F459348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 525 | 366 | 1050 | 405 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2545555800|2545557550 |
| Length | 466 |
| Sequence | YFVSGKRKKILRLAEVCTQTAGKFCGKRKNAGETSRFFGLARNLLYKKGKQDLMLNDYKTRGNQIMSAFTKSQEIISQTSHYGANNYHPLPIVISEAQGVWVKDPEGNQYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKDMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAEIIACIGNFHGRTMLAVSLSSEDEYKRGFGPMLPGIKLIPYGDAEALRRAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLLIADEIQTGLGRTGKTFAVDWENIVPDMFILGKALGGGVFPISCIAANRDILGVFNPGSHGSTFGGNPLACAVSLASLEVLEEEGLAERSLQLGRYFKEELEKIDNPIIKDVRGRGLFIGVELTEAARPYCEKLKGEGLLCKETHDTVIRFAPPLMISKEDLDWAIQKITNVLQNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 96 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 97 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 98 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 109 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 110 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 111 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 119 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 122 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 123 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 126 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 131 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 134 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 135 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 136 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 137 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 138 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 139 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 181 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 182 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 183 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 208 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 209 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 212 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 216 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 217 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 218 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 219 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 220 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 221 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 222 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 223 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 224 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 227 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 231 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 232 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 233 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 234 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 235 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 236 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 237 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 238 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 239 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 240 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 241 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 242 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 243 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 244 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 245 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 246 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 247 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 248 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 249 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 250 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 251 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 252 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 253 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 254 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 255 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 256 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 257 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 258 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 259 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 260 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 261 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 262 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 263 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 264 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 265 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 266 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 267 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 268 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 269 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 270 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 271 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 272 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 273 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 274 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 275 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 276 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 277 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 278 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 279 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 280 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 281 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 282 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 283 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 284 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 285 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 286 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 287 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 288 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 289 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 290 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 291 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 292 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 293 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 294 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 295 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 296 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 297 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 298 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 299 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 300 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 301 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 302 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 303 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 304 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 305 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 306 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 307 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 308 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 309 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 310 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 311 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 312 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 313 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 