 4444
340 Ga0307410_10016521 3300031852 Bacteria 4404
341 Ga0307410_10024012 3300031852 Bacteria 3802
342 Ga0307410_10024277 3300031852 Bacteria 3785
343 Ga0307410_10060091 3300031852 Bacteria 2597
344 Ga0307410_10065493 3300031852 Bacteria 2499
345 Ga0307410_10094638 3300031852 Bacteria 2128
346 Ga0307410_10139382 3300031852 Bacteria 1792
347 Ga0307410_10318413 3300031852 Bacteria 1233
348 Ga0307410_10368924 3300031852 Bacteria 1152
349 Ga0307410_10484048 3300031852 Bacteria 1015
350 Ga0307406_10011631 3300031901 Bacteria 4998
351 Ga0307406_10013782 3300031901 Bacteria 4638
352 Ga0307406_10023951 3300031901 Bacteria 3640
353 Ga0307406_10025347 3300031901 Bacteria 3550
354 Ga0307406_10081414 3300031901 Bacteria 2153
355 Ga0307406_10090707 3300031901 Bacteria 2057
356 Ga0307406_10163711 3300031901 Bacteria 1602
357 Ga0307406_10283793 3300031901 Bacteria 1264
358 Ga0307406_10377061 3300031901 Bacteria 1117
359 Ga0307407_10008654 3300031903 Bacteria 4687
360 Ga0307407_10026018 3300031903 Bacteria 3093
361 Ga0307407_10053800 3300031903 Bacteria 2318
362 Ga0307407_10062993 3300031903 Bacteria 2174
363 Ga0307407_10064437 3300031903 Bacteria 2154
364 Ga0307407_10102819 3300031903 Bacteria 1777
365 Ga0307407_10225696 3300031903 Bacteria 1269
366 Ga0307407_10292533 3300031903 Bacteria 1132
367 Ga0307412_10013021 3300031911 Bacteria 4862
368 Ga0307412_10013987 3300031911 Bacteria 4723
369 Ga0307412_10052406 3300031911 Bacteria 2702
370 Ga0307412_10122572 3300031911 Bacteria 1874
371 Ga0307412_10201069 3300031911 Bacteria 1513
372 Ga0307412_10211736 3300031911 Bacteria 1479
373 Ga0307412_10537320 3300031911 Bacteria 979
374 Ga0307412_10731322 3300031911 Bacteria 852
375 Ga0307412_10751149 3300031911 Bacteria 842
376 Ga0307409_100001426 3300031995 Bacteria 11737
377 Ga0307409_100037278 3300031995 Bacteria 3583
378 Ga0307409_100089144 3300031995 Bacteria 2520
379 Ga0307409_100118067 3300031995 Bacteria 2239
380 Ga0307409_100257620 3300031995 Bacteria 1599
381 Ga0307409_100327553 3300031995 Bacteria 1436
382 Ga0307409_100393647 3300031995 Bacteria 1321
383 Ga0307409_100762631 3300031995 Bacteria 972
384 Ga0307409_101335757 3300031995 Bacteria 742
385 Ga0307416_100007235 3300032002 Bacteria 7033
386 Ga0307416_100009009 3300032002 Bacteria 6493
387 Ga0307416_100041851 3300032002 Bacteria 3571
388 Ga0307416_100205742 3300032002 Bacteria 1872
389 Ga0307416_100315935 3300032002 Bacteria 1561
390 Ga0307416_100327123 3300032002 Bacteria 1538
391 Ga0307416_100340730 3300032002 Bacteria 1512
392 Ga0307416_100498477 3300032002 Bacteria 1281
393 Ga0307416_100574686 3300032002 Bacteria 1203
394 Ga0307416_100900926 3300032002 Bacteria 984
395 Ga0307414_10014541 3300032004 Bacteria 4724
396 Ga0307414_10016360 3300032004 Bacteria 4507
397 Ga0307414_10061711 3300032004 Bacteria 2656
398 Ga0307414_10074658 3300032004 Bacteria 2457
399 Ga0307414_10087210 3300032004 Bacteria 2305
400 Ga0307414_10092131 3300032004 Bacteria 2255
401 Ga0307414_10112254 3300032004 Bacteria 2077
