F459307

General Info

Members Datasets Scaffolds Average Seq Length
525 306 1050 100

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0008454|Ga0436360_0008454_216_533
Length 105
Sequence LEAFMAKKSAIENNLRKQRLAKKFAARRQRLLDVANDDSRPMEERFEARLKLAALPRNGAVVRVRNRCQVTGRPRGFYRKMKMSRIAVRELGNKGLIPGLVKSSW

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2534681786 Brucella suis 92/29 Isolate Unclassified
296 2643221580 Devosia sp. Root635 Isolate Unclassified
297 2643221591 Devosia sp. Root685 Isolate Unclassified
298 2643221674 Devosia sp. Root436 Isolate Unclassified
299 2751185800 Brucella pituitosa AA2 Isolate Unclassified
300 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
301 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
302 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
303 2854911287 Brucella lupini LUP21 Isolate Unclassified
304 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
305 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
306 3002141150 Phyllobacterium sp. 628 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 8
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0.19
Rhizoplane 7.24
Rhizosphere 79.24
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0008454 3300039438 Bacteria 721
2 Ga0070658_10416032 3300005327 Bacteria 1156
3 Ga0070666_10124941 3300005335 Bacteria 1786
4 Ga0070660_100871421 3300005339 Bacteria 759
5 Ga0070691_10182111 3300005341 Bacteria 1094
6 Ga0070673_101936104 3300005364 Bacteria 559
7 Ga0070714_102423206 3300005435 Bacteria 510
8 Ga0070713_100363066 3300005436 Bacteria 1346
9 Ga0070713_100597760 3300005436 Bacteria 1048
10 Ga0070711_100208257 3300005439 Bacteria 1513
11 Ga0070678_100526188 3300005456 Bacteria 1047
12 Ga0070685_10004968 3300005466 Bacteria 6735
13 Ga0070679_100590914 3300005530 Bacteria 1053
14 Ga0070684_101807597 3300005535 Bacteria 577
15 Ga0068853_100002020 3300005539 Bacteria 15004
16 Ga0068855_101327278 3300005563 Bacteria 744
17 Ga0070664_101155806 3300005564 Bacteria 730
18 Ga0068854_100195338 3300005578 Bacteria 1588
19 Ga0068854_101016256 3300005578 Bacteria 735
20 Ga0068854_101783947 3300005578 Bacteria 564
21 Ga0068856_100381086 3300005614 Bacteria 1429
22 Ga0068856_101026913 3300005614 Bacteria 843
23 Ga0070702_101163176 3300005615 Bacteria 620
24 Ga0068852_100426802 3300005616 Bacteria 1308
25 Ga0068864_101865819 3300005618 Bacteria 607
26 Ga0068863_101530906 3300005841 Bacteria 676
27 Ga0068858_101749995 3300005842 Bacteria 614
28 Ga0068858_102093377 3300005842 Bacteria 560
29 Ga0075365_10805682 3300006038 Bacteria 663
30 Ga0075365_10889827 3300006038 Bacteria 628
31 Ga0075365_11109304 3300006038 Bacteria 557
32 Ga0075363_100018755 3300006048 Bacteria 3450
33 Ga0075364_10035085 3300006051 Bacteria 3240
34 Ga0070712_100120515 3300006175 Bacteria 1973
35 Ga0070712_100365951 3300006175 Bacteria 1184
36 Ga0070712_100393545 3300006175 Bacteria 1143
37 Ga0075362_10003594 3300006177 Bacteria 5449
38 Ga0075367_10073553 3300006178 Bacteria 2059
39 Ga0075369_10134076 3300006186 Bacteria 1127
40 Ga0075366_10048147 3300006195 Bacteria 2527
41 Ga0075366_10152099 3300006195 Bacteria 1401
42 Ga0075366_10596180 3300006195 Bacteria 685
43 Ga0097621_102072049 3300006237 Bacteria 544
44 Ga0075370_10008914 3300006353 Bacteria 5184
45 Ga0075370_10159439 3300006353 Bacteria 1324
46 Ga0075370_10459230 3300006353 Bacteria 767
47 Ga0068871_100835810 3300006358 Bacteria 851
48 Ga0075433_10457594 3300006852 Bacteria 1125
49 Ga0075434_100109072 3300006871 Bacteria 2778
50 Ga0075434_100230918 3300006871 Bacteria 1870
51 Ga0075436_100575069 3300006914 Bacteria 829
52 Ga0075435_100043491 3300007076 Bacteria 3595
53 Ga0105240_10000798 3300009093 Bacteria 57073
54 Ga0105240_10038434 3300009093 Bacteria 6139
55 Ga0105240_10662586 3300009093 Bacteria 1143
56 Ga0105240_11082145 3300009093 Bacteria 854
57 Ga0105241_10742694 3300009174 Bacteria 899
58 Ga0105241_10977593 3300009174 Bacteria 791
59 Ga0105242_10314107 3300009176 Bacteria 1435
60 Ga0105248_10222577 3300009177 Bacteria 2124
61 Ga0105248_10545742 3300009177 Bacteria 1308
62 Ga0105237_10698469 3300009545 Bacteria 1021
63 Ga0105238_10164963 3300009551 Bacteria 2190
64 Ga0105238_10863098 3300009551 Bacteria 922
65 Ga0105238_10928529 3300009551 Bacteria 889
66 Ga0105030_128047 3300009987 Bacteria 520
67 Ga0105239_10587410 3300010375 Bacteria 1270
68 Ga0105239_11294546 3300010375 Bacteria 841
69 Ga0157371_10133052 3300013102 Bacteria 1770
70 Ga0157370_10390973 3300013104 Bacteria 1280
71 Ga0157369_12174895 3300013105 Bacteria 562
72 Ga0157374_10141807 3300013296 Bacteria 2333
73 Ga0157378_11729040 3300013297 Bacteria 673
74 Ga0157372_12336828 3300013307 Bacteria 614
75 Ga0157375_10502592 3300013308 Bacteria 1376
76 Ga0163163_11833915 3300014325 Bacteria 667
77 Ga0157376_10513798 3300014969 Bacteria 1179
78 Ga0157376_10639963 3300014969 Bacteria 1063
79 Ga0206353_10979880 3300020082 Bacteria 547