314 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 315 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 316 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 317 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 318 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 319 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 320 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 321 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 322 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 323 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 324 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 325 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 326 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 327 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 328 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 329 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 330 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 331 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 332 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 333 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 334 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 335 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 336 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 337 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 338 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 339 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 340 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 341 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 342 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 343 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 344 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 345 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 346 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 347 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 348 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 349 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 350 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 351 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 352 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 353 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 354 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 355 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 356 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 357 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 358 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 359 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 360 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 361 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 362 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 363 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 364 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 365 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 366 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.33 |
| Metatranscriptomes | 0.38 |
| Isolates | 26.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 12.57 |
| Nodule | 0.38 |
| Rhizoplane | 7.24 |
| Rhizosphere | 54.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1007547 | 3300002987 | Bacteria | 3104 |
| 2 | JGI25151J46595_10000011 | 3300003187 | Bacteria | 264206 |
| 3 | JGI25151J46595_10004537 | 3300003187 | Bacteria | 7326 |
| 4 | JGI25151J46595_10006351 | 3300003187 | Bacteria | 5952 |
| 5 | JGI25151J46595_10014009 | 3300003187 | Bacteria | 3590 |
| 6 | JGI25151J46595_10016140 | 3300003187 | Bacteria | 3272 |
| 7 | JGI25151J46595_10017178 | 3300003187 | Bacteria | 3146 |
| 8 | Ga0006562J51391_1000095 | 3300003578 | Bacteria | 15431 |
| 9 | Ga0006562J51391_1071400 | 3300003578 | Bacteria | 17010 |
| 10 | Ga0055532_1000024 | 3300003758 | Bacteria | 244166 |
| 11 | Ga0065704_10089489 | 3300005289 | Bacteria | 2854 |
| 12 | Ga0065707_10128256 | 3300005295 | Bacteria | 1968 |
| 13 | Ga0070658_10011701 | 3300005327 | Bacteria | 7038 |
| 14 | Ga0070683_100000938 | 3300005329 | Bacteria | 21679 |
| 15 | Ga0070683_100366606 | 3300005329 | Bacteria | 1372 |
| 16 | Ga0070670_100190230 | 3300005331 | Bacteria | 1783 |
| 17 | Ga0070682_100004788 | 3300005337 | Bacteria | 7520 |
| 18 | Ga0070669_100000944 | 3300005353 | Bacteria | 21209 |
| 19 | Ga0070671_100002004 | 3300005355 | Bacteria | 15647 |
| 20 | Ga0070667_100000182 | 3300005367 | Bacteria | 75588 |
| 21 | Ga0070667_100002503 | 3300005367 | Bacteria | 16033 |
| 22 | Ga0070710_10000261 | 3300005437 | Bacteria | 25090 |
| 23 | Ga0070663_100069351 | 3300005455 | Bacteria | 2561 |
| 24 | Ga0070678_100147305 | 3300005456 | Bacteria | 1892 |
| 25 | Ga0070662_100005256 | 3300005457 | Bacteria | 8261 |
| 26 | Ga0070681_10130384 | 3300005458 | Bacteria | 2446 |
| 27 | Ga0068867_100046951 | 3300005459 | Bacteria | 3173 |
| 28 | Ga0070679_100044651 | 3300005530 | Bacteria | 4415 |
| 29 | Ga0070684_100050198 | 3300005535 | Bacteria | 3623 |
| 30 | Ga0070665_100008095 | 3300005548 | Bacteria | 10641 |
| 31 | Ga0070665_100179842 | 3300005548 | Bacteria | 2116 |
| 32 | Ga0068855_100060699 | 3300005563 | Bacteria | 4421 |
| 33 | Ga0068857_100243089 | 3300005577 | Bacteria | 1648 |
| 34 | Ga0068859_100008871 | 3300005617 | Bacteria | 10152 |
| 35 | Ga0068864_100017142 | 3300005618 | Bacteria | 6040 |
| 36 | Ga0068864_100055669 | 3300005618 | Bacteria | 3416 |
| 37 | Ga0068863_100012289 | 3300005841 | Bacteria | 8265 |
| 38 | Ga0068863_100014842 | 3300005841 | Bacteria | 7486 |
| 39 | Ga0068863_100120243 | 3300005841 | Bacteria | 2504 |
| 40 | Ga0068863_100359281 | 3300005841 | Bacteria | 1420 |
| 41 | Ga0068858_100039330 | 3300005842 | Bacteria | 4386 |
| 42 | Ga0068860_100000374 | 3300005843 | Bacteria | 58635 |
| 43 | Ga0068862_100000276 | 3300005844 | Bacteria | 57404 |
| 44 | Ga0068862_100090833 | 3300005844 | Bacteria | 2659 |
| 45 | Ga0081455_10017303 | 3300005937 | Bacteria | 6918 |
| 46 | Ga0075365_10033973 | 3300006038 | Bacteria | 3291 |
| 47 | Ga0075363_100001303 | 3300006048 | Bacteria | 9309 |
| 48 | Ga0075363_100028896 | 3300006048 | Bacteria | 2857 |
| 49 | Ga0075363_100046547 | 3300006048 | Bacteria | 2302 |
| 50 | Ga0075364_10011450 | 3300006051 | Bacteria | 5389 |
| 51 | Ga0075364_10023675 | 3300006051 | Bacteria | 3890 |
| 52 | Ga0075364_10027707 | 3300006051 | Bacteria | 3621 |
| 53 | Ga0075364_10031848 | 3300006051 | Bacteria | 3387 |
| 54 | Ga0075367_10003453 | 3300006178 | Bacteria | 7539 |
| 55 | Ga0075369_10020487 | 3300006186 | Bacteria | 2708 |
| 56 | Ga0075369_10021759 | 3300006186 | Bacteria | 2639 |
| 57 | Ga0075370_10002037 | 3300006353 | Bacteria | 9171 |
| 58 | Ga0075370_10003960 | 3300006353 | Bacteria | 7116 |
| 59 | Ga0075370_10004873 | 3300006353 | Bacteria | 6584 |
| 60 | Ga0075428_100001829 | 3300006844 | Bacteria | 22768 |
| 61 | Ga0075428_100025039 | 3300006844 | Bacteria | 6602 |
| 62 | Ga0075430_100001544 | 3300006846 | Bacteria | 18810 |
| 63 | Ga0075430_100055026 | 3300006846 | Bacteria | 3347 |
| 64 | Ga0075431_100033580 | 3300006847 | Bacteria | 5288 |
| 65 | Ga0097620_100008871 | 3300006931 | Bacteria | 10152 |
| 66 | Ga0105244_10000719 | 3300009036 | Bacteria | 28584 |
| 67 | Ga0105244_10020287 | 3300009036 | Bacteria | 3695 |
| 68 | Ga0105250_10005754 | 3300009092 | Bacteria | 5518 |
| 69 | Ga0105250_10027675 | 3300009092 | Bacteria | 2285 |