402 Ga0307414_10114544 3300032004 Bacteria 2060
403 Ga0307414_10193376 3300032004 Bacteria 1648
404 Ga0307414_10211781 3300032004 Bacteria 1584
405 Ga0307414_10213135 3300032004 Bacteria 1580
406 Ga0307414_10233205 3300032004 Bacteria 1519
407 Ga0307414_10325717 3300032004 Bacteria 1309
408 Ga0307414_10407679 3300032004 Bacteria 1182
409 Ga0307414_10491216 3300032004 Bacteria 1084
410 Ga0307411_10001278 3300032005 Bacteria 10092
411 Ga0307411_10004534 3300032005 Bacteria 6668
412 Ga0307411_10021320 3300032005 Bacteria 3788
413 Ga0307411_10024976 3300032005 Bacteria 3571
414 Ga0307411_10059379 3300032005 Bacteria 2535
415 Ga0307411_10061224 3300032005 Bacteria 2504
416 Ga0307411_10062328 3300032005 Bacteria 2487
417 Ga0307411_10068245 3300032005 Bacteria 2396
418 Ga0307411_10068649 3300032005 Bacteria 2390
419 Ga0307411_10091724 3300032005 Bacteria 2123
420 Ga0307411_10235652 3300032005 Bacteria 1429
421 Ga0307411_10297703 3300032005 Bacteria 1292
422 Ga0307411_10472198 3300032005 Bacteria 1054
423 Ga0307415_100003694 3300032126 Bacteria 7833
424 Ga0307415_100014963 3300032126 Bacteria 4579
425 Ga0307415_100015686 3300032126 Bacteria 4495
426 Ga0307415_100019323 3300032126 Bacteria 4135
427 Ga0307415_100058293 3300032126 Bacteria 2658
428 Ga0307415_100116758 3300032126 Bacteria 1991
429 Ga0307415_100355261 3300032126 Bacteria 1235
430 Ga0307415_100778041 3300032126 Bacteria 871
431 Ga0395899_0067467 3300037312 Bacteria 2624
432 Ga0395899_0070990 3300037312 Bacteria 2548
433 Ga0395900_0001005 3300037418 Bacteria 36540
434 Ga0395900_0015800 3300037418 Bacteria 7696
435 Ga0395900_0026202 3300037418 Bacteria 5970
436 Ga0395900_0033072 3300037418 Bacteria 5322
437 Ga0395900_0200948 3300037418 Bacteria 2016
438 Ga0395900_0229637 3300037418 Bacteria 1867
439 Ga0395900_0389216 3300037418 Bacteria 1360
440 Ga0395898_0014896 3300037466 Bacteria 7982
441 Ga0395898_0240600 3300037466 Bacteria 1726
442 Ga0395905_0000128 3300037471 Bacteria 124305
443 Ga0395905_0030134 3300037471 Bacteria 5114
444 Ga0395905_0059243 3300037471 Bacteria 3579
445 Ga0395905_0075778 3300037471 Bacteria 3153
446 Ga0395905_0118888 3300037471 Bacteria 2484
447 Ga0395905_0128299 3300037471 Bacteria 2385
448 Ga0395905_0313866 3300037471 Bacteria 1456
449 Ga0395905_0457254 3300037471 Bacteria 1175
450 Ga0395901_0003812 3300038443 Bacteria 15192
451 Ga0395901_0084384 3300038443 Bacteria 3320
452 Ga0395901_0120545 3300038443 Bacteria 2756
453 Ga0466966_0043165 3300044684 Bacteria 2891
454 Ga0466966_0088625 3300044684 Bacteria 1922
455 Ga0466966_0307482 3300044684 Bacteria 953
456 Ga0466961_0036424 3300044693 Bacteria 3158
457 Ga0466961_0071958 3300044693 Bacteria 2193
458 Ga0466963_0028781 3300044694 Bacteria 3571
459 Ga0466971_0013690 3300044719 Bacteria 3567
460 Ga0466971_0047890 3300044719 Bacteria 1922
461 Ga0466970_0139931 3300044765 Bacteria 1333
462 Ga0466970_0382095 3300044765 Bacteria 802
463 Ga0466957_0155147 3300044842 Bacteria 1483
464 Ga0466957_0197055 3300044842 Bacteria 1321
465 Ga0466959_0606074 3300045049 Bacteria 736
