F459365

General Info

Members Datasets Scaffolds Average Seq Length
526 313 1052 752

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10009416|JGI25153J46596_100094165
Length 797
Sequence VSTPARSGTAASWAIGVGAALVTAIGLVLMFLLAQATNNRALYERYYVRLFGINVVVAVLLVLVIGWVAFRLLRRLRQGKFGSRLLIKLAAIFALVGVVPGALVYVVSYQFVARSIESWFDVKVEGALDAGLNLGRATLDSLSDDLAVKTRSASAQLAQVPDASAGLVLERIRDQLEASDVILWTGSGQLVASAGTSRFQLNPDRPTQQQFRQVRPERAVAHVEGXDETTAPGATPPAASVRALAMVQRPGFDFDTAPRYLQVTRPLPPAVVANALAVQEANREYQERALAREGLRRMYIGTLTLSLFLAVLFGNQLARPLLVLAEGVRQVAAGDLRPTAVLQGKDELGGLTRSFAVMTQQLADARGAVEKTMGQLDAARANLQTILDNLTSGVIVLDAKGTVLSTNPGATRVLRAPLAAYEGRPLIEVPGLGEFGAKVQQQFEDFLVERMQHGLDHWQHAFELHASGADLPQQDGAINIVARGAELPGAARLLVFDDISEIVSAQRAQAWGEVARRLAHEIKNPLTPIQLSAERLEMKLSGKVQPPEQAVLVKSVKTIVDQVDAMKRLVNEFRDYARLPAADLKPVDLNALLTDVLQLYSAENLPITLRSELDERCPPIRGDAQQIRQVIHNLLQNAQDAAEAAASGTGKAGEVTIRTRLGDSGQRVRLTVQDSGPGFAENILKRAFEPYVTTKTKGTGLGLAGRQEDRRRARRAHRAFQPRRRWGCSRGTSLAIIRAGKRAAGSGRSHRRFVEVFRLSRTNDRRTGDGWASGLNIPLRTPAHTTSSTHGKHSRGR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
178 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
237 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
250 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
258 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
259 2547132374 Acidovorax radicis N35 Isolate Unclassified
260 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
261 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
262 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
263 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
264 2643221570 Acidovorax sp. Root568 Isolate Unclassified
265 2643221596 Acidovorax sp. Root70 Isolate Unclassified
266 2643221609 Acidovorax sp. Root217 Isolate Unclassified
267 2643221611 Acidovorax sp. Root219 Isolate Unclassified
268 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
269 2643221652 Acidovorax sp. Root402 Isolate Unclassified
270 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
271 2643221658 Variovorax sp. Root411 Isolate Unclassified
272 2643221660 Methylibium sp. Root1272 Isolate Unclassified
273 2643221672 Variovorax sp. Root434 Isolate Unclassified
274 2643221683 Variovorax sp. Root473 Isolate Unclassified
275 2643221717 Acidovorax sp. Root267 Isolate Unclassified
276 2738541277 Variovorax sp. GV051 Isolate Unclassified
277 2738541307 Variovorax sp. GV008 Isolate Unclassified
278 2738543012 Acidovorax sp. CF301 Isolate Unclassified
279 2738543013 Variovorax sp. BT01 Isolate Unclassified
280 2738543019 Variovorax sp. GV040 Isolate Unclassified
281 2816332133 Acidovorax radicis 2721A Isolate Unclassified
282 2818991446 Variovorax sp. 1180 Isolate Unclassified
283 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
284 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
285 2842677519 Variovorax sp. R-72495 Isolate Unclassified
286 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
287 2842733646 Variovorax sp. R-72446 Isolate Unclassified
288 2842747753 Variovorax sp. R-72060 Isolate Unclassified
289 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
290 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
291 2885198086 Variovorax sp. 679 Isolate Unclassified
292 2885211737 Variovorax sp. 553 Isolate Unclassified
293 2899924645 Variovorax sp. 369 Isolate Unclassified
294 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
295 2904456579 Variovorax sp. 2002 Isolate Unclassified
296 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
297 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