| 70 | Ga0111539_10137635 | 3300009094 | Bacteria | 2859 |
| 71 | Ga0105245_10036363 | 3300009098 | Bacteria | 4374 |
| 72 | Ga0105247_10000181 | 3300009101 | Bacteria | 61066 |
| 73 | Ga0105243_10165400 | 3300009148 | Bacteria | 1911 |
| 74 | Ga0105243_10235964 | 3300009148 | Bacteria | 1625 |
| 75 | Ga0105248_10000652 | 3300009177 | Bacteria | 39387 |
| 76 | Ga0105248_10004546 | 3300009177 | Bacteria | 15355 |
| 77 | Ga0105237_10003090 | 3300009545 | Bacteria | 20059 |
| 78 | Ga0105237_10057184 | 3300009545 | Bacteria | 3904 |
| 79 | Ga0105249_10000022 | 3300009553 | Bacteria | 258377 |
| 80 | Ga0105239_10001222 | 3300010375 | Bacteria | 35019 |
| 81 | Ga0105239_10030709 | 3300010375 | Bacteria | 5909 |
| 82 | Ga0105246_10012025 | 3300011119 | Bacteria | 5392 |
| 83 | Ga0157369_10271441 | 3300013105 | Bacteria | 1767 |
| 84 | Ga0163162_10035949 | 3300013306 | Bacteria | 4935 |
| 85 | Ga0163162_10060900 | 3300013306 | Bacteria | 3811 |
| 86 | Ga0157372_10012226 | 3300013307 | Bacteria | 9140 |
| 87 | Ga0157372_10104317 | 3300013307 | Bacteria | 3240 |
| 88 | Ga0157375_10077481 | 3300013308 | Bacteria | 3354 |
| 89 | Ga0157375_10103532 | 3300013308 | Bacteria | 2934 |
| 90 | Ga0157375_10259032 | 3300013308 | Bacteria | 1901 |
| 91 | Ga0157375_10354984 | 3300013308 | Bacteria | 1632 |
| 92 | Ga0163163_10072568 | 3300014325 | Bacteria | 3432 |
| 93 | Ga0163163_10098763 | 3300014325 | Bacteria | 2941 |
| 94 | Ga0163163_10176172 | 3300014325 | Bacteria | 2185 |
| 95 | Ga0157380_10006402 | 3300014326 | Bacteria | 8289 |
| 96 | Ga0213876_10021932 | 3300021384 | Bacteria | 3378 |
| 97 | Ga0209784_100061 | 3300025224 | Bacteria | 164590 |
| 98 | Ga0209147_100020 | 3300025229 | Bacteria | 474055 |
| 99 | Ga0209130_1000311 | 3300025284 | Bacteria | 57319 |
| 100 | Ga0209130_1006242 | 3300025284 | Bacteria | 3915 |
| 101 | Ga0209130_1006505 | 3300025284 | Bacteria | 3781 |
| 102 | Ga0209675_1012279 | 3300025291 | Bacteria | 2772 |
| 103 | Ga0209676_1000274 | 3300025292 | Bacteria | 107505 |
| 104 | Ga0209676_1000808 | 3300025292 | Bacteria | 40975 |
| 105 | Ga0209025_1000011 | 3300025294 | Bacteria | 976387 |
| 106 | Ga0209025_1000043 | 3300025294 | Bacteria | 350458 |
| 107 | Ga0209025_1000209 | 3300025294 | Bacteria | 140401 |
| 108 | Ga0209025_1000851 | 3300025294 | Bacteria | 48307 |
| 109 | Ga0209025_1001029 | 3300025294 | Bacteria | 40908 |
| 110 | Ga0209025_1002458 | 3300025294 | Bacteria | 19577 |
| 111 | Ga0209025_1003417 | 3300025294 | Bacteria | 15063 |
| 112 | Ga0209025_1006279 | 3300025294 | Bacteria | 9295 |
| 113 | Ga0209025_1006597 | 3300025294 | Bacteria | 8945 |
| 114 | Ga0209025_1016765 | 3300025294 | Bacteria | 4288 |
| 115 | Ga0209025_1024252 | 3300025294 | Bacteria | 3137 |
| 116 | Ga0209025_1028312 | 3300025294 | Bacteria | 2750 |
| 117 | Ga0207696_1005618 | 3300025711 | Bacteria | 5175 |
| 118 | Ga0207696_1021684 | 3300025711 | Bacteria | 2054 |
| 119 | Ga0207655_1000184 | 3300025728 | Bacteria | 111832 |
| 120 | Ga0207655_1002232 | 3300025728 | Bacteria | 16043 |
| 121 | Ga0207710_10000091 | 3300025900 | Bacteria | 121330 |
| 122 | Ga0207705_10022680 | 3300025909 | Bacteria | 4478 |
| 123 | Ga0207707_10067445 | 3300025912 | Bacteria | 3117 |
| 124 | Ga0207671_10055321 | 3300025914 | Bacteria | 2940 |
| 125 | Ga0207657_10209240 | 3300025919 | Bacteria | 1566 |
| 126 | Ga0207652_10013343 | 3300025921 | Bacteria | 6653 |
| 127 | Ga0207652_10065539 | 3300025921 | Bacteria | 3146 |
| 128 | Ga0207681_10001711 | 3300025923 | Bacteria | 14112 |
| 129 | Ga0207650_10163320 | 3300025925 | Bacteria | 1766 |
| 130 | Ga0207644_10005495 | 3300025931 | Bacteria | 8254 |
| 131 | Ga0207691_10176525 | 3300025940 | Bacteria | 1868 |
| 132 | Ga0207711_10000713 | 3300025941 | Bacteria | 32689 |
| 133 | Ga0207661_10003990 | 3300025944 | Bacteria | 10316 |
| 134 | Ga0207667_10100355 | 3300025949 | Bacteria | 2986 |
| 135 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 136 | Ga0207658_10000316 | 3300025986 | Bacteria | 48662 |
| 137 | Ga0207677_10108471 | 3300026023 | Bacteria | 2062 |
| 138 | Ga0207641_10003321 | 3300026088 | Bacteria | 14315 |
| 139 | Ga0207641_10011331 | 3300026088 | Bacteria | 7318 |
| 140 | Ga0207641_10329744 | 3300026088 | Bacteria | 1449 |
| 141 | Ga0207674_10037704 | 3300026116 | Bacteria | 5023 |
| 142 | Ga0207674_10215566 | 3300026116 | Bacteria | 1868 |
| 143 | Ga0207675_100056433 | 3300026118 | Bacteria | 3663 |
| 144 | Ga0207683_10232652 | 3300026121 | Bacteria | 1681 |
| 145 | Ga0207698_10040157 | 3300026142 | Bacteria | 3473 |
| 146 | Ga0209813_10023746 | 3300027866 | Bacteria | 1746 |
| 147 | Ga0268266_10004670 | 3300028379 | Bacteria | 13049 |
| 148 | Ga0268266_10020334 | 3300028379 | Bacteria | 5659 |
| 149 | Ga0268265_10000005 | 3300028380 | Bacteria | 535350 |
| 150 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 151 | Ga0307517_10071568 | 3300028786 | Bacteria | 3106 |
| 152 | Ga0307517_10160254 | 3300028786 | Bacteria | 1513 |
| 153 | Ga0307515_10036058 | 3300028794 | Bacteria | 8018 |
| 154 | Ga0307515_10065813 | 3300028794 | Bacteria | 5034 |
| 155 | Ga0307515_10106730 | 3300028794 | Bacteria | 3318 |
| 156 | Ga0237817_10012 | 3300030083 | Bacteria | 76001 |
| 157 | Ga0237817_10068 | 3300030083 | Bacteria | 33736 |
| 158 | Ga0307511_10013821 | 3300030521 | Bacteria | 7877 |
| 159 | Ga0307512_10005567 | 3300030522 | Bacteria | 13089 |
| 160 | Ga0265327_10000532 | 3300031251 | Bacteria | 65543 |
| 161 | Ga0265327_10003586 | 3300031251 | Bacteria | 14659 |
| 162 | Ga0307513_10067180 | 3300031456 | Bacteria | 3763 |
| 163 | Ga0307509_10049617 | 3300031507 | Bacteria | 4499 |
| 164 | Ga0265342_10008744 | 3300031712 | Bacteria | 7223 |
| 165 | Ga0316576_10029907 | 3300031727 | Bacteria | 3854 |
| 166 | Ga0316576_10039988 | 3300031727 | Bacteria | 3368 |
| 167 | Ga0307516_10002975 | 3300031730 | Bacteria | 22144 |
| 168 | Ga0307413_10037452 | 3300031824 | Bacteria | 2801 |
| 169 | Ga0307413_10090069 | 3300031824 | Bacteria | 1995 |
| 170 | Ga0307410_10245949 | 3300031852 | Bacteria | 1388 |
| 171 | Ga0307411_10122509 | 3300032005 | Bacteria | 1884 |
| 172 | Ga0307415_100078701 | 3300032126 | Bacteria | 2346 |
| 173 | Ga0307507_10106290 | 3300033179 | Bacteria | 2318 |
| 174 | Ga0307510_10206167 | 3300033180 | Bacteria | 1494 |
| 175 | Ga0373926_0052234 | 3300035083 | Bacteria | 1477 |
| 176 | Ga0373951_0000316 | 3300035091 | Bacteria | 15083 |
| 177 | Ga0373945_0047835 | 3300035116 | Bacteria | 1565 |
| 178 | Ga0373927_0000524 | 3300035695 | Bacteria | 29117 |
| 179 | Ga0373947_0000741 | 3300035725 | Bacteria | 19572 |
| 180 | Ga0373947_0144296 | 3300035725 | Bacteria | 1529 |
| 181 | Ga0316584_0001501 | 3300036712 | Bacteria | 14046 |
| 182 | Ga0316584_0156289 | 3300036712 | Bacteria | 1696 |
| 183 | Ga0373925_0001648 | 3300037068 | Bacteria | 18821 |
| 184 | Ga0373925_0051195 | 3300037068 | Bacteria | 3082 |
| 185 | Ga0395899_0001284 | 3300037312 | Bacteria | 21770 |
| 186 | Ga0237819_00064 | 3300038705 | Bacteria | 37828 |
| 187 | Ga0237819_00081 | 3300038705 | Bacteria | 34666 |
| 188 | Ga0400490_19112 | 3300038726 | Bacteria | 8222 |
| 189 | Ga0436365_0548618 | 3300039437 | Bacteria | 38439 |
| 190 | Ga0436365_1573747 | 3300039437 | Bacteria | 26695 |
| 191 | Ga0439461_0004470 | 3300041410 | Bacteria | 2336 |
| 192 | Ga0439466_0001247 | 3300041411 | Bacteria | 9888 |
| 193 | Ga0439466_0007808 | 3300041411 | Bacteria | 4042 |
| 194 | Ga0439465_0001363 | 3300041413 | Bacteria | 7873 |