466 Ga0466958_0039140 3300045836 Bacteria 2847
467 Ga0466958_0160675 3300045836 Bacteria 1419
468 Ga0466967_0082319 3300045976 Bacteria 2908
469 Ga0466967_0188712 3300045976 Bacteria 1947
470 Ga0466967_0251154 3300045976 Bacteria 1689
471 Ga0495663_0003858 3300046525 Bacteria 4274
472 Ga0495663_0008266 3300046525 Bacteria 2881
473 Ga0495663_0063743 3300046525 Bacteria 1162
474 Ga0495642_0032759 3300046528 Bacteria 2086
475 Ga0495642_0063890 3300046528 Bacteria 1531
476 Ga0495621_0000466 3300046539 Bacteria 9922
477 Ga0495621_0003239 3300046539 Bacteria 4472
478 Ga0495668_0072563 3300046616 Bacteria 1891
479 Ga0495659_0120730 3300046664 Bacteria 1031
480 Ga0495669_0038784 3300046684 Bacteria 2109
481 Ga0495670_0024838 3300046691 Bacteria 2962
482 Ga0495670_0025124 3300046691 Bacteria 2946
483 Ga0495670_0048319 3300046691 Bacteria 2129
484 Ga0495677_0183638 3300047445 Bacteria 811
485 Ga0496101_0008073 3300048904 Bacteria 6864
486 Ga0496102_0155023 3300048905 Bacteria 2153
487 Ga0496102_0765692 3300048905 Bacteria 888
488 Ga0496103_0038726 3300048906 Bacteria 2927
489 Ga0496104_0195662 3300048907 Bacteria 1934
490 Ga0496106_0008395 3300048909 Bacteria 7643
491 Ga0496107_0001705 3300048910 Bacteria 13777
492 Ga0496107_0015909 3300048910 Bacteria 5277
493 Ga0496108_0048801 3300048911 Bacteria 3540
494 Ga0496108_0168275 3300048911 Bacteria 1895
495 Ga0496109_0046592 3300048912 Bacteria 3938
496 Ga0496109_0221268 3300048912 Bacteria 1780
497 Ga0496110_0009252 3300048913 Bacteria 7962
498 Ga0496110_0011708 3300048913 Bacteria 7196
499 Ga0496110_0022628 3300048913 Bacteria 5339
500 Ga0496111_0001851 3300048914 Bacteria 12479
501 Ga0496111_0049002 3300048914 Bacteria 3046
502 Ga0496112_0009799 3300048915 Bacteria 8653
503 Ga0496112_0011344 3300048915 Bacteria 8134
504 Ga0496112_0412007 3300048915 Bacteria 1290
505 Ga0496114_0005601 3300048917 Bacteria 9846
506 Ga0501209_021571 3300049656 Bacteria 1533
507 Ga0501216_012338 3300049660 Bacteria 1402
508 Ga0501217_009851 3300049661 Bacteria 2085
509 Ga0501223_026426 3300049663 Bacteria 1129
510 Ga0501230_028954 3300049667 Bacteria 1021
511 Ga0501235_020823 3300049669 Bacteria 1456
512 Ga0501249_001127 3300049679 Bacteria 5635
513 Ga0501257_057914 3300049686 Bacteria 975
514 Ga0501258_007531 3300049687 Bacteria 1103
515 Ga0501221_001664 3300049704 Bacteria 3691
516 Ga0501270_033514 3300049767 Bacteria 860
517 Ga0501272_011791 3300049769 Bacteria 987
518 Ga0501283_023880 3300049779 Bacteria 994
519 Ga0501204_014674 3300049850 Bacteria 964
520 nmdc:mga06r32_2711_c1 3300050510 Bacteria 15846
521 nmdc:mga08y16_1163425_c1 3300050511 Bacteria 744
522 nmdc:mga08y16_232229_c1 3300050511 Bacteria 1908
523 Ga0466962_0046673 3300061719 Bacteria 2070
524 Ga0466962_0085196 3300061719 Bacteria 1513
525 2885428847 2885427238 Bacteria 2291351
526 Ga0307415_100449937
527 MBSR1b_contig_2933200
528 JGI24746J21847_1007738
529 JGI24739J22299_10042427
530 JGI24737J22298_10053878
531 JGI24750J21931_1032392
532 JGI24738J21930_10016704
533 JGI24749J21850_1007612