80 Ga0213872_10059007 3300021361 Bacteria 1737
81 Ga0213872_10077193 3300021361 Bacteria 1498
82 Ga0213872_10111276 3300021361 Bacteria 1216
83 Ga0213874_10010369 3300021377 Bacteria 2332
84 Ga0213874_10089747 3300021377 Bacteria 1008
85 Ga0213874_10466661 3300021377 Bacteria 500
86 Ga0213876_10000244 3300021384 Bacteria 51875
87 Ga0213876_10582157 3300021384 Bacteria 595
88 Ga0213875_10063678 3300021388 Bacteria 1724
89 Ga0213871_10074150 3300021441 Bacteria 966
90 Ga0213871_10102972 3300021441 Bacteria 837
91 Ga0213871_10163356 3300021441 Bacteria 682
92 Ga0213871_10213084 3300021441 Bacteria 606
93 Ga0207692_10139774 3300025898 Bacteria 1377
94 Ga0207680_10398473 3300025903 Bacteria 972
95 Ga0207680_10458795 3300025903 Bacteria 905
96 Ga0207643_10322431 3300025908 Bacteria 965
97 Ga0207654_10139882 3300025911 Bacteria 1542
98 Ga0207654_10390734 3300025911 Bacteria 965
99 Ga0207695_10010884 3300025913 Bacteria 11075
100 Ga0207695_10058589 3300025913 Bacteria 3997
101 Ga0207695_10125896 3300025913 Bacteria 2524
102 Ga0207693_10127235 3300025915 Bacteria 2003
103 Ga0207693_10962781 3300025915 Bacteria 653
104 Ga0207693_10984361 3300025915 Bacteria 645
105 Ga0207663_10247337 3300025916 Bacteria 1311
106 Ga0207663_11246153 3300025916 Bacteria 599
107 Ga0207657_10877653 3300025919 Bacteria 692
108 Ga0207694_10161581 3300025924 Bacteria 1809
109 Ga0207694_10859735 3300025924 Bacteria 767
110 Ga0207694_10991489 3300025924 Bacteria 711
111 Ga0207694_11299435 3300025924 Bacteria 615
112 Ga0207659_11562147 3300025926 Bacteria 564
113 Ga0207700_10431656 3300025928 Bacteria 1159
114 Ga0207700_10432293 3300025928 Bacteria 1158
115 Ga0207700_11805624 3300025928 Bacteria 537
116 Ga0207664_10924090 3300025929 Bacteria 783
117 Ga0207711_10488319 3300025941 Bacteria 1147
118 Ga0207711_10826081 3300025941 Bacteria 863
119 Ga0207689_10006518 3300025942 Bacteria 10303
120 Ga0207679_10845814 3300025945 Bacteria 835
121 Ga0207667_11010122 3300025949 Bacteria 819
122 Ga0207667_11160474 3300025949 Bacteria 753
123 Ga0207668_10094737 3300025972 Bacteria 2202
124 Ga0207640_10188781 3300025981 Bacteria 1552
125 Ga0207658_10055258 3300025986 Bacteria 2942
126 Ga0207703_10345430 3300026035 Bacteria 1369
127 Ga0207639_10000867 3300026041 Bacteria 20545
128 Ga0207702_10560913 3300026078 Bacteria 1118
129 Ga0207702_10959003 3300026078 Bacteria 848
130 Ga0207702_12049184 3300026078 Bacteria 562
131 Ga0207641_11399601 3300026088 Bacteria 700
132 Ga0207648_10786090 3300026089 Bacteria 885
133 Ga0207648_10948708 3300026089 Bacteria 805
134 Ga0207676_11395195 3300026095 Bacteria 696
135 Ga0207674_11987288 3300026116 Bacteria 547
136 Ga0207698_11125741 3300026142 Bacteria 798
137 Ga0209970_1037686 3300027614 Bacteria 854
138 Ga0209588_1133290 3300027671 Bacteria 792
139 Ga0209974_10021202 3300027876 Bacteria 2152
140 Ga0268265_12149600 3300028380 Bacteria 565
141 Ga0268264_10655940 3300028381 Bacteria 1039
142 Ga0268264_12149495 3300028381 Bacteria 566
143 Ga0265326_10203754 3300028558 Bacteria 568
144 Ga0265319_1113104 3300028563 Bacteria 848
145 Ga0265318_10009217 3300028577 Bacteria 4353
146 Ga0265338_10365293 3300028800 Bacteria 1035
147 Ga0265338_11038880 3300028800 Unclassified 554
148 Ga0265770_1098208 3300030878 Bacteria 593
149 Ga0265760_10343167 3300031090 Bacteria 534
150 Ga0265332_10302477 3300031238 Bacteria 660
151 Ga0265328_10000041 3300031239 Bacteria 89398
152 Ga0265328_10014485 3300031239 Bacteria 3105
153 Ga0265328_10248737 3300031239 Bacteria 680
154 Ga0265320_10090219 3300031240 Bacteria 1420
155 Ga0265325_10162804 3300031241 Bacteria 1048
156 Ga0265340_10038450 3300031247 Bacteria 2366
157 Ga0265339_10008522 3300031249 Bacteria 6519
158 Ga0265331_10415121 3300031250 Bacteria 604
159 Ga0265327_10265422 3300031251 Bacteria 761
160 Ga0265327_10520140 3300031251 Bacteria 512
161 Ga0265316_10282146 3300031344 Bacteria 1213
162 Ga0265316_10493092 3300031344 Bacteria 875
163 Ga0265316_10737676 3300031344 Bacteria 693
164 Ga0307513_10779302 3300031456 Bacteria 662
165 Ga0307408_101083691 3300031548 Bacteria 742
166 Ga0316575_10000986 3300031665 Bacteria 8786
167 Ga0316575_10090221 3300031665 Bacteria 1241
168 Ga0316575_10475477 3300031665 Bacteria 541
169 Ga0316579_10016915 3300031691 Bacteria 3193
170 Ga0316579_10086562 3300031691 Bacteria 1495
171 Ga0316579_10359007 3300031691 Bacteria 705
172 Ga0265314_10028270 3300031711 Bacteria 4183
173 Ga0265342_10171071 3300031712 Bacteria 1195
174 Ga0316576_10005834 3300031727 Bacteria 7592
175 Ga0316578_10124141 3300031728 Bacteria 1552
176 Ga0307516_10060173 3300031730 Bacteria 3691
177 Ga0307405_10006207 3300031731 Bacteria 5858
178 Ga0316577_10009939 3300031733 Bacteria 5131
179 Ga0316577_10300516 3300031733 Bacteria 909
180 Ga0307413_10267216 3300031824 Bacteria 1278
181 Ga0307410_10026483 3300031852 Bacteria 3651
182 Ga0307410_10524869 3300031852 Bacteria 978
183 Ga0307406_10024184 3300031901 Bacteria 3625