| 195 | Ga0439465_0060897 | 3300041413 | Bacteria | 1250 |
| 196 | Ga0451853_0317456 | 3300041512 | Bacteria | 6444 |
| 197 | Ga0451853_2568413 | 3300041512 | Bacteria | 2232 |
| 198 | Ga0439431_0001303 | 3300041997 | Bacteria | 5481 |
| 199 | Ga0439442_012830 | 3300042002 | Bacteria | 1715 |
| 200 | Ga0439445_0025219 | 3300042004 | Bacteria | 1515 |
| 201 | Ga0439457_000045 | 3300042014 | Bacteria | 26189 |
| 202 | Ga0439434_0008474 | 3300042435 | Bacteria | 3015 |
| 203 | Ga0466969_0028280 | 3300044656 | Bacteria | 2866 |
| 204 | Ga0466972_0024195 | 3300044658 | Bacteria | 3014 |
| 205 | Ga0466972_0044668 | 3300044658 | Bacteria | 2148 |
| 206 | Ga0466972_0055574 | 3300044658 | Bacteria | 1904 |
| 207 | Ga0466965_0000004 | 3300044683 | Bacteria | 229348 |
| 208 | Ga0466965_0003174 | 3300044683 | Bacteria | 7178 |
| 209 | Ga0466965_0012333 | 3300044683 | Bacteria | 4018 |
| 210 | Ga0466965_0041924 | 3300044683 | Bacteria | 2256 |
| 211 | Ga0466961_0017207 | 3300044693 | Bacteria | 4644 |
| 212 | Ga0466961_0066711 | 3300044693 | Bacteria | 2285 |
| 213 | Ga0453684_0393660 | 3300044712 | Bacteria | 1553 |
| 214 | Ga0466971_0011020 | 3300044719 | Bacteria | 3957 |
| 215 | Ga0466971_0025406 | 3300044719 | Bacteria | 2645 |
| 216 | Ga0466968_0001279 | 3300044735 | Bacteria | 8960 |
| 217 | Ga0466970_0008305 | 3300044765 | Bacteria | 5222 |
| 218 | Ga0466957_0008721 | 3300044842 | Bacteria | 5774 |
| 219 | Ga0466960_0002334 | 3300044901 | Bacteria | 7129 |
| 220 | Ga0466959_0004098 | 3300045049 | Bacteria | 9706 |
| 221 | Ga0466959_0020016 | 3300045049 | Bacteria | 4925 |
| 222 | Ga0451576_0001881 | 3300045051 | Bacteria | 33790 |
| 223 | Ga0466958_0016688 | 3300045836 | Bacteria | 4232 |
| 224 | Ga0466958_0098342 | 3300045836 | Bacteria | 1817 |
| 225 | Ga0466967_0063874 | 3300045976 | Bacteria | 3273 |
| 226 | Ga0466967_0282337 | 3300045976 | Bacteria | 1593 |
| 227 | Ga0495629_0019711 | 3300046459 | Bacteria | 4815 |
| 228 | Ga0495582_0051939 | 3300046473 | Bacteria | 2261 |
| 229 | Ga0495639_0099994 | 3300046475 | Bacteria | 1368 |
| 230 | Ga0495583_0038562 | 3300046506 | Bacteria | 2257 |
| 231 | Ga0495648_0009985 | 3300046524 | Bacteria | 7281 |
| 232 | Ga0495654_0029506 | 3300046530 | Bacteria | 2797 |
| 233 | Ga0495665_0023934 | 3300046531 | Bacteria | 3281 |
| 234 | Ga0495640_0062926 | 3300046533 | Bacteria | 2515 |
| 235 | Ga0495586_0089631 | 3300046535 | Bacteria | 1698 |
| 236 | Ga0495668_0009708 | 3300046616 | Bacteria | 5881 |
| 237 | Ga0495611_0069008 | 3300046648 | Bacteria | 1614 |
| 238 | Ga0495658_0010966 | 3300046683 | Bacteria | 4544 |
| 239 | Ga0495581_0098732 | 3300047315 | Bacteria | 1696 |
| 240 | Ga0495676_0157182 | 3300047321 | Bacteria | 1612 |
| 241 | Ga0495683_0000181 | 3300047323 | Bacteria | 61963 |
| 242 | Ga0495673_0004409 | 3300047469 | Bacteria | 8811 |
| 243 | Ga0495686_0060563 | 3300047472 | Bacteria | 2353 |
| 244 | Ga0495593_0021032 | 3300047673 | Bacteria | 3648 |
| 245 | Ga0496101_0000075 | 3300048904 | Bacteria | 112785 |
| 246 | Ga0496101_0035064 | 3300048904 | Bacteria | 3548 |
| 247 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 248 | Ga0496102_0000050 | 3300048905 | Bacteria | 179469 |
| 249 | Ga0496102_0003725 | 3300048905 | Bacteria | 12884 |
| 250 | Ga0496102_0024044 | 3300048905 | Bacteria | 5416 |
| 251 | Ga0496102_0072788 | 3300048905 | Bacteria | 3159 |
| 252 | Ga0496102_0103023 | 3300048905 | Bacteria | 2654 |
| 253 | Ga0496103_0000014 | 3300048906 | Bacteria | 290397 |
| 254 | Ga0496103_0000738 | 3300048906 | Bacteria | 24107 |
| 255 | Ga0496103_0101109 | 3300048906 | Bacteria | 1825 |
| 256 | Ga0496103_0109237 | 3300048906 | Bacteria | 1756 |
| 257 | Ga0496104_0009931 | 3300048907 | Bacteria | 8498 |
| 258 | Ga0496104_0030595 | 3300048907 | Bacteria | 5003 |
| 259 | Ga0496105_0035862 | 3300048908 | Bacteria | 4084 |
| 260 | Ga0496105_0036313 | 3300048908 | Bacteria | 4059 |
| 261 | Ga0496106_0142069 | 3300048909 | Bacteria | 1889 |
| 262 | Ga0496108_0011814 | 3300048911 | Bacteria | 7104 |
| 263 | Ga0496108_0023708 | 3300048911 | Bacteria | 5050 |
| 264 | Ga0496108_0090651 | 3300048911 | Bacteria | 2599 |
| 265 | Ga0496109_0002876 | 3300048912 | Bacteria | 14406 |
| 266 | Ga0496110_0004750 | 3300048913 | Bacteria | 10579 |
| 267 | Ga0496110_0015955 | 3300048913 | Bacteria | 6264 |
| 268 | Ga0496111_0024841 | 3300048914 | Bacteria | 4226 |
| 269 | Ga0496111_0051230 | 3300048914 | Bacteria | 2980 |
| 270 | Ga0496111_0064191 | 3300048914 | Bacteria | 2664 |
| 271 | Ga0496111_0087491 | 3300048914 | Bacteria | 2280 |
| 272 | Ga0496112_0008930 | 3300048915 | Bacteria | 8997 |
| 273 | Ga0496112_0045933 | 3300048915 | Bacteria | 4281 |
| 274 | Ga0496112_0064468 | 3300048915 | Bacteria | 3615 |
| 275 | Ga0496112_0081905 | 3300048915 | Bacteria | 3192 |
| 276 | Ga0496112_0149674 | 3300048915 | Bacteria | 2301 |
| 277 | Ga0496113_0008581 | 3300048916 | Bacteria | 6666 |
| 278 | Ga0496113_0013096 | 3300048916 | Bacteria | 5602 |
| 279 | Ga0496113_0033072 | 3300048916 | Bacteria | 3762 |
| 280 | Ga0496113_0097378 | 3300048916 | Bacteria | 2276 |
| 281 | Ga0496113_0108057 | 3300048916 | Bacteria | 2162 |
| 282 | Ga0496116_0000040 | 3300048919 | Bacteria | 346900 |
| 283 | Ga0496116_0014608 | 3300048919 | Bacteria | 6259 |
| 284 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 285 | Ga0496117_0000014 | 3300048920 | Bacteria | 584427 |
| 286 | Ga0496117_0002221 | 3300048920 | Bacteria | 25126 |
| 287 | Ga0496117_0006545 | 3300048920 | Bacteria | 11728 |
| 288 | Ga0496117_0108289 | 3300048920 | Bacteria | 1738 |
| 289 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 290 | Ga0496118_0001032 | 3300048921 | Bacteria | 43337 |
| 291 | Ga0496118_0009941 | 3300048921 | Bacteria | 9499 |
| 292 | Ga0496119_0000256 | 3300048922 | Bacteria | 75557 |
| 293 | Ga0496119_0000527 | 3300048922 | Bacteria | 52100 |
| 294 | Ga0496119_0005670 | 3300048922 | Bacteria | 11848 |
| 295 | Ga0496119_0021912 | 3300048922 | Bacteria | 4595 |
| 296 | Ga0496119_0033439 | 3300048922 | Bacteria | 3407 |
| 297 | Ga0496119_0105207 | 3300048922 | Bacteria | 1577 |
| 298 | Ga0496120_0000293 | 3300048923 | Bacteria | 83834 |
| 299 | Ga0496120_0003928 | 3300048923 | Bacteria | 12955 |
| 300 | Ga0496120_0006448 | 3300048923 | Bacteria | 9012 |
| 301 | Ga0496120_0022335 | 3300048923 | Bacteria | 3982 |
| 302 | Ga0496120_0049683 | 3300048923 | Bacteria | 2406 |
| 303 | Ga0496120_0071113 | 3300048923 | Bacteria | 1911 |
| 304 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 305 | Ga0496122_0000511 | 3300048925 | Bacteria | 80182 |
| 306 | Ga0496122_0009318 | 3300048925 | Bacteria | 10375 |
| 307 | Ga0496123_0000011 | 3300048926 | Bacteria | 493925 |
| 308 | Ga0496123_0002843 | 3300048926 | Bacteria | 20464 |
| 309 | Ga0496123_0023558 | 3300048926 | Bacteria | 4708 |
| 310 | Ga0496124_0001998 | 3300048927 | Bacteria | 27787 |
| 311 | Ga0496124_0013383 | 3300048927 | Bacteria | 8011 |
| 312 | Ga0496125_0019441 | 3300048928 | Bacteria | 6405 |
| 313 | Ga0496125_0033334 | 3300048928 | Bacteria | 4558 |
| 314 | Ga0496126_0001018 | 3300048929 | Bacteria | 47580 |
| 315 | Ga0496126_0001119 | 3300048929 | Bacteria | 44895 |
| 316 | Ga0496126_0001704 | 3300048929 | Bacteria | 32650 |
| 317 | Ga0496126_0002750 | 3300048929 | Bacteria | 23226 |
| 318 | Ga0496126_0005089 | 3300048929 | Bacteria | 15250 |
| 319 | Ga0496126_0007007 | 3300048929 | Bacteria | 12447 |