534 JGI24744J21845_10000079
535 Ga0065715_10000733
536 Ga0065715_10122837
537 Ga0070658_10041142
538 Ga0070658_10158355
539 Ga0070658_10375249
540 Ga0070658_10520258
541 Ga0070676_10006117
542 Ga0070683_100552509
543 Ga0070670_100004328
544 Ga0070670_100043409
545 Ga0070670_101123137
546 Ga0070677_10003092
547 Ga0070677_10170815
548 Ga0068869_100125270
549 Ga0070666_10068191
550 Ga0070666_10803536
551 Ga0070680_100001313
552 Ga0070680_100071053
553 Ga0070680_100180123
554 Ga0070680_100208760
555 Ga0068868_100142705
556 Ga0070660_100064232
557 Ga0070660_100076986
558 Ga0070660_100118743
559 Ga0070660_100130490
560 Ga0070660_100285329
561 Ga0070661_100032148
562 Ga0070661_100038351
563 Ga0070661_100082063
564 Ga0070668_100003373
565 Ga0070668_100057277
566 Ga0070668_100157807
567 Ga0070668_100317428
568 Ga0070669_100000714
569 Ga0070669_100242622
570 Ga0070669_100315551
571 Ga0070669_100354331
572 Ga0070675_100000410
573 Ga0070675_100547970
574 Ga0070671_100002716
575 Ga0070671_100003073
576 Ga0070671_100073336
577 Ga0070671_100123093
578 Ga0070671_100271604
579 Ga0070674_100000855
580 Ga0070674_100024054
581 Ga0070673_100109852
582 Ga0070673_100131244
583 Ga0070673_100132789
584 Ga0070673_100288535
585 Ga0070673_100707949
586 Ga0070659_100031589
587 Ga0070659_100047299
588 Ga0070659_100078966
589 Ga0070659_100086591
590 Ga0070659_100089122
591 Ga0070659_100384134
592 Ga0070659_100669248
593 Ga0070667_100039219
594 Ga0070667_100195072
595 Ga0070714_100106078
596 Ga0070714_100553058
597 Ga0070713_100056673
598 Ga0070701_10108632
599 Ga0070700_100985282
600 Ga0070663_100040535
601 Ga0070663_100054421
602 Ga0070663_100197635
603 Ga0070663_100374382
604 Ga0070678_100008631
605 Ga0070678_100505515
606 Ga0070662_100000230
607 Ga0070662_100007321
608 Ga0070662_100033130
609 Ga0070662_100033215
610 Ga0070662_100064386
611 Ga0070662_100072267
612 Ga0070681_10010885
613 Ga0070681_10038415
614 Ga0070681_10102974
615 Ga0070681_10219383
616 Ga0070681_10567366
617 Ga0068867_100010095
618 Ga0068867_100050293
619 Ga0068867_100301117
620 Ga0070679_100032785
621 Ga0070679_100059664
622 Ga0070679_100074065
623 Ga0070679_100213668
624 Ga0068853_100103225
625 Ga0068853_100231927
626 Ga0068853_100566497
627 Ga0070672_100002028
628 Ga0070672_100020660
629 Ga0070672_100054735
630 Ga0070672_100416203
631 Ga0070704_100097113
632 Ga0068855_100225536
633 Ga0070664_100019027
634 Ga0070664_100021419
635 Ga0070664_100031253
636 Ga0070664_100068993
637 Ga0070664_100273653
638 Ga0068857_100226359
639 Ga0068857_100931333
640 Ga0068854_100032155
641 Ga0068854_100038416
642 Ga0068854_100058992
643 Ga0068854_100986280
644 Ga0068856_100045520
645 Ga0068852_100072470
646 Ga0068852_100482772
647 Ga0068852_101037627
648 Ga0068859_100016407
649 Ga0068859_100908229
650 Ga0068864_100024183
651 Ga0068864_100051540
652 Ga0068864_100965957
653 Ga0068866_10023584
654 Ga0068866_10242788
655 Ga0068861_101136565
656 Ga0068851_10109534
657 Ga0068870_10067179
658 Ga0068863_100106630
659 Ga0068858_100249944