184 Ga0307406_10516552 3300031901 Bacteria 971
185 Ga0307412_10039066 3300031911 Bacteria 3061
186 Ga0307412_10278519 3300031911 Bacteria 1312
187 Ga0307409_100091347 3300031995 Bacteria 2495
188 Ga0307409_100903011 3300031995 Bacteria 897
189 Ga0307416_100599730 3300032002 Bacteria 1181
190 Ga0307414_10012983 3300032004 Bacteria 4945
191 Ga0307414_10466712 3300032004 Bacteria 1110
192 Ga0307414_10560470 3300032004 Bacteria 1019
193 Ga0307414_10813836 3300032004 Bacteria 852
194 Ga0307414_10982812 3300032004 Bacteria 776
195 Ga0307411_10081973 3300032005 Bacteria 2223
196 Ga0307411_11195264 3300032005 Bacteria 689
197 Ga0307411_11276655 3300032005 Bacteria 668
198 Ga0307411_12007771 3300032005 Bacteria 540
199 Ga0307415_101457370 3300032126 Bacteria 654
200 Ga0316583_10054181 3300032133 Bacteria 1410
201 Ga0316583_10337500 3300032133 Unclassified 521
202 Ga0316585_10002061 3300032137 Bacteria 5391
203 Ga0316580_10020547 3300032139 Bacteria 2034
204 Ga0316593_10000349 3300032168 Bacteria 8071
205 Ga0316593_10002228 3300032168 Bacteria 4542
206 Ga0316593_10004876 3300032168 Bacteria 3488
207 Ga0316593_10020369 3300032168 Bacteria 2062
208 Ga0316593_10129538 3300032168 Bacteria 909
209 Ga0316592_1003508 3300033524 Bacteria 2833
210 Ga0316586_1019360 3300033527 Bacteria 1112
211 Ga0316588_1003356 3300033528 Bacteria 2911
212 Ga0316596_1000615 3300033541 Bacteria 6324
213 Ga0373951_0066206 3300035091 Bacteria 913
214 Ga0373941_0285480 3300035115 Bacteria 654
215 Ga0373954_0456125 3300035118 Bacteria 633
216 Ga0316574_0001643 3300035398 Bacteria 10749
217 Ga0316574_0697331 3300035398 Bacteria 623
218 Ga0316574_0956226 3300035398 Bacteria 517
219 Ga0373931_0771523 3300035691 Bacteria 639
220 Ga0373935_1140539 3300035692 Bacteria 581
221 Ga0373935_1337436 3300035692 Bacteria 535
222 Ga0373933_0222247 3300035724 Bacteria 1212
223 Ga0373933_0355522 3300035724 Bacteria 952
224 Ga0373933_0510491 3300035724 Bacteria 788
225 Ga0316582_0009543 3300036647 Bacteria 5271
226 Ga0316582_0066745 3300036647 Bacteria 2320
227 Ga0316582_0068725 3300036647 Bacteria 2288
228 Ga0316582_0480594 3300036647 Bacteria 856
229 Ga0316584_0001849 3300036712 Bacteria 13108
230 Ga0316584_0168695 3300036712 Bacteria 1625
231 Ga0395899_0700804 3300037312 Bacteria 635
232 Ga0395900_0004844 3300037418 Bacteria 14179
233 Ga0395900_0898235 3300037418 Bacteria 809
234 Ga0395900_1373757 3300037418 Bacteria 620
235 Ga0395898_0096111 3300037466 Bacteria 2846
236 Ga0395898_0581135 3300037466 Bacteria 1063
237 Ga0395905_1150085 3300037471 Bacteria 679
238 Ga0316581_0013780 3300037588 Bacteria 2296
239 Ga0436364_1483493 3300037853 Bacteria 5443
240 Ga0395901_0053587 3300038443 Bacteria 4191
241 Ga0395901_1966248 3300038443 Bacteria 531
242 Ga0400483_072180 3300039062 Bacteria 2225
243 Ga0400483_147820 3300039062 Bacteria 2477
244 Ga0400487_08546 3300039110 Bacteria 1024
245 Ga0436365_0047289 3300039437 Bacteria 7014
246 Ga0436365_0376847 3300039437 Bacteria 89580
247 Ga0436365_0542581 3300039437 Bacteria 596
248 Ga0436360_0147347 3300039438 Bacteria 1378
249 Ga0436360_0321131 3300039438 Bacteria 1021
250 Ga0436360_0355448 3300039438 Bacteria 2358
251 Ga0436360_0454769 3300039438 Bacteria 2380
252 Ga0436360_0537617 3300039438 Bacteria 7493
253 Ga0436360_0624015 3300039438 Bacteria 816
254 Ga0436360_0723239 3300039438 Bacteria 576
255 Ga0436360_0820186 3300039438 Bacteria 854
256 Ga0436360_1194619 3300039438 Bacteria 772
257 Ga0436360_1211980 3300039438 Bacteria 925
258 Ga0436361_0014203 3300039447 Bacteria 1592
259 Ga0436361_0318276 3300039447 Bacteria 2628
260 Ga0436361_0510053 3300039447 Bacteria 566
261 Ga0436361_0706861 3300039447 Bacteria 1998
262 Ga0436361_0866004 3300039447 Bacteria 1371
263 Ga0436361_1025029 3300039447 Bacteria 3243
264 Ga0436363_0101867 3300039450 Bacteria 3467
265 Ga0436363_0858619 3300039450 Bacteria 1652
266 Ga0436363_1561855 3300039450 Bacteria 633
267 Ga0436362_0398087 3300039453 Bacteria 1302
268 Ga0436362_1087862 3300039453 Bacteria 1420
269 Ga0451790_38519 3300041444 Bacteria 517
270 Ga0451791_0781854 3300041451 Bacteria 1105
271 Ga0451793_0378461 3300041452 Bacteria 538
272 Ga0451797_1359083 3300041453 Bacteria 632
273 Ga0451807_0982769 3300041486 Bacteria 944
274 Ga0451837_0083364 3300041494 Bacteria 1407
275 Ga0451837_1800192 3300041494 Bacteria 633
276 Ga0451843_0855842 3300041509 Bacteria 662
277 Ga0451853_0212792 3300041512 Bacteria 555
278 Ga0439431_0052962 3300041997 Bacteria 1056
279 Ga0439432_156860 3300042006 Bacteria 667
280 Ga0495629_0193960 3300046459 Bacteria 1405
281 Ga0495629_0367825 3300046459 Bacteria 979
282 Ga0495641_0140816 3300046461 Bacteria 1077
283 Ga0495618_0193002 3300046514 Bacteria 1291
284 Ga0495620_0294425 3300046515 Bacteria 617
285 Ga0495630_0441589 3300046517 Bacteria 997
286 Ga0495665_0601615 3300046531 Bacteria 549
287 Ga0495640_0846755 3300046533 Bacteria 543
288 Ga0495587_0458619 3300046536 Bacteria 706