| 320 | Ga0496126_0025059 | 3300048929 | Bacteria | 5749 |
| 321 | Ga0501031_0113404 | 3300049568 | Bacteria | 1770 |
| 322 | Ga0501032_0047841 | 3300049569 | Bacteria | 2888 |
| 323 | Ga0501032_0059970 | 3300049569 | Bacteria | 2552 |
| 324 | Ga0501033_0007354 | 3300049570 | Bacteria | 8575 |
| 325 | Ga0501033_0020000 | 3300049570 | Bacteria | 5060 |
| 326 | Ga0501034_0027229 | 3300049571 | Bacteria | 5815 |
| 327 | Ga0501034_0075175 | 3300049571 | Bacteria | 3386 |
| 328 | Ga0501036_0013003 | 3300049572 | Bacteria | 6911 |
| 329 | Ga0501036_0033729 | 3300049572 | Bacteria | 4329 |
| 330 | Ga0501036_0112441 | 3300049572 | Bacteria | 2301 |
| 331 | Ga0501037_0000110 | 3300049573 | Bacteria | 77484 |
| 332 | Ga0501037_0027299 | 3300049573 | Bacteria | 4218 |
| 333 | Ga0501038_0002820 | 3300049574 | Bacteria | 16173 |
| 334 | Ga0501038_0013579 | 3300049574 | Bacteria | 7421 |
| 335 | Ga0501038_0098282 | 3300049574 | Bacteria | 2441 |
| 336 | Ga0501039_0000276 | 3300049575 | Bacteria | 36811 |
| 337 | Ga0501039_0015905 | 3300049575 | Bacteria | 5760 |
| 338 | Ga0501040_0012792 | 3300049576 | Bacteria | 5509 |
| 339 | Ga0501042_0057208 | 3300049578 | Bacteria | 2783 |
| 340 | Ga0501043_0000875 | 3300049579 | Bacteria | 26714 |
| 341 | Ga0501046_0007004 | 3300049580 | Bacteria | 9929 |
| 342 | Ga0501046_0077042 | 3300049580 | Bacteria | 2582 |
| 343 | Ga0501047_0053139 | 3300049581 | Bacteria | 3916 |
| 344 | Ga0501047_0231489 | 3300049581 | Bacteria | 1701 |
| 345 | Ga0501048_0041168 | 3300049582 | Bacteria | 3310 |
| 346 | Ga0501070_0002622 | 3300049586 | Bacteria | 15709 |
| 347 | Ga0501074_0186298 | 3300049590 | Bacteria | 1480 |
| 348 | Ga0501075_0060243 | 3300049591 | Bacteria | 2860 |
| 349 | Ga0501076_0062976 | 3300049592 | Bacteria | 2954 |
| 350 | Ga0501079_0031957 | 3300049741 | Bacteria | 4045 |
| 351 | Ga0501081_0103399 | 3300049743 | Bacteria | 2015 |
| 352 | Ga0501035_0023721 | 3300049822 | Bacteria | 5629 |
| 353 | Ga0501035_0033518 | 3300049822 | Bacteria | 4671 |
| 354 | Ga0501035_0153314 | 3300049822 | Bacteria | 1998 |
| 355 | Ga0501044_0012912 | 3300049823 | Bacteria | 9040 |
| 356 | Ga0501044_0019073 | 3300049823 | Bacteria | 7343 |
| 357 | Ga0501044_0056778 | 3300049823 | Bacteria | 4019 |
| 358 | Ga0501044_0215489 | 3300049823 | Bacteria | 1873 |
| 359 | nmdc:mga03683_34246_c1 | 3300050489 | Bacteria | 2054 |
| 360 | nmdc:mga03683_5716_c1 | 3300050489 | Bacteria | 4219 |
| 361 | nmdc:mga03n38_111439_c1 | 3300050490 | Bacteria | 1333 |
| 362 | nmdc:mga00v17_10886_c1 | 3300050491 | Bacteria | 4984 |
| 363 | nmdc:mga00v17_20610_c1 | 3300050491 | Bacteria | 3779 |
| 364 | nmdc:mga00v17_9653_c1 | 3300050491 | Bacteria | 5234 |
| 365 | nmdc:mga0k408_13689_c1 | 3300050493 | Bacteria | 4454 |
| 366 | nmdc:mga04h51_8675_c1 | 3300050495 | Bacteria | 2725 |
| 367 | nmdc:mga0qj67_109433_c1 | 3300050509 | Bacteria | 2230 |
| 368 | nmdc:mga0qj67_759_c1 | 3300050509 | Bacteria | 21967 |
| 369 | nmdc:mga08y16_257633_c1 | 3300050511 | Bacteria | 1802 |
| 370 | nmdc:mga0sz30_2466_c1 | 3300050516 | Bacteria | 6585 |
| 371 | Ga0500610_0008396 | 3300053079 | Bacteria | 4498 |
| 372 | Ga0500643_001858 | 3300053087 | Bacteria | 11519 |
| 373 | Ga0500643_009535 | 3300053087 | Bacteria | 3700 |
| 374 | Ga0500646_0000038 | 3300053090 | Bacteria | 37529 |
| 375 | Ga0500641_0023806 | 3300053096 | Bacteria | 2358 |
| 376 | Ga0500553_115022 | 3300053101 | Bacteria | 1122 |
| 377 | Ga0500593_000883 | 3300053117 | Bacteria | 11145 |
| 378 | Ga0500642_0004128 | 3300053130 | Bacteria | 4495 |
| 379 | Ga0500652_000187 | 3300053131 | Bacteria | 23997 |
| 380 | Ga0500568_0000717 | 3300053139 | Bacteria | 23747 |
| 381 | Ga0500573_0030000 | 3300053140 | Bacteria | 3136 |
| 382 | Ga0500616_0018233 | 3300053153 | Bacteria | 3971 |
| 383 | Ga0500622_0001496 | 3300053156 | Bacteria | 18586 |
| 384 | Ga0500622_0002335 | 3300053156 | Bacteria | 13822 |
| 385 | Ga0501084_0021275 | 3300054114 | Bacteria | 5407 |
| 386 | Ga0501082_0121342 | 3300060353 | Bacteria | 2265 |
| 387 | Ga0466962_0023328 | 3300061719 | Bacteria | 2974 |
| 388 | 2545557550 | 2545555800 | Bacteria | 4222588 |
| 389 | 2511701710 | 2511231119 | Bacteria | 4019861 |
| 390 | 2512639731 | 2512564013 | Bacteria | 6286191 |
| 391 | 2540608956 | 2540341094 | Bacteria | 4061186 |
| 392 | 2553391838 | 2551306519 | Bacteria | 5465154 |
| 393 | 2555468309 | 2554235283 | Bacteria | 3683090 |
| 394 | 2563930323 | 2563366752 | Bacteria | 4961801 |
| 395 | 2578931937 | 2576861599 | Bacteria | 4217202 |
| 396 | 2585296051 | 2582581312 | Bacteria | 7308206 |
| 397 | 2595090060 | 2593339131 | Bacteria | 5116855 |
| 398 | 2631985627 | 2630968484 | Bacteria | 3876276 |
| 399 | 2643766905 | 2643221549 | Bacteria | 4042819 |
| 400 | 2643827112 | 2643221561 | Bacteria | 4984412 |
| 401 | 2643847064 | 2643221566 | Bacteria | 3460379 |
| 402 | 2644534465 | 2643221696 | Bacteria | 5431823 |
| 403 | 2644635628 | 2643221715 | Bacteria | 6671032 |
| 404 | 2644707779 | 2643221729 | Bacteria | 6621700 |
| 405 | 2644712189 | 2643221730 | Bacteria | 6523787 |
| 406 | 2644738875 | 2643221735 | Bacteria | 3676263 |
| 407 | 2651531320 | 2648501850 | Bacteria | 3975476 |
| 408 | 2672337540 | 2671180330 | Bacteria | 5521719 |
| 409 | 2674421333 | 2671180844 | Bacteria | 4164150 |
| 410 | 2685149075 | 2684622632 | Bacteria | 5380049 |
| 411 | 2686998455 | 2684623153 | Bacteria | 3878815 |
| 412 | 2687499732 | 2687453109 | Bacteria | 3860091 |
| 413 | 2695629678 | 2695420354 | Bacteria | 3922431 |
| 414 | 2698324107 | 2695420987 | Bacteria | 6152737 |
| 415 | 2705993111 | 2703719227 | Bacteria | 5631989 |
| 416 | 2717914628 | 2716884898 | Bacteria | 3928789 |
| 417 | 2721504457 | 2718218445 | Bacteria | 5113413 |
| 418 | 2738664222 | 2738541264 | Bacteria | 5935393 |
| 419 | 2739156602 | 2738541358 | Bacteria | 5932299 |
| 420 | 2739210203 | 2738543006 | Bacteria | 5904091 |
| 421 | 2739231655 | 2738543010 | Bacteria | 5583595 |
| 422 | 2753265019 | 2751185782 | Bacteria | 11227053 |
| 423 | 2757567599 | 2757320391 | Bacteria | 4746095 |
| 424 | 2758225672 | 2757320536 | Bacteria | 3629334 |
| 425 | 2774379780 | 2773857758 | Bacteria | 3592392 |
| 426 | 2774397874 | 2773857763 | Bacteria | 4180068 |
| 427 | 2777763335 | 2775507177 | Bacteria | 4384303 |
| 428 | 2777836260 | 2775507192 | Bacteria | 4622234 |
| 429 | 2791214994 | 2788500588 | Bacteria | 4584915 |
| 430 | 2808629144 | 2808606306 | Bacteria | 3608896 |
| 431 | 2808899645 | 2808606372 | Bacteria | 4649509 |
| 432 | 2808918102 | 2808606375 | Bacteria | 9466072 |
| 433 | 2809054116 | 2808606399 | Bacteria | 4021018 |
| 434 | 2811844950 | 2808606982 | Bacteria | 7791042 |
| 435 | 2812360594 | 2811994879 | Bacteria | 9313447 |
| 436 | 2816862051 | 2816332186 | Bacteria | 5331395 |
| 437 | 2817478499 | 2816332295 | Bacteria | 4352468 |
| 438 | 2819582885 | 2818991443 | Bacteria | 6598732 |
| 439 | 2819629776 | 2818991451 | Bacteria | 4697364 |
| 440 | 2819695108 | 2818991463 | Bacteria | 7948711 |
| 441 | 2819722650 | 2818991468 | Bacteria | 3723169 |
| 442 | 2823529563 | 2823526263 | Bacteria | 3765752 |
| 443 | 2831908059 | 2831905167 | Bacteria | 3319172 |
| 444 | 2833712583 | 2833709550 | Bacteria | 4008291 |
| 445 | 2837274540 | 2837268691 | Bacteria | 7850704 |
| 446 | 2842136741 | 2842134933 | Bacteria | 5847019 |
| 447 | 2842686664 | 2842682962 | Bacteria | 5589973 |
| 448 | 2849141614 | 2849139964 | Bacteria | 5613304 |
| 449 | 2857475974 | 2857472729 | Bacteria | 6568124 |