660 Ga0068858_100799760
661 Ga0068860_100071380
662 Ga0068862_100020853
663 Ga0068862_100116174
664 Ga0068862_101012889
665 Ga0097621_100119720
666 Ga0097621_100440632
667 Ga0075431_100073975
668 Ga0068865_100035287
669 Ga0068865_100175050
670 Ga0097620_100016407
671 Ga0097620_100908212
672 Ga0111539_10028693
673 Ga0111539_10594412
674 Ga0105248_10002873
675 Ga0105248_10015455
676 Ga0105248_10041406
677 Ga0105248_10168485
678 Ga0105248_10230880
679 Ga0105249_10010976
680 Ga0157373_10057023
681 Ga0157373_10057275
682 Ga0157373_10136847
683 Ga0157373_10187908
684 Ga0157373_10244735
685 Ga0157369_10356362
686 Ga0157369_10505986
687 Ga0157369_10521906
688 Ga0157378_10036975
689 Ga0163162_10025551
690 Ga0157375_10002721
691 Ga0157375_10844328
692 Ga0157380_10000743
693 Ga0157380_10002497
694 Ga0157380_10693907
695 Ga0157380_10912323
696 Ga0163161_10005605
697 Ga0163161_10005788
698 Ga0163161_10010334
699 Ga0207697_10001412
700 Ga0207697_10084843
701 Ga0207697_10168778
702 Ga0207656_10154208
703 Ga0207682_10000869
704 Ga0207682_10013481
705 Ga0207682_10106153
706 Ga0207642_10007534
707 Ga0207688_10007823
708 Ga0207688_10043506
709 Ga0207688_10059031
710 Ga0207680_10521686
711 Ga0207647_10044274
712 Ga0207645_10062732
713 Ga0207645_10064192
714 Ga0207645_10066220
715 Ga0207643_10058843
716 Ga0207705_10104914
717 Ga0207705_10205406
718 Ga0207705_10437192
719 Ga0207707_10009893
720 Ga0207707_10199167
721 Ga0207707_10217198
722 Ga0207660_10261431
723 Ga0207662_10204551
724 Ga0207657_10002445
725 Ga0207657_10059384
726 Ga0207657_10078612
727 Ga0207657_10121060
728 Ga0207649_10020613
729 Ga0207649_10036061
730 Ga0207652_10018851
731 Ga0207652_10180092
732 Ga0207652_10663514
733 Ga0207652_10849844
734 Ga0207681_10000376
735 Ga0207681_10074964
736 Ga0207681_10170124
737 Ga0207681_10220365
738 Ga0207650_10003665
739 Ga0207650_10055903
740 Ga0207650_10754342
741 Ga0207659_10000215
742 Ga0207659_10283294
743 Ga0207664_10216916
744 Ga0207644_10001983
745 Ga0207644_10002558
746 Ga0207644_10015737
747 Ga0207644_10054326
748 Ga0207644_10057571
749 Ga0207644_10142042
750 Ga0207644_10295201
751 Ga0207644_11034895
752 Ga0207690_10033129
753 Ga0207690_10137727
754 Ga0207690_10149230
755 Ga0207690_10332530
756 Ga0207690_10724160
757 Ga0207706_10000378
758 Ga0207706_10000557
759 Ga0207706_10011585
760 Ga0207706_10116711
761 Ga0207706_10124000
762 Ga0207706_10178493
763 Ga0207706_10211192
764 Ga0207706_10368332
765 Ga0207706_10677029
766 Ga0207669_10003525
767 Ga0207669_10311252
768 Ga0207704_10014668
769 Ga0207691_10001956
770 Ga0207691_10085412
771 Ga0207691_10123293
772 Ga0207691_10318130
773 Ga0207711_10000055
774 Ga0207711_10026817
775 Ga0207711_10031426
776 Ga0207711_10089903
777 Ga0207689_10011938
778 Ga0207689_10109530
779 Ga0207661_10441819
780 Ga0207679_10007501
781 Ga0207679_10054548
782 Ga0207679_10059284
783 Ga0207679_10117907
784 Ga0207679_10367097
785 Ga0207667_10309098
786 Ga0207651_10016944
787 Ga0207651_10029479
788 Ga0207651_10120528
789 Ga0207712_10017790
790 Ga0207668_10000233