289 Ga0495598_0047225 3300046537 Bacteria 1283
290 Ga0495667_0345418 3300046559 Bacteria 940
291 Ga0495611_0510325 3300046648 Bacteria 546
292 Ga0495625_0218098 3300046660 Bacteria 1251
293 Ga0495635_0175957 3300046663 Bacteria 1455
294 Ga0495635_0757699 3300046663 Bacteria 627
295 Ga0495669_0000044 3300046684 Bacteria 85633
296 Ga0495613_0000576 3300046689 Bacteria 29823
297 Ga0495613_0109975 3300046689 Bacteria 1986
298 Ga0495624_0469722 3300046690 Bacteria 753
299 Ga0495600_0398497 3300046809 Bacteria 857
300 Ga0495581_0598256 3300047315 Bacteria 639
301 Ga0495604_0333675 3300047317 Bacteria 1011
302 Ga0495674_0198490 3300047319 Bacteria 1665
303 Ga0495674_0813865 3300047319 Bacteria 726
304 Ga0495672_0117197 3300047320 Bacteria 1421
305 Ga0495672_0250329 3300047320 Bacteria 860
306 Ga0495684_0160009 3300047471 Bacteria 1680
307 Ga0495593_0063381 3300047673 Bacteria 1930
308 Ga0495602_0163855 3300048088 Bacteria 1733
309 Ga0496100_0401356 3300048903 Bacteria 1044
310 Ga0496100_0815485 3300048903 Bacteria 731
311 Ga0496101_0312224 3300048904 Bacteria 1233
312 Ga0496101_0498506 3300048904 Bacteria 962
313 Ga0496102_0037431 3300048905 Bacteria 4377
314 Ga0496102_0783859 3300048905 Bacteria 876
315 Ga0496102_1504585 3300048905 Bacteria 592
316 Ga0496104_0050054 3300048907 Bacteria 3942
317 Ga0496105_0406874 3300048908 Bacteria 1079
318 Ga0496105_0514765 3300048908 Bacteria 938
319 Ga0496106_0186897 3300048909 Bacteria 1646
320 Ga0496106_0286824 3300048909 Bacteria 1319
321 Ga0496106_1123889 3300048909 Bacteria 615
322 Ga0496106_1375186 3300048909 Bacteria 546
323 Ga0496106_1504656 3300048909 Bacteria 518
324 Ga0496107_0513397 3300048910 Bacteria 889
325 Ga0496107_0632702 3300048910 Bacteria 789
326 Ga0496108_0236249 3300048911 Bacteria 1590
327 Ga0496109_1322012 3300048912 Bacteria 657
328 Ga0496109_1735258 3300048912 Bacteria 558
329 Ga0496110_0213506 3300048913 Bacteria 1754
330 Ga0496110_1235324 3300048913 Bacteria 656
331 Ga0496110_1765407 3300048913 Bacteria 529
332 Ga0496111_0048615 3300048914 Bacteria 3056
333 Ga0496111_0188285 3300048914 Bacteria 1534
334 Ga0496112_0850217 3300048915 Bacteria 836
335 Ga0496113_0637017 3300048916 Bacteria 853
336 Ga0496113_1471546 3300048916 Bacteria 526
337 Ga0496114_0259780 3300048917 Bacteria 1529
338 Ga0496115_0009751 3300048918 Bacteria 7152
339 Ga0496115_0129762 3300048918 Bacteria 2077
340 Ga0496115_0746302 3300048918 Bacteria 766
341 Ga0496121_0446961 3300048924 Bacteria 834
342 Ga0496122_0285722 3300048925 Bacteria 899
343 Ga0496124_0882712 3300048927 Bacteria 544
344 Ga0496125_0000815 3300048928 Bacteria 50702
345 Ga0496125_0053349 3300048928 Bacteria 3315
346 Ga0496126_0059869 3300048929 Bacteria 3428
347 Ga0496126_0365140 3300048929 Bacteria 1178
348 Ga0496126_0569671 3300048929 Bacteria 896
349 Ga0501306_010393 3300049127 Bacteria 1170
350 Ga0501306_024882 3300049127 Bacteria 858
351 Ga0501310_007080 3300049130 Bacteria 1193
352 Ga0501341_04932 3300049131 Bacteria 789
353 Ga0501305_006299 3300049161 Bacteria 1469
354 Ga0501305_024890 3300049161 Bacteria 905
355 Ga0501307_020465 3300049162 Bacteria 856
356 Ga0501311_009857 3300049527 Bacteria 1148
357 Ga0501311_024303 3300049527 Bacteria 843
358 Ga0501312_014819 3300049528 Bacteria 1100
359 Ga0501312_017939 3300049528 Bacteria 1026
360 Ga0501313_005313 3300049529 Bacteria 1356
361 Ga0501314_000441 3300049530 Bacteria 2577
362 Ga0501316_020858 3300049532 Bacteria 825
363 Ga0501318_085856 3300049534 Bacteria 515
364 Ga0501319_015145 3300049535 Bacteria 653
365 Ga0501320_064376 3300049536 Bacteria 521
366 Ga0501322_001901 3300049538 Bacteria 1233
367 Ga0501323_078061 3300049539 Bacteria 538
368 Ga0501325_002486 3300049541 Bacteria 1265
369 Ga0501329_10680 3300049545 Bacteria 578
370 Ga0501031_0340958 3300049568 Bacteria 970
371 Ga0501031_0351841 3300049568 Bacteria 954
372 Ga0501031_0431544 3300049568 Bacteria 851
373 Ga0501032_0099533 3300049569 Bacteria 1926
374 Ga0501032_0125174 3300049569 Bacteria 1698
375 Ga0501032_0319802 3300049569 Bacteria 1002
376 Ga0501032_0591232 3300049569 Bacteria 706
377 Ga0501032_0992336 3300049569 Bacteria 528
378 Ga0501033_0044482 3300049570 Bacteria 3305
379 Ga0501033_0112292 3300049570 Bacteria 1982
380 Ga0501033_0180116 3300049570 Bacteria 1515
381 Ga0501034_0069393 3300049571 Bacteria 3535
382 Ga0501034_0333296 3300049571 Bacteria 1448
383 Ga0501034_0416318 3300049571 Bacteria 1265
384 Ga0501034_0429467 3300049571 Bacteria 1241
385 Ga0501034_0571001 3300049571 Bacteria 1039
386 Ga0501034_0783539 3300049571 Bacteria 847
387 Ga0501036_0018306 3300049572 Bacteria 5865
388 Ga0501036_0027081 3300049572 Bacteria 4844
389 Ga0501036_0114275 3300049572 Bacteria 2281
390 Ga0501036_1196971 3300049572 Bacteria 619
391 Ga0501037_0020451 3300049573 Bacteria 4888
392 Ga0501037_0172986 3300049573 Bacteria 1534
393 Ga0501037_0218316 3300049573 Bacteria 1342
394 Ga0501037_0438423 3300049573 Bacteria 892