| 450 | 2857583947 | 2857581216 | Bacteria | 5522813 |
| 451 | 2857590106 | 2857586860 | Bacteria | 4354574 |
| 452 | 2860841798 | 2860837431 | Bacteria | 4202080 |
| 453 | 2862294647 | 2862290372 | Bacteria | 7471434 |
| 454 | 2867432576 | 2867428634 | Bacteria | 9590268 |
| 455 | 2870785019 | 2870782633 | Bacteria | 9624083 |
| 456 | 2877772611 | 2877768649 | Bacteria | 3957164 |
| 457 | 2880173457 | 2880169592 | Bacteria | 3900066 |
| 458 | 2897113739 | 2897109615 | Bacteria | 4009619 |
| 459 | 2902792939 | 2902792274 | Bacteria | 7270173 |
| 460 | 2902813754 | 2902810491 | Bacteria | 6794147 |
| 461 | 2904512571 | 2904509784 | Bacteria | 3520416 |
| 462 | 2904563336 | 2904560550 | Bacteria | 4029838 |
| 463 | 2904610176 | 2904606771 | Bacteria | 4684500 |
| 464 | 2908666934 | 2908665501 | Bacteria | 3678115 |
| 465 | 2908679188 | 2908678064 | Bacteria | 3482747 |
| 466 | 2915600876 | 2915597211 | Bacteria | 6475886 |
| 467 | 2916976288 | 2916971899 | Bacteria | 4250608 |
| 468 | 2919069830 | 2919069694 | Bacteria | 3622919 |
| 469 | 2919095052 | 2919093281 | Bacteria | 3660974 |
| 470 | 2919397251 | 2919395869 | Bacteria | 3704152 |
| 471 | 2919414250 | 2919414237 | Bacteria | 5429133 |
| 472 | 2919444438 | 2919443155 | Bacteria | 4072969 |
| 473 | 2919727627 | 2919726948 | Bacteria | 3696050 |
| 474 | 2929186014 | 2929183550 | Bacteria | 6377511 |
| 475 | 2929234346 | 2929233124 | Bacteria | 5948380 |
| 476 | 2936345508 | 2936340661 | Bacteria | 5139038 |
| 477 | 2938918517 | 2938917290 | Bacteria | 5914775 |
| 478 | 2939586659 | 2939582691 | Bacteria | 7088898 |
| 479 | 2939598012 | 2939593269 | Bacteria | 4798695 |
| 480 | 2947427860 | 2947426588 | Bacteria | 5357194 |
| 481 | 2954776898 | 2954773129 | Bacteria | 3741715 |
| 482 | 2956902288 | 2956897341 | Bacteria | 5447711 |
| 483 | 2956902459 | 2956897341 | Bacteria | 5447711 |
| 484 | 2962295050 | 2962290636 | Bacteria | 4072939 |
| 485 | 2965762366 | 2965761152 | Bacteria | 5806513 |
| 486 | 2969140933 | 2969136845 | Bacteria | 3923176 |
| 487 | 2969145186 | 2969141011 | Bacteria | 4118468 |
| 488 | 2969766070 | 2969765954 | Bacteria | 4216713 |
| 489 | 2969770573 | 2969770375 | Bacteria | 4271280 |
| 490 | 2971897313 | 2971893375 | Bacteria | 3929648 |
| 491 | 2974296003 | 2974294766 | Bacteria | 3767688 |
| 492 | 2974327731 | 2974324384 | Bacteria | 3750535 |
| 493 | 2977229389 | 2977228692 | Bacteria | 3450105 |
| 494 | 2977238567 | 2977236895 | Bacteria | 3569373 |
| 495 | 2977264589 | 2977264416 | Bacteria | 3750737 |
| 496 | 2979084776 | 2979083700 | Bacteria | 5894929 |
| 497 | 2980130785 | 2980125574 | Bacteria | 5567337 |
| 498 | 2980496782 | 2980492589 | Bacteria | 4072961 |
| 499 | 2984543651 | 2984542743 | Bacteria | 3569378 |
| 500 | 2984579088 | 2984576629 | Bacteria | 4248407 |
| 501 | 2990260018 | 2990256926 | Bacteria | 4252839 |
| 502 | 2990276892 | 2990275345 | Bacteria | 4887158 |
| 503 | 3001268959 | 3001267043 | Bacteria | 4823521 |
| 504 | 3001274396 | 3001272096 | Bacteria | 4729684 |
| 505 | 3006858821 | 3006858327 | Bacteria | 4317835 |
| 506 | 3006883475 | 3006879489 | Bacteria | 4064221 |
| 507 | 3006971639 | 3006969106 | Bacteria | 4739423 |
| 508 | 3006976438 | 3006973921 | Bacteria | 4423788 |
| 509 | 3006987133 | 3006984091 | Bacteria | 4207523 |
| 510 | 3006993046 | 3006988479 | Bacteria | 4767936 |
| 511 | 8022622291 | 8022621104 | Bacteria | 5241040 |
| 512 | 8022632828 | 8022630665 | Bacteria | 3886130 |
| 513 | 8022656617 | 8022653035 | Bacteria | 4035078 |
| 514 | 8022793462 | 8022792930 | Bacteria | 5693794 |
| 515 | 8022953202 | 8022948649 | Bacteria | 5366783 |
| 516 | 8023443330 | 8023438354 | Bacteria | 5779374 |
| 517 | 8023449366 | 8023444577 | Bacteria | 5661597 |
| 518 | 8025482312 | 8025478263 | Bacteria | 8209203 |
| 519 | 8045833610 | 8045830549 | Bacteria | 4444727 |
| 520 | 8046354826 | 8046352972 | Bacteria | 3613806 |
| 521 | 8051953776 | 8051952484 | Bacteria | 3926774 |
| 522 | 8052178024 | 8052174270 | Bacteria | 3881265 |
| 523 | 8054284014 | 8054280661 | Bacteria | 4232245 |
| 524 | 8055536093 | 8055531788 | Bacteria | 5249694 |
| 525 | 8057583855 | 8057582654 | Bacteria | 5218944 |
| 526 | JGI25159J45721_1007547 | |||
| 527 | JGI25151J46595_10000011 | |||
| 528 | JGI25151J46595_10004537 | |||
| 529 | JGI25151J46595_10006351 | |||
| 530 | JGI25151J46595_10014009 | |||
| 531 | JGI25151J46595_10016140 | |||
| 532 | JGI25151J46595_10017178 | |||
| 533 | Ga0006562J51391_1000095 | |||
| 534 | Ga0006562J51391_1071400 | |||
| 535 | Ga0055532_1000024 | |||
| 536 | Ga0065704_10089489 | |||
| 537 | Ga0065707_10128256 | |||
| 538 | Ga0070658_10011701 | |||
| 539 | Ga0070683_100000938 | |||
| 540 | Ga0070683_100366606 | |||
| 541 | Ga0070670_100190230 | |||
| 542 | Ga0070682_100004788 | |||
| 543 | Ga0070669_100000944 | |||
| 544 | Ga0070671_100002004 | |||
| 545 | Ga0070667_100000182 | |||
| 546 | Ga0070667_100002503 | |||
| 547 | Ga0070710_10000261 | |||
| 548 | Ga0070663_100069351 | |||
| 549 | Ga0070678_100147305 | |||
| 550 | Ga0070662_100005256 | |||
| 551 | Ga0070681_10130384 | |||
| 552 | Ga0068867_100046951 | |||
| 553 | Ga0070679_100044651 | |||
| 554 | Ga0070684_100050198 | |||
| 555 | Ga0070665_100008095 | |||
| 556 | Ga0070665_100179842 | |||
| 557 | Ga0068855_100060699 | |||
| 558 | Ga0068857_100243089 | |||
| 559 | Ga0068859_100008871 | |||
| 560 | Ga0068864_100017142 | |||
| 561 | Ga0068864_100055669 | |||
| 562 | Ga0068863_100012289 | |||
| 563 | Ga0068863_100014842 | |||
| 564 | Ga0068863_100120243 | |||
| 565 | Ga0068863_100359281 | |||
| 566 | Ga0068858_100039330 | |||
| 567 | Ga0068860_100000374 | |||
| 568 | Ga0068862_100000276 | |||
| 569 | Ga0068862_100090833 | |||
| 570 | Ga0081455_10017303 | |||
| 571 | Ga0075365_10033973 | |||
| 572 | Ga0075363_100001303 | |||
| 573 | Ga0075363_100028896 | |||
| 574 | Ga0075363_100046547 | |||
| 575 | Ga0075364_10011450 | |||
| 576 | Ga0075364_10023675 | |||
| 577 | Ga0075364_10027707 | |||
| 578 | Ga0075364_10031848 | |||
| 579 | Ga0075367_10003453 | |||
| 580 | Ga0075369_10020487 | |||
| 581 | Ga0075369_10021759 | |||
| 582 | Ga0075370_10002037 | |||
| 583 | Ga0075370_10003960 | |||
| 584 | Ga0075370_10004873 | |||
| 585 | Ga0075428_100001829 | |||
| 586 | Ga0075428_100025039 | |||
| 587 | Ga0075430_100001544 | |||
| 588 | Ga0075430_100055026 | |||
| 589 | Ga0075431_100033580 | |||
| 590 | Ga0097620_100008871 | |||
| 591 | Ga0105244_10000719 | |||
| 592 | Ga0105244_10020287 | |||
| 593 | Ga0105250_10005754 | |||
| 594 | Ga0105250_10027675 | |||
| 595 | Ga0111539_10137635 | |||
| 596 | Ga0105245_10036363 | |||
| 597 | Ga0105247_10000181 | |||
| 598 | Ga0105243_10165400 | |||
| 599 | Ga0105243_10235964 | |||
| 600 | Ga0105248_10000652 | |||
| 601 | Ga0105248_10004546 | |||
| 602 | Ga0105237_10003090 | |||
| 603 | Ga0105237_10057184 | |||
| 604 | Ga0105249_10000022 | |||
| 605 | Ga0105239_10001222 | |||
| 606 | Ga0105239_10030709 | |||
| 607 | Ga0105246_10012025 | |||
| 608 | Ga0157369_10271441 | |||
| 609 | Ga0163162_10035949 | |||
| 610 | Ga0163162_10060900 | |||
| 611 | Ga0157372_10012226 | |||
| 612 | Ga0157372_10104317 | |||
| 613 | Ga0157375_10077481 | |||
| 614 | Ga0157375_10103532 | |||
| 615 | Ga0157375_10259032 | |||
| 616 | Ga0157375_10354984 | |||
| 617 | Ga0163163_10072568 | |||
| 618 | Ga0163163_10098763 | |||
| 619 | Ga0163163_10176172 | |||
| 620 | Ga0157380_10006402 | |||
| 621 | Ga0213876_10021932 | |||