298 2928037797 Variovorax sp. 1126 Isolate Unclassified
299 2928044640 Variovorax sp. 1128 Isolate Unclassified
300 2928051484 Variovorax sp. 1133 Isolate Unclassified
301 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
302 2928070936 Variovorax gossypii 1167 Isolate Unclassified
303 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
304 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
305 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
306 2929520902 Variovorax beijingensis 502 Isolate Unclassified
307 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
308 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
309 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
310 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
311 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
312 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
313 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 0
Isolates 10.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.65
Nodule 0.95
Rhizoplane 2.47
Rhizosphere 47.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10009416 3300003215 Bacteria 4542
2 JGI25155J39150_1000033 3300002704 Bacteria 105391
3 JGI25156J39149_1000043 3300002705 Bacteria 105452
4 JGI25154J39366_1000062 3300002738 Bacteria 105525
5 JGI25157J39369_1000060 3300002741 Bacteria 105525
6 JGI25152J39213_1000141 3300002773 Bacteria 49080
7 JGI25150J39212_1000246 3300002774 Bacteria 28745
8 JGI25159J45721_1000070 3300002987 Bacteria 49080
9 JGI25159J45721_1001805 3300002987 Bacteria 8588
10 JGI25159J45721_1006354 3300002987 Bacteria 3548
11 JGI25151J46595_10000323 3300003187 Bacteria 51894
12 JGI25151J46595_10000349 3300003187 Bacteria 49530
13 JGI25151J46595_10002871 3300003187 Bacteria 9898
14 JGI25151J46595_10009352 3300003187 Bacteria 4647
15 JGI25151J46595_10021479 3300003187 Bacteria 2700
16 JGI25153J46596_10000220 3300003215 Bacteria 49080
17 JGI25160J50197_1000174 3300003354 Bacteria 54817
18 JGI25160J50197_1009456 3300003354 Bacteria 3613
19 JGI25161J50226_1000057 3300003374 Bacteria 102462
20 JGI25161J50226_1000237 3300003374 Bacteria 33552
21 Ga0055535_1001875 3300003761 Bacteria 8904
22 Ga0055542_1000965 3300003762 Bacteria 18727
23 Ga0055526_1000222 3300003771 Bacteria 49080
24 Ga0055526_1004283 3300003771 Bacteria 8637
25 Ga0055537_1000166 3300003773 Bacteria 49080
26 Ga0055537_1001048 3300003773 Bacteria 12394
27 Ga0055524_1000033 3300003775 Bacteria 180833
28 Ga0055524_1000286 3300003775 Bacteria 49080
29 Ga0055524_1000357 3300003775 Bacteria 41402
30 Ga0055524_1004396 3300003775 Bacteria 6502
31 Ga0055536_1002203 3300003781 Bacteria 11100
32 Ga0055536_1004387 3300003781 Bacteria 7237
33 Ga0055536_1005847 3300003781 Bacteria 5908
34 Ga0055534_1000128 3300003784 Bacteria 56698
35 Ga0055534_1000166 3300003784 Bacteria 49080
36 Ga0055534_1001945 3300003784 Bacteria 7584
37 Ga0055528_1000590 3300003790 Bacteria 27346
38 Ga0055528_1001372 3300003790 Bacteria 14961
39 Ga0055528_1011021 3300003790 Bacteria 3624
40 Ga0055530_10002953 3300003791 Bacteria 10265
41 Ga0055530_10003542 3300003791 Bacteria 8808
42 Ga0055530_10006134 3300003791 Bacteria 5459
43 Ga0055530_10009650 3300003791 Bacteria 3681
44 Ga0055540_1000007 3300003792 Bacteria 318178
45 Ga0055540_1000470 3300003792 Bacteria 31110
46 Ga0055540_1000793 3300003792 Bacteria 21387
47 Ga0055540_1001815 3300003792 Bacteria 12104
48 Ga0055540_1003507 3300003792 Bacteria 7552
49 Ga0055540_1004818 3300003792 Bacteria 5928
50 Ga0055531_10000252 3300003794 Bacteria 57457