395 Ga0501037_0706384 3300049573 Bacteria 671
396 Ga0501038_0039812 3300049574 Bacteria 4110
397 Ga0501038_0102284 3300049574 Bacteria 2384
398 Ga0501038_0366378 3300049574 Bacteria 1120
399 Ga0501038_0696938 3300049574 Bacteria 761
400 Ga0501039_0040464 3300049575 Bacteria 3599
401 Ga0501039_0107203 3300049575 Bacteria 2182
402 Ga0501039_0186058 3300049575 Bacteria 1633
403 Ga0501040_0070528 3300049576 Bacteria 2411
404 Ga0501041_0013799 3300049577 Bacteria 4789
405 Ga0501042_0030096 3300049578 Bacteria 3833
406 Ga0501042_0386813 3300049578 Bacteria 1013
407 Ga0501043_0032912 3300049579 Bacteria 4078
408 Ga0501043_0314192 3300049579 Bacteria 1195
409 Ga0501043_0319125 3300049579 Bacteria 1185
410 Ga0501043_0703908 3300049579 Bacteria 738
411 Ga0501043_0764985 3300049579 Bacteria 701
412 Ga0501046_0214030 3300049580 Bacteria 1429
413 Ga0501046_0481232 3300049580 Bacteria 891
414 Ga0501047_0171216 3300049581 Bacteria 2040
415 Ga0501047_0252100 3300049581 Bacteria 1613
416 Ga0501047_1073232 3300049581 Bacteria 618
417 Ga0501048_0040441 3300049582 Bacteria 3341
418 Ga0501048_0294136 3300049582 Bacteria 1155
419 Ga0501048_0390198 3300049582 Bacteria 995
420 Ga0501048_0692400 3300049582 Bacteria 732
421 Ga0501048_0819722 3300049582 Bacteria 669
422 Ga0501067_0017088 3300049583 Bacteria 4009
423 Ga0501067_0201030 3300049583 Bacteria 1110
424 Ga0501068_0024472 3300049584 Bacteria 3546
425 Ga0501068_0107095 3300049584 Bacteria 1736
426 Ga0501068_0194481 3300049584 Bacteria 1286
427 Ga0501069_0127179 3300049585 Bacteria 1458
428 Ga0501069_0209076 3300049585 Bacteria 1132
429 Ga0501070_0426971 3300049586 Bacteria 1070
430 Ga0501070_0433353 3300049586 Bacteria 1061
431 Ga0501070_0471550 3300049586 Unclassified 1010
432 Ga0501070_0702345 3300049586 Bacteria 800
433 Ga0501071_0163930 3300049587 Bacteria 1662
434 Ga0501072_0019597 3300049588 Bacteria 5231
435 Ga0501072_0589002 3300049588 Bacteria 877
436 Ga0501072_1138433 3300049588 Bacteria 607
437 Ga0501073_0058581 3300049589 Bacteria 2691
438 Ga0501073_0095338 3300049589 Bacteria 2066
439 Ga0501073_0270296 3300049589 Bacteria 1173
440 Ga0501073_0668886 3300049589 Bacteria 716
441 Ga0501074_0047115 3300049590 Bacteria 3116
442 Ga0501074_0098290 3300049590 Bacteria 2095
443 Ga0501074_1144891 3300049590 Bacteria 546
444 Ga0501075_0013808 3300049591 Bacteria 5774
445 Ga0501076_0000421 3300049592 Bacteria 26662
446 Ga0501077_0101576 3300049593 Bacteria 1822
447 Ga0501077_0206900 3300049593 Bacteria 1247
448 Ga0501077_0270029 3300049593 Bacteria 1082
449 Ga0501079_0076070 3300049741 Bacteria 2596
450 Ga0501079_0221107 3300049741 Bacteria 1480
451 Ga0501079_0437386 3300049741 Bacteria 1027
452 Ga0501080_0228421 3300049742 Bacteria 1701
453 Ga0501080_0579483 3300049742 Bacteria 997
454 Ga0501080_0660033 3300049742 Bacteria 925
455 Ga0501081_0009235 3300049743 Bacteria 6422
456 Ga0501081_0198327 3300049743 Bacteria 1455
457 Ga0501083_0596708 3300049744 Bacteria 719
458 Ga0501273_087385 3300049770 Bacteria 526
459 Ga0501035_0024284 3300049822 Bacteria 5560
460 Ga0501035_0050399 3300049822 Bacteria 3731
461 Ga0501035_0571939 3300049822 Bacteria 924
462 Ga0501035_0861654 3300049822 Bacteria 720
463 Ga0501044_0036810 3300049823 Bacteria 5118
464 Ga0501044_0064887 3300049823 Bacteria 3725
465 Ga0501044_0130572 3300049823 Bacteria 2506
466 Ga0501044_0254098 3300049823 Bacteria 1697
467 Ga0501044_0445142 3300049823 Bacteria 1203
468 Ga0501045_0047269 3300049824 Bacteria 3134
469 nmdc:mga03683_31055_c1 3300050489 Bacteria 2141
470 nmdc:mga03n38_7059_c1 3300050490 Bacteria 3948
471 nmdc:mga00v17_20896_c1 3300050491 Bacteria 3756
472 nmdc:mga00v17_438177_c1 3300050491 Bacteria 848
473 nmdc:mga0k408_72405_c1 3300050493 Bacteria 2013
474 nmdc:mga06z11_173421_c1 3300050494 Bacteria 1240
475 nmdc:mga06z11_988875_c1 3300050494 Bacteria 513
476 nmdc:mga07m45_184624_c1 3300050496 Bacteria 1213
477 nmdc:mga07m45_317154_c1 3300050496 Bacteria 906
478 nmdc:mga0qj67_120438_c1 3300050509 Bacteria 2122
479 nmdc:mga0n895_11248_c1 3300050512 Bacteria 7972
480 nmdc:mga0n895_435231_c1 3300050512 Bacteria 1325
481 nmdc:mga0rr50_231261_c1 3300050513 Bacteria 1530
482 nmdc:mga0a205_91530_c1 3300050515 Bacteria 2939
483 nmdc:mga0sz30_380655_c1 3300050516 Bacteria 632
484 Ga0495601_0370475 3300053077 Bacteria 930
485 Ga0495612_0365409 3300053078 Bacteria 653
486 Ga0495619_0090649 3300053085 Bacteria 2070
487 Ga0495619_0157287 3300053085 Bacteria 1569
488 Ga0495619_0913093 3300053085 Bacteria 590
489 Ga0500566_0123133 3300053094 Bacteria 1396
490 Ga0500593_000058 3300053117 Bacteria 41070
491 Ga0500593_068358 3300053117 Bacteria 1547
492 Ga0500568_0000001 3300053139 Bacteria 988705
493 Ga0500568_0394789 3300053139 Bacteria 501
494 Ga0500573_0503255 3300053140 Bacteria 547
495 Ga0500604_0000294 3300053151 Bacteria 13881
496 Ga0500619_043325 3300053154 Bacteria 1430
497 Ga0501084_0077198 3300054114 Bacteria 2792