791 Ga0207668_10141127
792 Ga0207668_10144269
793 Ga0207640_10008846
794 Ga0207640_10032594
795 Ga0207640_10112017
796 Ga0207658_10165145
797 Ga0207677_10061429
798 Ga0207677_10189787
799 Ga0207703_10296770
800 Ga0207639_10087102
801 Ga0207639_10315813
802 Ga0207678_10018879
803 Ga0207678_10039635
804 Ga0207678_10053088
805 Ga0207678_10109077
806 Ga0207678_10271437
807 Ga0207678_10325698
808 Ga0207708_10244654
809 Ga0207702_10052958
810 Ga0207641_10099229
811 Ga0207641_10666141
812 Ga0207648_10002819
813 Ga0207648_10005688
814 Ga0207648_10193143
815 Ga0207648_10221516
816 Ga0207676_10021148
817 Ga0207676_10045195
818 Ga0207676_10117544
819 Ga0207674_10011365
820 Ga0207674_10222297
821 Ga0207674_10248078
822 Ga0207675_100337126
823 Ga0207683_10063894
824 Ga0207683_10125289
825 Ga0207683_10157029
826 Ga0207683_10297113
827 Ga0207683_10694825
828 Ga0207698_10384933
829 Ga0207698_10405690
830 Ga0207698_10856131
831 Ga0209971_1025046
832 Ga0209974_10000170
833 Ga0207428_10123455
834 Ga0268266_10365191
835 Ga0268265_10195492
836 Ga0268265_10231729
837 Ga0316181_1064600
838 Ga0316182_1074158
839 Ga0307408_100095562
840 Ga0307408_100156468
841 Ga0307408_100167680
842 Ga0307408_100231015
843 Ga0307408_100558087
844 Ga0307405_10002439
845 Ga0307405_10004000
846 Ga0307405_10008327
847 Ga0307405_10052449
848 Ga0307405_10130708
849 Ga0307405_10219263
850 Ga0307405_10522836
851 Ga0307413_10004882
852 Ga0307413_10008551
853 Ga0307413_10012194
854 Ga0307413_10027348
855 Ga0307413_10027756
856 Ga0307413_10035286
857 Ga0307413_10109112
858 Ga0307413_10152183
859 Ga0307413_10154148
860 Ga0307413_10277311
861 Ga0307413_10517655
862 Ga0307413_10761154
863 Ga0307413_11007247
864 Ga0307410_10016156
865 Ga0307410_10016521
866 Ga0307410_10024012
867 Ga0307410_10024277
868 Ga0307410_10060091
869 Ga0307410_10065493
870 Ga0307410_10094638
871 Ga0307410_10139382
872 Ga0307410_10318413
873 Ga0307410_10368924
874 Ga0307410_10484048
875 Ga0307406_10011631
876 Ga0307406_10013782
877 Ga0307406_10023951
878 Ga0307406_10025347
879 Ga0307406_10081414
880 Ga0307406_10090707
881 Ga0307406_10163711
882 Ga0307406_10283793
883 Ga0307406_10377061
884 Ga0307407_10008654
885 Ga0307407_10026018
886 Ga0307407_10053800
887 Ga0307407_10062993
888 Ga0307407_10064437
889 Ga0307407_10102819
890 Ga0307407_10225696
891 Ga0307407_10292533
892 Ga0307412_10013021
893 Ga0307412_10013987
894 Ga0307412_10052406
895 Ga0307412_10122572
896 Ga0307412_10201069
897 Ga0307412_10211736
898 Ga0307412_10537320
899 Ga0307412_10731322
900 Ga0307412_10751149
901 Ga0307409_100001426
902 Ga0307409_100037278
903 Ga0307409_100089144
904 Ga0307409_100118067
905 Ga0307409_100257620
906 Ga0307409_100327553
907 Ga0307409_100393647
908 Ga0307409_100762631
909 Ga0307409_101335757
910 Ga0307416_100007235
911 Ga0307416_100009009
912 Ga0307416_100041851
913 Ga0307416_100205742
914 Ga0307416_100315935
915 Ga0307416_100327123
916 Ga0307416_100340730
917 Ga0307416_100498477
918 Ga0307416_100574686
919 Ga0307416_100900926
920 Ga0307414_10014541