51 Ga0055531_10000909 3300003794 Bacteria 24060
52 Ga0055531_10003304 3300003794 Bacteria 10334
53 Ga0055531_10010323 3300003794 Bacteria 4655
54 Ga0055543_1000198 3300004625 Bacteria 49238
55 Ga0055543_1000308 3300004625 Bacteria 34048
56 Ga0065165_1000671 3300005262 Bacteria 49238
57 Ga0070676_10006642 3300005328 Bacteria 6192
58 Ga0070676_10012996 3300005328 Bacteria 4561
59 Ga0070670_100019702 3300005331 Bacteria 5792
60 Ga0068869_100005922 3300005334 Bacteria 7725
61 Ga0070666_10001109 3300005335 Bacteria 16444
62 Ga0068868_100008222 3300005338 Bacteria 7466
63 Ga0068868_100013064 3300005338 Bacteria 6079
64 Ga0068868_100038464 3300005338 Bacteria 3713
65 Ga0070660_100005369 3300005339 Bacteria 8871
66 Ga0070689_100011315 3300005340 Bacteria 6388
67 Ga0070669_100019221 3300005353 Bacteria 4879
68 Ga0070675_100000748 3300005354 Bacteria 22596
69 Ga0070675_100000867 3300005354 Bacteria 21513
70 Ga0070671_100022182 3300005355 Bacteria 5187
71 Ga0070674_100003369 3300005356 Bacteria 8954
72 Ga0070674_100024461 3300005356 Bacteria 3920
73 Ga0070674_100049561 3300005356 Bacteria 2887
74 Ga0070673_100006898 3300005364 Bacteria 7427
75 Ga0070673_100025149 3300005364 Bacteria 4377
76 Ga0070673_100032503 3300005364 Bacteria 3930
77 Ga0070667_100023906 3300005367 Bacteria 5075
78 Ga0070667_100033471 3300005367 Bacteria 4296
79 Ga0070667_100040567 3300005367 Bacteria 3904
80 Ga0070667_100056509 3300005367 Bacteria 3315
81 Ga0070663_100000127 3300005455 Bacteria 35963
82 Ga0068867_100000016 3300005459 Bacteria 108420
83 Ga0068867_100005537 3300005459 Bacteria 8942
84 Ga0070679_100039148 3300005530 Bacteria 4712
85 Ga0068853_100003285 3300005539 Bacteria 12366
86 Ga0068853_100043706 3300005539 Bacteria 3833
87 Ga0070672_100017481 3300005543 Bacteria 5163
88 Ga0070665_100010031 3300005548 Bacteria 9581
89 Ga0068855_100015357 3300005563 Bacteria 9218
90 Ga0068855_100045622 3300005563 Bacteria 5183
91 Ga0068855_100056749 3300005563 Bacteria 4592
92 Ga0068857_100020578 3300005577 Bacteria 5805
93 Ga0068859_100018604 3300005617 Bacteria 6984
94 Ga0068864_100001800 3300005618 Bacteria 17594
95 Ga0068864_100045109 3300005618 Bacteria 3781
96 Ga0068861_100000598 3300005719 Bacteria 21402
97 Ga0068863_100055236 3300005841 Bacteria 3761
98 Ga0068858_100002952 3300005842 Bacteria 17096
99 Ga0068862_100020538 3300005844 Bacteria 5518
100 Ga0068862_100065559 3300005844 Bacteria 3128
101 Ga0075365_10000046 3300006038 Bacteria 39668
102 Ga0075364_10000326 3300006051 Bacteria 23579
103 Ga0075364_10035765 3300006051 Bacteria 3210
104 Ga0075362_10004020 3300006177 Bacteria 5235
105 Ga0075366_10003533 3300006195 Bacteria 8257
106 Ga0075366_10011137 3300006195 Bacteria 5069
107 Ga0075370_10000452 3300006353 Bacteria 15337
108 Ga0075370_10004224 3300006353 Bacteria 6942
109 Ga0075370_10019326 3300006353 Bacteria 3709
110 Ga0075370_10037275 3300006353 Bacteria 2733
111 Ga0068871_100016751 3300006358 Bacteria 5530
112 Ga0075429_100008564 3300006880 Bacteria 8900
113 Ga0097620_100018604 3300006931 Bacteria 6984
114 Ga0079104_1000009 3300006946 Bacteria 367015
115 Ga0099826_10000576 3300006948 Bacteria 18492
116 Ga0105240_10011274 3300009093 Bacteria 12463
117 Ga0105240_10031020 3300009093 Bacteria 6937
118 Ga0105240_10032454 3300009093 Bacteria 6761
119 Ga0105245_10003302 3300009098 Bacteria 14483
120 Ga0105245_10015734 3300009098 Bacteria 6597
121 Ga0105243_10001735 3300009148 Bacteria 18769
122 Ga0105243_10009880 3300009148 Bacteria 7258
123 Ga0105237_10011976 3300009545 Bacteria 9166