498 Ga0501084_0452192 3300054114 Bacteria 1086
499 Ga0500661_046834 3300055283 Bacteria 769
500 Ga0587070_003577 3300059491 Bacteria 1884
501 Ga0587086_006705 3300059507 Bacteria 1296
502 Ga0587092_058232 3300059512 Bacteria 717
503 Ga0587101_003004 3300059623 Bacteria 1676
504 Ga0587127_019609 3300059629 Bacteria 592
505 Ga0587072_003068 3300059643 Bacteria 2312
506 Ga0587072_028133 3300059643 Bacteria 1036
507 Ga0587071_002314 3300060344 Bacteria 2569
508 Ga0501082_0015085 3300060353 Bacteria 6656
509 Ga0501082_0169846 3300060353 Bacteria 1896
510 Ga0501082_0970719 3300060353 Bacteria 743
511 Ga0530510_0078777 3300061734 Bacteria 2396
512 Ga0530510_0227162 3300061734 Bacteria 1388
513 Ga0530510_0640748 3300061734 Bacteria 809
514 2535484935 2534681786 Bacteria 3308809
515 2643911593 2643221580 Bacteria 3816678
516 2643963607 2643221591 Bacteria 4397626
517 2644410385 2643221674 Bacteria 3919126
518 2753359564 2751185800 Bacteria 5467370
519 2757572023 2757320392 Bacteria 3737298
520 2758641825 2758568016 Bacteria 5645291
521 2770195571 2767802442 Bacteria 5747986
522 2854912156 2854911287 Bacteria 5582813
523 2894654246 2894652903 Bacteria 4587256
524 2915654120 2915650412 Bacteria 4288180
525 3002143939 3002141150 Bacteria 5254435
526 Ga0436360_0008454
527 Ga0070658_10416032
528 Ga0070666_10124941
529 Ga0070660_100871421
530 Ga0070691_10182111
531 Ga0070673_101936104
532 Ga0070714_102423206
533 Ga0070713_100363066
534 Ga0070713_100597760
535 Ga0070711_100208257
536 Ga0070678_100526188
537 Ga0070685_10004968
538 Ga0070679_100590914
539 Ga0070684_101807597
540 Ga0068853_100002020
541 Ga0068855_101327278
542 Ga0070664_101155806
543 Ga0068854_100195338
544 Ga0068854_101016256
545 Ga0068854_101783947
546 Ga0068856_100381086
547 Ga0068856_101026913
548 Ga0070702_101163176
549 Ga0068852_100426802
550 Ga0068864_101865819
551 Ga0068863_101530906
552 Ga0068858_101749995
553 Ga0068858_102093377
554 Ga0075365_10805682
555 Ga0075365_10889827
556 Ga0075365_11109304
557 Ga0075363_100018755
558 Ga0075364_10035085
559 Ga0070712_100120515
560 Ga0070712_100365951
561 Ga0070712_100393545
562 Ga0075362_10003594
563 Ga0075367_10073553
564 Ga0075369_10134076
565 Ga0075366_10048147
566 Ga0075366_10152099
567 Ga0075366_10596180
568 Ga0097621_102072049
569 Ga0075370_10008914
570 Ga0075370_10159439
571 Ga0075370_10459230
572 Ga0068871_100835810
573 Ga0075433_10457594
574 Ga0075434_100109072
575 Ga0075434_100230918
576 Ga0075436_100575069
577 Ga0075435_100043491
578 Ga0105240_10000798
579 Ga0105240_10038434
580 Ga0105240_10662586
581 Ga0105240_11082145
582 Ga0105241_10742694
583 Ga0105241_10977593
584 Ga0105242_10314107
585 Ga0105248_10222577
586 Ga0105248_10545742
587 Ga0105237_10698469
588 Ga0105238_10164963
589 Ga0105238_10863098
590 Ga0105238_10928529
591 Ga0105030_128047
592 Ga0105239_10587410
593 Ga0105239_11294546
594 Ga0157371_10133052
595 Ga0157370_10390973
596 Ga0157369_12174895
597 Ga0157374_10141807
598 Ga0157378_11729040
599 Ga0157372_12336828
600 Ga0157375_10502592
601 Ga0163163_11833915
602 Ga0157376_10513798
603 Ga0157376_10639963
604 Ga0206353_10979880
605 Ga0213872_10059007
606 Ga0213872_10077193
607 Ga0213872_10111276
608 Ga0213874_10010369
609 Ga0213874_10089747
610 Ga0213874_10466661
611 Ga0213876_10000244
612 Ga0213876_10582157
613 Ga0213875_10063678
614 Ga0213871_10074150
615 Ga0213871_10102972
616 Ga0213871_10163356
617 Ga0213871_10213084
618 Ga0207692_10139774
619 Ga0207680_10398473
620 Ga0207680_10458795
621 Ga0207643_10322431
622 Ga0207654_10139882
623 Ga0207654_10390734
624 Ga0207695_10010884
625 Ga0207695_10058589
626 Ga0207695_10125896
627 Ga0207693_10127235
628 Ga0207693_10962781
629 Ga0207693_10984361
630 Ga0207663_10247337
631 Ga0207663_11246153
632 Ga0207657_10877653
633 Ga0207694_10161581
634 Ga0207694_10859735
635 Ga0207694_10991489
636 Ga0207694_11299435
637 Ga0207659_11562147
638 Ga0207700_10431656
639 Ga0207700_10432293
640 Ga0207700_11805624
641 Ga0207664_10924090
642 Ga0207711_10488319
643 Ga0207711_10826081
644 Ga0207689_10006518
645 Ga0207679_10845814
646 Ga0207667_11010122
647 Ga0207667_11160474
648 Ga0207668_10094737
649 Ga0207640_10188781
650 Ga0207658_10055258
651 Ga0207703_10345430
652 Ga0207639_10000867
653 Ga0207702_10560913
654 Ga0207702_10959003
655 Ga0207702_12049184
656 Ga0207641_11399601
657 Ga0207648_10786090
658 Ga0207648_10948708
659 Ga0207676_11395195
660 Ga0207674_11987288
661 Ga0207698_11125741
662 Ga0209970_1037686
663 Ga0209588_1133290
664 Ga0209974_10021202
665 Ga0268265_12149600
666 Ga0268264_10655940
667 Ga0268264_12149495
668 Ga0265326_10203754
669 Ga0265319_1113104
670 Ga0265318_10009217
671 Ga0265338_10365293
672 Ga0265338_11038880
673 Ga0265770_1098208
674 Ga0265760_10343167
675 Ga0265332_10302477
676 Ga0265328_10000041
677 Ga0265328_10014485
678 Ga0265328_10248737
679 Ga0265320_10090219
680 Ga0265325_10162804
681 Ga0265340_10038450
682 Ga0265339_10008522