921 Ga0307414_10016360
922 Ga0307414_10061711
923 Ga0307414_10074658
924 Ga0307414_10087210
925 Ga0307414_10092131
926 Ga0307414_10112254
927 Ga0307414_10114544
928 Ga0307414_10193376
929 Ga0307414_10211781
930 Ga0307414_10213135
931 Ga0307414_10233205
932 Ga0307414_10325717
933 Ga0307414_10407679
934 Ga0307414_10491216
935 Ga0307411_10001278
936 Ga0307411_10004534
937 Ga0307411_10021320
938 Ga0307411_10024976
939 Ga0307411_10059379
940 Ga0307411_10061224
941 Ga0307411_10062328
942 Ga0307411_10068245
943 Ga0307411_10068649
944 Ga0307411_10091724
945 Ga0307411_10235652
946 Ga0307411_10297703
947 Ga0307411_10472198
948 Ga0307415_100003694
949 Ga0307415_100014963
950 Ga0307415_100015686
951 Ga0307415_100019323
952 Ga0307415_100058293
953 Ga0307415_100116758
954 Ga0307415_100355261
955 Ga0307415_100778041
956 Ga0395899_0067467
957 Ga0395899_0070990
958 Ga0395900_0001005
959 Ga0395900_0015800
960 Ga0395900_0026202
961 Ga0395900_0033072
962 Ga0395900_0200948
963 Ga0395900_0229637
964 Ga0395900_0389216
965 Ga0395898_0014896
966 Ga0395898_0240600
967 Ga0395905_0000128
968 Ga0395905_0030134
969 Ga0395905_0059243
970 Ga0395905_0075778
971 Ga0395905_0118888
972 Ga0395905_0128299
973 Ga0395905_0313866
974 Ga0395905_0457254
975 Ga0395901_0003812
976 Ga0395901_0084384
977 Ga0395901_0120545
978 Ga0466966_0043165
979 Ga0466966_0088625
980 Ga0466966_0307482
981 Ga0466961_0036424
982 Ga0466961_0071958
983 Ga0466963_0028781
984 Ga0466971_0013690
985 Ga0466971_0047890
986 Ga0466970_0139931
987 Ga0466970_0382095
988 Ga0466957_0155147
989 Ga0466957_0197055
990 Ga0466959_0606074
991 Ga0466958_0039140
992 Ga0466958_0160675
993 Ga0466967_0082319
994 Ga0466967_0188712
995 Ga0466967_0251154
996 Ga0495663_0003858
997 Ga0495663_0008266
998 Ga0495663_0063743
999 Ga0495642_0032759
1000 Ga0495642_0063890
1001 Ga0495621_0000466
1002 Ga0495621_0003239
1003 Ga0495668_0072563
1004 Ga0495659_0120730
1005 Ga0495669_0038784
1006 Ga0495670_0024838
1007 Ga0495670_0025124
1008 Ga0495670_0048319
1009 Ga0495677_0183638
1010 Ga0496101_0008073
1011 Ga0496102_0155023
1012 Ga0496102_0765692
1013 Ga0496103_0038726
1014 Ga0496104_0195662
1015 Ga0496106_0008395
1016 Ga0496107_0001705
1017 Ga0496107_0015909
1018 Ga0496108_0048801
1019 Ga0496108_0168275
1020 Ga0496109_0046592
1021 Ga0496109_0221268
1022 Ga0496110_0009252
1023 Ga0496110_0011708
1024 Ga0496110_0022628
1025 Ga0496111_0001851
1026 Ga0496111_0049002
1027 Ga0496112_0009799
1028 Ga0496112_0011344
1029 Ga0496112_0412007
1030 Ga0496114_0005601
1031 Ga0501209_021571
1032 Ga0501216_012338
1033 Ga0501217_009851
1034 Ga0501223_026426
1035 Ga0501230_028954
1036 Ga0501235_020823
1037 Ga0501249_001127
1038 Ga0501257_057914
1039 Ga0501258_007531
1040 Ga0501221_001664
1041 Ga0501270_033514
1042 Ga0501272_011791
1043 Ga0501283_023880
1044 Ga0501204_014674
1045 nmdc:mga06r32_2711_c1
1046 nmdc:mga08y16_1163425_c1
1047 nmdc:mga08y16_232229_c1
1048 Ga0466962_0046673
1049 Ga0466962_0085196
1050 2885428847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

61

131

0.96

Map