| 622 | Ga0209784_100061 | |||
| 623 | Ga0209147_100020 | |||
| 624 | Ga0209130_1000311 | |||
| 625 | Ga0209130_1006242 | |||
| 626 | Ga0209130_1006505 | |||
| 627 | Ga0209675_1012279 | |||
| 628 | Ga0209676_1000274 | |||
| 629 | Ga0209676_1000808 | |||
| 630 | Ga0209025_1000011 | |||
| 631 | Ga0209025_1000043 | |||
| 632 | Ga0209025_1000209 | |||
| 633 | Ga0209025_1000851 | |||
| 634 | Ga0209025_1001029 | |||
| 635 | Ga0209025_1002458 | |||
| 636 | Ga0209025_1003417 | |||
| 637 | Ga0209025_1006279 | |||
| 638 | Ga0209025_1006597 | |||
| 639 | Ga0209025_1016765 | |||
| 640 | Ga0209025_1024252 | |||
| 641 | Ga0209025_1028312 | |||
| 642 | Ga0207696_1005618 | |||
| 643 | Ga0207696_1021684 | |||
| 644 | Ga0207655_1000184 | |||
| 645 | Ga0207655_1002232 | |||
| 646 | Ga0207710_10000091 | |||
| 647 | Ga0207705_10022680 | |||
| 648 | Ga0207707_10067445 | |||
| 649 | Ga0207671_10055321 | |||
| 650 | Ga0207657_10209240 | |||
| 651 | Ga0207652_10013343 | |||
| 652 | Ga0207652_10065539 | |||
| 653 | Ga0207681_10001711 | |||
| 654 | Ga0207650_10163320 | |||
| 655 | Ga0207644_10005495 | |||
| 656 | Ga0207691_10176525 | |||
| 657 | Ga0207711_10000713 | |||
| 658 | Ga0207661_10003990 | |||
| 659 | Ga0207667_10100355 | |||
| 660 | Ga0207712_10000005 | |||
| 661 | Ga0207658_10000316 | |||
| 662 | Ga0207677_10108471 | |||
| 663 | Ga0207641_10003321 | |||
| 664 | Ga0207641_10011331 | |||
| 665 | Ga0207641_10329744 | |||
| 666 | Ga0207674_10037704 | |||
| 667 | Ga0207674_10215566 | |||
| 668 | Ga0207675_100056433 | |||
| 669 | Ga0207683_10232652 | |||
| 670 | Ga0207698_10040157 | |||
| 671 | Ga0209813_10023746 | |||
| 672 | Ga0268266_10004670 | |||
| 673 | Ga0268266_10020334 | |||
| 674 | Ga0268265_10000005 | |||
| 675 | Ga0268264_10000005 | |||
| 676 | Ga0307517_10071568 | |||
| 677 | Ga0307517_10160254 | |||
| 678 | Ga0307515_10036058 | |||
| 679 | Ga0307515_10065813 | |||
| 680 | Ga0307515_10106730 | |||
| 681 | Ga0237817_10012 | |||
| 682 | Ga0237817_10068 | |||
| 683 | Ga0307511_10013821 | |||
| 684 | Ga0307512_10005567 | |||
| 685 | Ga0265327_10000532 | |||
| 686 | Ga0265327_10003586 | |||
| 687 | Ga0307513_10067180 | |||
| 688 | Ga0307509_10049617 | |||
| 689 | Ga0265342_10008744 | |||
| 690 | Ga0316576_10029907 | |||
| 691 | Ga0316576_10039988 | |||
| 692 | Ga0307516_10002975 | |||
| 693 | Ga0307413_10037452 | |||
| 694 | Ga0307413_10090069 | |||
| 695 | Ga0307410_10245949 | |||
| 696 | Ga0307411_10122509 | |||
| 697 | Ga0307415_100078701 | |||
| 698 | Ga0307507_10106290 | |||
| 699 | Ga0307510_10206167 | |||
| 700 | Ga0373926_0052234 | |||
| 701 | Ga0373951_0000316 | |||
| 702 | Ga0373945_0047835 | |||
| 703 | Ga0373927_0000524 | |||
| 704 | Ga0373947_0000741 | |||
| 705 | Ga0373947_0144296 | |||
| 706 | Ga0316584_0001501 | |||
| 707 | Ga0316584_0156289 | |||
| 708 | Ga0373925_0001648 | |||
| 709 | Ga0373925_0051195 | |||
| 710 | Ga0395899_0001284 | |||
| 711 | Ga0237819_00064 | |||
| 712 | Ga0237819_00081 | |||
| 713 | Ga0400490_19112 | |||
| 714 | Ga0436365_0548618 | |||
| 715 | Ga0436365_1573747 | |||
| 716 | Ga0439461_0004470 | |||
| 717 | Ga0439466_0001247 | |||
| 718 | Ga0439466_0007808 | |||
| 719 | Ga0439465_0001363 | |||
| 720 | Ga0439465_0060897 | |||
| 721 | Ga0451853_0317456 | |||
| 722 | Ga0451853_2568413 | |||
| 723 | Ga0439431_0001303 | |||
| 724 | Ga0439442_012830 | |||
| 725 | Ga0439445_0025219 | |||
| 726 | Ga0439457_000045 | |||
| 727 | Ga0439434_0008474 | |||
| 728 | Ga0466969_0028280 | |||
| 729 | Ga0466972_0024195 | |||
| 730 | Ga0466972_0044668 | |||
| 731 | Ga0466972_0055574 | |||
| 732 | Ga0466965_0000004 | |||
| 733 | Ga0466965_0003174 | |||
| 734 | Ga0466965_0012333 | |||
| 735 | Ga0466965_0041924 | |||
| 736 | Ga0466961_0017207 | |||
| 737 | Ga0466961_0066711 | |||
| 738 | Ga0453684_0393660 | |||
| 739 | Ga0466971_0011020 | |||
| 740 | Ga0466971_0025406 | |||
| 741 | Ga0466968_0001279 | |||
| 742 | Ga0466970_0008305 | |||
| 743 | Ga0466957_0008721 | |||
| 744 | Ga0466960_0002334 | |||
| 745 | Ga0466959_0004098 | |||
| 746 | Ga0466959_0020016 | |||
| 747 | Ga0451576_0001881 | |||
| 748 | Ga0466958_0016688 | |||
| 749 | Ga0466958_0098342 | |||
| 750 | Ga0466967_0063874 | |||
| 751 | Ga0466967_0282337 | |||
| 752 | Ga0495629_0019711 | |||
| 753 | Ga0495582_0051939 | |||
| 754 | Ga0495639_0099994 | |||
| 755 | Ga0495583_0038562 | |||
| 756 | Ga0495648_0009985 | |||
| 757 | Ga0495654_0029506 | |||
| 758 | Ga0495665_0023934 | |||
| 759 | Ga0495640_0062926 | |||
| 760 | Ga0495586_0089631 | |||
| 761 | Ga0495668_0009708 | |||
| 762 | Ga0495611_0069008 | |||
| 763 | Ga0495658_0010966 | |||
| 764 | Ga0495581_0098732 | |||
| 765 | Ga0495676_0157182 | |||
| 766 | Ga0495683_0000181 | |||
| 767 | Ga0495673_0004409 | |||
| 768 | Ga0495686_0060563 | |||
| 769 | Ga0495593_0021032 | |||
| 770 | Ga0496101_0000075 | |||
| 771 | Ga0496101_0035064 | |||
| 772 | Ga0496102_0000003 | |||
| 773 | Ga0496102_0000050 | |||
| 774 | Ga0496102_0003725 | |||
| 775 | Ga0496102_0024044 | |||
| 776 | Ga0496102_0072788 | |||
| 777 | Ga0496102_0103023 | |||
| 778 | Ga0496103_0000014 | |||
| 779 | Ga0496103_0000738 | |||
| 780 | Ga0496103_0101109 | |||
| 781 | Ga0496103_0109237 | |||
| 782 | Ga0496104_0009931 | |||
| 783 | Ga0496104_0030595 | |||
| 784 | Ga0496105_0035862 | |||
| 785 | Ga0496105_0036313 | |||
| 786 | Ga0496106_0142069 | |||
| 787 | Ga0496108_0011814 | |||
| 788 | Ga0496108_0023708 | |||
| 789 | Ga0496108_0090651 | |||
| 790 | Ga0496109_0002876 | |||
| 791 | Ga0496110_0004750 | |||
| 792 | Ga0496110_0015955 | |||
| 793 | Ga0496111_0024841 | |||
| 794 | Ga0496111_0051230 | |||
| 795 | Ga0496111_0064191 | |||
| 796 | Ga0496111_0087491 | |||
| 797 | Ga0496112_0008930 | |||
| 798 | Ga0496112_0045933 | |||
| 799 | Ga0496112_0064468 | |||
| 800 | Ga0496112_0081905 | |||
| 801 | Ga0496112_0149674 | |||
| 802 | Ga0496113_0008581 | |||
| 803 | Ga0496113_0013096 | |||
| 804 | Ga0496113_0033072 | |||
| 805 | Ga0496113_0097378 | |||
| 806 | Ga0496113_0108057 | |||
| 807 | Ga0496116_0000040 | |||
| 808 | Ga0496116_0014608 | |||
| 809 | Ga0496117_0000003 | |||
| 810 | Ga0496117_0000014 | |||
| 811 | Ga0496117_0002221 | |||
| 812 | Ga0496117_0006545 | |||
| 813 | Ga0496117_0108289 | |||
| 814 | Ga0496118_0000001 | |||
| 815 | Ga0496118_0001032 | |||
| 816 | Ga0496118_0009941 | |||
| 817 | Ga0496119_0000256 | |||
| 818 | Ga0496119_0000527 | |||
| 819 | Ga0496119_0005670 | |||
| 820 | Ga0496119_0021912 | |||
| 821 | Ga0496119_0033439 | |||
| 822 | Ga0496119_0105207 | |||
| 823 | Ga0496120_0000293 | |||
| 824 | Ga0496120_0003928 | |||
| 825 | Ga0496120_0006448 | |||
| 826 | Ga0496120_0022335 | |||
| 827 | Ga0496120_0049683 | |||
| 828 | Ga0496120_0071113 | |||
| 829 | Ga0496121_0000019 | |||
| 830 | Ga0496122_0000511 | |||
| 831 | Ga0496122_0009318 | |||
| 832 | Ga0496123_0000011 | |||
| 833 | Ga0496123_0002843 | |||
| 834 | Ga0496123_0023558 | |||
| 835 | Ga0496124_0001998 | |||
| 836 | Ga0496124_0013383 | |||
| 837 | Ga0496125_0019441 | |||
| 838 | Ga0496125_0033334 | |||
| 839 | Ga0496126_0001018 | |||
| 840 | Ga0496126_0001119 | |||
| 841 | Ga0496126_0001704 | |||
| 842 | Ga0496126_0002750 | |||
| 843 | Ga0496126_0005089 | |||
| 844 | Ga0496126_0007007 | |||
| 845 | Ga0496126_0025059 | |||
| 846 | Ga0501031_0113404 | |||
| 847 | Ga0501032_0047841 | |||
| 848 | Ga0501032_0059970 | |||
| 849 | Ga0501033_0007354 | |||
| 850 | Ga0501033_0020000 | |||
| 851 | Ga0501034_0027229 | |||
| 852 | Ga0501034_0075175 | |||
| 853 | Ga0501036_0013003 | |||