683 Ga0265331_10415121
684 Ga0265327_10265422
685 Ga0265327_10520140
686 Ga0265316_10282146
687 Ga0265316_10493092
688 Ga0265316_10737676
689 Ga0307513_10779302
690 Ga0307408_101083691
691 Ga0316575_10000986
692 Ga0316575_10090221
693 Ga0316575_10475477
694 Ga0316579_10016915
695 Ga0316579_10086562
696 Ga0316579_10359007
697 Ga0265314_10028270
698 Ga0265342_10171071
699 Ga0316576_10005834
700 Ga0316578_10124141
701 Ga0307516_10060173
702 Ga0307405_10006207
703 Ga0316577_10009939
704 Ga0316577_10300516
705 Ga0307413_10267216
706 Ga0307410_10026483
707 Ga0307410_10524869
708 Ga0307406_10024184
709 Ga0307406_10516552
710 Ga0307412_10039066
711 Ga0307412_10278519
712 Ga0307409_100091347
713 Ga0307409_100903011
714 Ga0307416_100599730
715 Ga0307414_10012983
716 Ga0307414_10466712
717 Ga0307414_10560470
718 Ga0307414_10813836
719 Ga0307414_10982812
720 Ga0307411_10081973
721 Ga0307411_11195264
722 Ga0307411_11276655
723 Ga0307411_12007771
724 Ga0307415_101457370
725 Ga0316583_10054181
726 Ga0316583_10337500
727 Ga0316585_10002061
728 Ga0316580_10020547
729 Ga0316593_10000349
730 Ga0316593_10002228
731 Ga0316593_10004876
732 Ga0316593_10020369
733 Ga0316593_10129538
734 Ga0316592_1003508
735 Ga0316586_1019360
736 Ga0316588_1003356
737 Ga0316596_1000615
738 Ga0373951_0066206
739 Ga0373941_0285480
740 Ga0373954_0456125
741 Ga0316574_0001643
742 Ga0316574_0697331
743 Ga0316574_0956226
744 Ga0373931_0771523
745 Ga0373935_1140539
746 Ga0373935_1337436
747 Ga0373933_0222247
748 Ga0373933_0355522
749 Ga0373933_0510491
750 Ga0316582_0009543
751 Ga0316582_0066745
752 Ga0316582_0068725
753 Ga0316582_0480594
754 Ga0316584_0001849
755 Ga0316584_0168695
756 Ga0395899_0700804
757 Ga0395900_0004844
758 Ga0395900_0898235
759 Ga0395900_1373757
760 Ga0395898_0096111
761 Ga0395898_0581135
762 Ga0395905_1150085
763 Ga0316581_0013780
764 Ga0436364_1483493
765 Ga0395901_0053587
766 Ga0395901_1966248
767 Ga0400483_072180
768 Ga0400483_147820
769 Ga0400487_08546
770 Ga0436365_0047289
771 Ga0436365_0376847
772 Ga0436365_0542581
773 Ga0436360_0147347
774 Ga0436360_0321131
775 Ga0436360_0355448
776 Ga0436360_0454769
777 Ga0436360_0537617
778 Ga0436360_0624015
779 Ga0436360_0723239
780 Ga0436360_0820186
781 Ga0436360_1194619
782 Ga0436360_1211980
783 Ga0436361_0014203
784 Ga0436361_0318276
785 Ga0436361_0510053
786 Ga0436361_0706861
787 Ga0436361_0866004
788 Ga0436361_1025029
789 Ga0436363_0101867
790 Ga0436363_0858619
791 Ga0436363_1561855
792 Ga0436362_0398087
793 Ga0436362_1087862
794 Ga0451790_38519
795 Ga0451791_0781854
796 Ga0451793_0378461
797 Ga0451797_1359083
798 Ga0451807_0982769
799 Ga0451837_0083364
800 Ga0451837_1800192
801 Ga0451843_0855842
802 Ga0451853_0212792
803 Ga0439431_0052962
804 Ga0439432_156860
805 Ga0495629_0193960
806 Ga0495629_0367825
807 Ga0495641_0140816
808 Ga0495618_0193002
809 Ga0495620_0294425
810 Ga0495630_0441589
811 Ga0495665_0601615
812 Ga0495640_0846755
813 Ga0495587_0458619
814 Ga0495598_0047225
815 Ga0495667_0345418
816 Ga0495611_0510325
817 Ga0495625_0218098
818 Ga0495635_0175957
819 Ga0495635_0757699
820 Ga0495669_0000044
821 Ga0495613_0000576
822 Ga0495613_0109975
823 Ga0495624_0469722
824 Ga0495600_0398497
825 Ga0495581_0598256
826 Ga0495604_0333675
827 Ga0495674_0198490
828 Ga0495674_0813865
829 Ga0495672_0117197
830 Ga0495672_0250329
831 Ga0495684_0160009
832 Ga0495593_0063381
833 Ga0495602_0163855
834 Ga0496100_0401356
835 Ga0496100_0815485
836 Ga0496101_0312224
837 Ga0496101_0498506
838 Ga0496102_0037431
839 Ga0496102_0783859
840 Ga0496102_1504585
841 Ga0496104_0050054
842 Ga0496105_0406874
843 Ga0496105_0514765
844 Ga0496106_0186897
845 Ga0496106_0286824
846 Ga0496106_1123889
847 Ga0496106_1375186
848 Ga0496106_1504656
849 Ga0496107_0513397
850 Ga0496107_0632702
851 Ga0496108_0236249
852 Ga0496109_1322012
853 Ga0496109_1735258
854 Ga0496110_0213506
855 Ga0496110_1235324
856 Ga0496110_1765407
857 Ga0496111_0048615
858 Ga0496111_0188285
859 Ga0496112_0850217
860 Ga0496113_0637017
861 Ga0496113_1471546
862 Ga0496114_0259780
863 Ga0496115_0009751
864 Ga0496115_0129762
865 Ga0496115_0746302
866 Ga0496121_0446961
867 Ga0496122_0285722
868 Ga0496124_0882712
869 Ga0496125_0000815
870 Ga0496125_0053349
871 Ga0496126_0059869
872 Ga0496126_0365140
873 Ga0496126_0569671
874 Ga0501306_010393
875 Ga0501306_024882
876 Ga0501310_007080
877 Ga0501341_04932
878 Ga0501305_006299
879 Ga0501305_024890
880 Ga0501307_020465
881 Ga0501311_009857
882 Ga0501311_024303
883 Ga0501312_014819
884 Ga0501312_017939
885 Ga0501313_005313
886 Ga0501314_000441
887 Ga0501316_020858
888 Ga0501318_085856
889 Ga0501319_015145
890 Ga0501320_064376
891 Ga0501322_001901
892 Ga0501323_078061
893 Ga0501325_002486
894 Ga0501329_10680
895 Ga0501031_0340958
896 Ga0501031_0351841
897 Ga0501031_0431544
898 Ga0501032_0099533
899 Ga0501032_0125174
900 Ga0501032_0319802
901 Ga0501032_0591232
902 Ga0501032_0992336
903 Ga0501033_0044482
904 Ga0501033_0112292