| 854 | Ga0501036_0033729 | |||
| 855 | Ga0501036_0112441 | |||
| 856 | Ga0501037_0000110 | |||
| 857 | Ga0501037_0027299 | |||
| 858 | Ga0501038_0002820 | |||
| 859 | Ga0501038_0013579 | |||
| 860 | Ga0501038_0098282 | |||
| 861 | Ga0501039_0000276 | |||
| 862 | Ga0501039_0015905 | |||
| 863 | Ga0501040_0012792 | |||
| 864 | Ga0501042_0057208 | |||
| 865 | Ga0501043_0000875 | |||
| 866 | Ga0501046_0007004 | |||
| 867 | Ga0501046_0077042 | |||
| 868 | Ga0501047_0053139 | |||
| 869 | Ga0501047_0231489 | |||
| 870 | Ga0501048_0041168 | |||
| 871 | Ga0501070_0002622 | |||
| 872 | Ga0501074_0186298 | |||
| 873 | Ga0501075_0060243 | |||
| 874 | Ga0501076_0062976 | |||
| 875 | Ga0501079_0031957 | |||
| 876 | Ga0501081_0103399 | |||
| 877 | Ga0501035_0023721 | |||
| 878 | Ga0501035_0033518 | |||
| 879 | Ga0501035_0153314 | |||
| 880 | Ga0501044_0012912 | |||
| 881 | Ga0501044_0019073 | |||
| 882 | Ga0501044_0056778 | |||
| 883 | Ga0501044_0215489 | |||
| 884 | nmdc:mga03683_34246_c1 | |||
| 885 | nmdc:mga03683_5716_c1 | |||
| 886 | nmdc:mga03n38_111439_c1 | |||
| 887 | nmdc:mga00v17_10886_c1 | |||
| 888 | nmdc:mga00v17_20610_c1 | |||
| 889 | nmdc:mga00v17_9653_c1 | |||
| 890 | nmdc:mga0k408_13689_c1 | |||
| 891 | nmdc:mga04h51_8675_c1 | |||
| 892 | nmdc:mga0qj67_109433_c1 | |||
| 893 | nmdc:mga0qj67_759_c1 | |||
| 894 | nmdc:mga08y16_257633_c1 | |||
| 895 | nmdc:mga0sz30_2466_c1 | |||
| 896 | Ga0500610_0008396 | |||
| 897 | Ga0500643_001858 | |||
| 898 | Ga0500643_009535 | |||
| 899 | Ga0500646_0000038 | |||
| 900 | Ga0500641_0023806 | |||
| 901 | Ga0500553_115022 | |||
| 902 | Ga0500593_000883 | |||
| 903 | Ga0500642_0004128 | |||
| 904 | Ga0500652_000187 | |||
| 905 | Ga0500568_0000717 | |||
| 906 | Ga0500573_0030000 | |||
| 907 | Ga0500616_0018233 | |||
| 908 | Ga0500622_0001496 | |||
| 909 | Ga0500622_0002335 | |||
| 910 | Ga0501084_0021275 | |||
| 911 | Ga0501082_0121342 | |||
| 912 | Ga0466962_0023328 | |||
| 913 | 2545557550 | |||
| 914 | 2511701710 | |||
| 915 | 2512639731 | |||
| 916 | 2540608956 | |||
| 917 | 2553391838 | |||
| 918 | 2555468309 | |||
| 919 | 2563930323 | |||
| 920 | 2578931937 | |||
| 921 | 2585296051 | |||
| 922 | 2595090060 | |||
| 923 | 2631985627 | |||
| 924 | 2643766905 | |||
| 925 | 2643827112 | |||
| 926 | 2643847064 | |||
| 927 | 2644534465 | |||
| 928 | 2644635628 | |||
| 929 | 2644707779 | |||
| 930 | 2644712189 | |||
| 931 | 2644738875 | |||
| 932 | 2651531320 | |||
| 933 | 2672337540 | |||
| 934 | 2674421333 | |||
| 935 | 2685149075 | |||
| 936 | 2686998455 | |||
| 937 | 2687499732 | |||
| 938 | 2695629678 | |||
| 939 | 2698324107 | |||
| 940 | 2705993111 | |||
| 941 | 2717914628 | |||
| 942 | 2721504457 | |||
| 943 | 2738664222 | |||
| 944 | 2739156602 | |||
| 945 | 2739210203 | |||
| 946 | 2739231655 | |||
| 947 | 2753265019 | |||
| 948 | 2757567599 | |||
| 949 | 2758225672 | |||
| 950 | 2774379780 | |||
| 951 | 2774397874 | |||
| 952 | 2777763335 | |||
| 953 | 2777836260 | |||
| 954 | 2791214994 | |||
| 955 | 2808629144 | |||
| 956 | 2808899645 | |||
| 957 | 2808918102 | |||
| 958 | 2809054116 | |||
| 959 | 2811844950 | |||
| 960 | 2812360594 | |||
| 961 | 2816862051 | |||
| 962 | 2817478499 | |||
| 963 | 2819582885 | |||
| 964 | 2819629776 | |||
| 965 | 2819695108 | |||
| 966 | 2819722650 | |||
| 967 | 2823529563 | |||
| 968 | 2831908059 | |||
| 969 | 2833712583 | |||
| 970 | 2837274540 | |||
| 971 | 2842136741 | |||
| 972 | 2842686664 | |||
| 973 | 2849141614 | |||
| 974 | 2857475974 | |||
| 975 | 2857583947 | |||
| 976 | 2857590106 | |||
| 977 | 2860841798 | |||
| 978 | 2862294647 | |||
| 979 | 2867432576 | |||
| 980 | 2870785019 | |||
| 981 | 2877772611 | |||
| 982 | 2880173457 | |||
| 983 | 2897113739 | |||
| 984 | 2902792939 | |||
| 985 | 2902813754 | |||
| 986 | 2904512571 | |||
| 987 | 2904563336 | |||
| 988 | 2904610176 | |||
| 989 | 2908666934 | |||
| 990 | 2908679188 | |||
| 991 | 2915600876 | |||
| 992 | 2916976288 | |||
| 993 | 2919069830 | |||
| 994 | 2919095052 | |||
| 995 | 2919397251 | |||
| 996 | 2919414250 | |||
| 997 | 2919444438 | |||
| 998 | 2919727627 | |||
| 999 | 2929186014 | |||
| 1000 | 2929234346 | |||
| 1001 | 2936345508 | |||
| 1002 | 2938918517 | |||
| 1003 | 2939586659 | |||
| 1004 | 2939598012 | |||
| 1005 | 2947427860 | |||
| 1006 | 2954776898 | |||
| 1007 | 2956902288 | |||
| 1008 | 2956902459 | |||
| 1009 | 2962295050 | |||
| 1010 | 2965762366 | |||
| 1011 | 2969140933 | |||
| 1012 | 2969145186 | |||
| 1013 | 2969766070 | |||
| 1014 | 2969770573 | |||
| 1015 | 2971897313 | |||
| 1016 | 2974296003 | |||
| 1017 | 2974327731 | |||
| 1018 | 2977229389 | |||
| 1019 | 2977238567 | |||
| 1020 | 2977264589 | |||
| 1021 | 2979084776 | |||
| 1022 | 2980130785 | |||
| 1023 | 2980496782 | |||
| 1024 | 2984543651 | |||
| 1025 | 2984579088 | |||
| 1026 | 2990260018 | |||
| 1027 | 2990276892 | |||
| 1028 | 3001268959 | |||
| 1029 | 3001274396 | |||
| 1030 | 3006858821 | |||
| 1031 | 3006883475 | |||
| 1032 | 3006971639 | |||
| 1033 | 3006976438 | |||
| 1034 | 3006987133 | |||
| 1035 | 3006993046 | |||
| 1036 | 8022622291 | |||
| 1037 | 8022632828 | |||
| 1038 | 8022656617 | |||
| 1039 | 8022793462 | |||
| 1040 | 8022953202 | |||
| 1041 | 8023443330 | |||
| 1042 | 8023449366 | |||
| 1043 | 8025482312 | |||
| 1044 | 8045833610 | |||
| 1045 | 8046354826 | |||
| 1046 | 8051953776 | |||
| 1047 | 8052178024 | |||
| 1048 | 8054284014 | |||
| 1049 | 8055536093 | |||
| 1050 | 8057583855 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ruy-assembly1.cif.gz_B | crystal structure of the ornithine-oxo acid transaminase rocd from bacillus anthracis | 0.9877 | 6 | 396 |
| 7lk1-assembly1.cif.gz_A | ornithine aminotransferase (oat) with its potent inhibitor - (s)-3-amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) - 1 hour soaking | 0.9847 | 1 | 395 |
| 2byj-assembly2.cif.gz_C-2 | ornithine aminotransferase mutant y85i | 0.9847 | 1 | 395 |
| 2byl-assembly2.cif.gz_C-2 | structure of ornithine aminotransferase triple mutant y85i y55a g320f | 0.9838 | 2 | 395 |
| 3ruy-assembly1.cif.gz_B | crystal structure of the ornithine-oxo acid transaminase rocd from bacillus anthracis | 0.9827 | 6 | 396 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1H3_305_391_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9904 | 310 | 393 | 3.90.1150.10 |
| af_Q54JP5_319_410_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9793 | 308 | 393 | 3.90.1150.10 |
| af_Q18040_325_412_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9721 | 308 | 391 | 3.90.1150.10 |
| 3ruyB01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9717 | 6 | 396 | 3.90.1150.10 |
| af_Q6LFH8_318_406_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9702 | 312 | 393 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6URK6-F1-model_v4 | Ornithine aminotransferase (OAT) (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) | 0.9912 | 1 | 396 |
GO:0004587
GO:0005737 GO:0030170 GO:0042802 GO:0055129 |
| AF-A0A4P6URK6-F1-model_v4 | Ornithine aminotransferase (OAT) (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) | 0.9887 | 1 | 396 |
GO:0004587
GO:0005737 GO:0030170 GO:0042802 GO:0055129 |
| AF-G8NSV4-F1-model_v4 | ornithine aminotransferase (EC 2.6.1.13) (Ornithine--oxo-acid aminotransferase) | 0.9883 | 4 | 395 |
GO:0004587
GO:0030170 GO:0042802 GO:0055129 |
| AF-A0A2A5K0P4-F1-model_v4 | deleted | 0.9872 | 46 | 395 |
|
| AF-A0A4U3BUA0-F1-model_v4 | deleted | 0.9872 | 1 | 259 |
|