905 Ga0501033_0180116
906 Ga0501034_0069393
907 Ga0501034_0333296
908 Ga0501034_0416318
909 Ga0501034_0429467
910 Ga0501034_0571001
911 Ga0501034_0783539
912 Ga0501036_0018306
913 Ga0501036_0027081
914 Ga0501036_0114275
915 Ga0501036_1196971
916 Ga0501037_0020451
917 Ga0501037_0172986
918 Ga0501037_0218316
919 Ga0501037_0438423
920 Ga0501037_0706384
921 Ga0501038_0039812
922 Ga0501038_0102284
923 Ga0501038_0366378
924 Ga0501038_0696938
925 Ga0501039_0040464
926 Ga0501039_0107203
927 Ga0501039_0186058
928 Ga0501040_0070528
929 Ga0501041_0013799
930 Ga0501042_0030096
931 Ga0501042_0386813
932 Ga0501043_0032912
933 Ga0501043_0314192
934 Ga0501043_0319125
935 Ga0501043_0703908
936 Ga0501043_0764985
937 Ga0501046_0214030
938 Ga0501046_0481232
939 Ga0501047_0171216
940 Ga0501047_0252100
941 Ga0501047_1073232
942 Ga0501048_0040441
943 Ga0501048_0294136
944 Ga0501048_0390198
945 Ga0501048_0692400
946 Ga0501048_0819722
947 Ga0501067_0017088
948 Ga0501067_0201030
949 Ga0501068_0024472
950 Ga0501068_0107095
951 Ga0501068_0194481
952 Ga0501069_0127179
953 Ga0501069_0209076
954 Ga0501070_0426971
955 Ga0501070_0433353
956 Ga0501070_0471550
957 Ga0501070_0702345
958 Ga0501071_0163930
959 Ga0501072_0019597
960 Ga0501072_0589002
961 Ga0501072_1138433
962 Ga0501073_0058581
963 Ga0501073_0095338
964 Ga0501073_0270296
965 Ga0501073_0668886
966 Ga0501074_0047115
967 Ga0501074_0098290
968 Ga0501074_1144891
969 Ga0501075_0013808
970 Ga0501076_0000421
971 Ga0501077_0101576
972 Ga0501077_0206900
973 Ga0501077_0270029
974 Ga0501079_0076070
975 Ga0501079_0221107
976 Ga0501079_0437386
977 Ga0501080_0228421
978 Ga0501080_0579483
979 Ga0501080_0660033
980 Ga0501081_0009235
981 Ga0501081_0198327
982 Ga0501083_0596708
983 Ga0501273_087385
984 Ga0501035_0024284
985 Ga0501035_0050399
986 Ga0501035_0571939
987 Ga0501035_0861654
988 Ga0501044_0036810
989 Ga0501044_0064887
990 Ga0501044_0130572
991 Ga0501044_0254098
992 Ga0501044_0445142
993 Ga0501045_0047269
994 nmdc:mga03683_31055_c1
995 nmdc:mga03n38_7059_c1
996 nmdc:mga00v17_20896_c1
997 nmdc:mga00v17_438177_c1
998 nmdc:mga0k408_72405_c1
999 nmdc:mga06z11_173421_c1
1000 nmdc:mga06z11_988875_c1
1001 nmdc:mga07m45_184624_c1
1002 nmdc:mga07m45_317154_c1
1003 nmdc:mga0qj67_120438_c1
1004 nmdc:mga0n895_11248_c1
1005 nmdc:mga0n895_435231_c1
1006 nmdc:mga0rr50_231261_c1
1007 nmdc:mga0a205_91530_c1
1008 nmdc:mga0sz30_380655_c1
1009 Ga0495601_0370475
1010 Ga0495612_0365409
1011 Ga0495619_0090649
1012 Ga0495619_0157287
1013 Ga0495619_0913093
1014 Ga0500566_0123133
1015 Ga0500593_000058
1016 Ga0500593_068358
1017 Ga0500568_0000001
1018 Ga0500568_0394789
1019 Ga0500573_0503255
1020 Ga0500604_0000294
1021 Ga0500619_043325
1022 Ga0501084_0077198
1023 Ga0501084_0452192
1024 Ga0500661_046834
1025 Ga0587070_003577
1026 Ga0587086_006705
1027 Ga0587092_058232
1028 Ga0587101_003004
1029 Ga0587127_019609
1030 Ga0587072_003068
1031 Ga0587072_028133
1032 Ga0587071_002314
1033 Ga0501082_0015085
1034 Ga0501082_0169846
1035 Ga0501082_0970719
1036 Ga0530510_0078777
1037 Ga0530510_0227162
1038 Ga0530510_0640748
1039 2535484935
1040 2643911593
1041 2643963607
1042 2644410385
1043 2753359564
1044 2757572023
1045 2758641825
1046 2770195571
1047 2854912156
1048 2894654246
1049 2915654120
1050 3002143939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

51

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h1n-assembly1.cif.gz_B crystal structure of sf173 from shigella flexneri 0.9894 24 49
3tuf-assembly1.cif.gz_A structure of the spoiiq-spoiiiah pore forming complex. 0.9159 18 49
6fsh-assembly3.cif.gz_C crystal structure of hybrid p450 oxybtei(bc/fgvan) 0.8937 19 50
1ya0-assembly2.cif.gz_B crystal structure of the n-terminal domain of human smg7 0.8241 17 48
1lfk-assembly1.cif.gz_A crystal structure of oxyb, a cytochrome p450 implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis 0.8197 18 50
ID Description Score Start End Superfamily
af_Q1LVF3_6_236_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8516 20 48 1.25.40.10
af_Q9VPS5_207_391_3.50.7.10 Alpha Beta;3-Layer(bba) Sandwich;GroEL;GroEL 0.8452 21 49 3.50.7.10
af_A0A1D6J1R0_7_116_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.7724 11 50 1.10.287.40
af_Q5AJZ7_16_105_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7716 3 91 1.10.287.1480
af_O42859_6_94_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7593 3 89 1.10.287.1480
ID Description Score Start End GO Terms
AF-A0A1D1XID5-F1-model_v4 Ribosomal protein S14, mitochondrial 0.9745 10 55 GO:0005739
GO:0005840
GO:1990904
AF-A0A2N1JAF3-F1-model_v4 Mrp2p 0.9493 12 72 GO:0003735
GO:0005763
GO:0006412
AF-A0A085DTT5-F1-model_v4 deleted 0.9467 7 64
AF-A0A5K1H5F4-F1-model_v4 Small ribosomal subunit protein uS14m (Ribosomal protein S14, mitochondrial) 0.9427 9 65 GO:0003735
GO:0005739
GO:0006412
GO:0015935
AF-A0A2K6LKK7-F1-model_v4 Mitochondrial ribosomal protein S14 0.9387 9 55 GO:0005737
GO:0005840
GO:1990904

Map