124 Ga0105237_10013179 3300009545 Bacteria 8674
125 Ga0105237_10058416 3300009545 Bacteria 3860
126 Ga0105238_10013582 3300009551 Bacteria 8223
127 Ga0105239_10000231 3300010375 Bacteria 82117
128 Ga0157370_10003650 3300013104 Bacteria 17995
129 Ga0157369_10003989 3300013105 Bacteria 17501
130 Ga0157374_10011338 3300013296 Bacteria 7713
131 Ga0163162_10007787 3300013306 Bacteria 10445
132 Ga0157372_10027431 3300013307 Bacteria 6202
133 Ga0157375_10025260 3300013308 Bacteria 5516
134 Ga0182008_10001863 3300014497 Bacteria 13712
135 Ga0182008_10010316 3300014497 Bacteria 5002
136 Ga0182008_10013592 3300014497 Bacteria 4279
137 Ga0157377_10000006 3300014745 Bacteria 419853
138 Ga0157379_10004620 3300014968 Bacteria 11812
139 Ga0157376_10002598 3300014969 Bacteria 12264
140 Ga0182006_1005064 3300015261 Bacteria 6337
141 Ga0182007_10001504 3300015262 Bacteria 12452
142 Ga0182007_10003665 3300015262 Bacteria 7199
143 Ga0183362_10014 3300015683 Bacteria 40122
144 Ga0163161_10000532 3300017792 Bacteria 31132
145 Ga0213872_10001569 3300021361 Bacteria 14562
146 Ga0209435_100041 3300025206 Bacteria 105577
147 Ga0209436_100639 3300025208 Bacteria 14902
148 Ga0209672_100902 3300025228 Bacteria 13488
149 Ga0209258_100793 3300025242 Bacteria 18779
150 Ga0207425_1000188 3300025245 Bacteria 50224
151 Ga0207425_1000938 3300025245 Bacteria 13889
152 Ga0207425_1001417 3300025245 Bacteria 10074
153 Ga0207425_1002431 3300025245 Bacteria 6556
154 Ga0209646_1000144 3300025246 Bacteria 105691
155 Ga0209026_1000159 3300025250 Bacteria 105691
156 Ga0209148_1000666 3300025254 Bacteria 29479
157 Ga0209759_1000001 3300025256 Bacteria 2799452
158 Ga0209129_1000204 3300025258 Bacteria 69584
159 Ga0209129_1004547 3300025258 Bacteria 5357
160 Ga0209129_1005648 3300025258 Bacteria 4336
161 Ga0209565_1000101 3300025263 Bacteria 129092
162 Ga0209565_1000229 3300025263 Bacteria 61660
163 Ga0209565_1000265 3300025263 Bacteria 54730
164 Ga0209565_1001671 3300025263 Bacteria 9249
165 Ga0209565_1002211 3300025263 Bacteria 7285
166 Ga0209673_1000463 3300025273 Bacteria 68460
167 Ga0209673_1000493 3300025273 Bacteria 65247
168 Ga0209673_1000611 3300025273 Bacteria 54730
169 Ga0209673_1000687 3300025273 Bacteria 48530
170 Ga0209673_1001888 3300025273 Bacteria 16849
171 Ga0209130_1000146 3300025284 Bacteria 111777
172 Ga0209130_1000291 3300025284 Bacteria 61045
173 Ga0209130_1002414 3300025284 Bacteria 9421
174 Ga0209130_1002588 3300025284 Bacteria 8794
175 Ga0209675_1000121 3300025291 Bacteria 107684
176 Ga0209675_1000186 3300025291 Bacteria 68471
177 Ga0209675_1000240 3300025291 Bacteria 54730
178 Ga0209675_1002001 3300025291 Bacteria 10940
179 Ga0209675_1008937 3300025291 Bacteria 3602
180 Ga0209676_1000073 3300025292 Bacteria 305947
181 Ga0209676_1001219 3300025292 Bacteria 27305
182 Ga0209676_1001283 3300025292 Bacteria 25966
183 Ga0209676_1001420 3300025292 Bacteria 22744
184 Ga0209676_1004287 3300025292 Bacteria 8041
185 Ga0209676_1006616 3300025292 Bacteria 5666
186 Ga0209025_1000208 3300025294 Bacteria 140415
187 Ga0209025_1000500 3300025294 Bacteria 75244
188 Ga0209025_1000693 3300025294 Bacteria 57567
189 Ga0209025_1001480 3300025294 Bacteria 30536
190 Ga0209025_1006944 3300025294 Bacteria 8610
191 Ga0209025_1011151 3300025294 Bacteria 5979
192 Ga0209025_1022921 3300025294 Bacteria 3289
193 Ga0209564_1000554 3300025295 Bacteria 59946
194 Ga0209564_1000798 3300025295 Bacteria 43280
195 Ga0209564_1004269 3300025295 Bacteria 8860
196 Ga0209564_1004490 3300025295 Bacteria 8514
197 Ga0209564_1005844 3300025295 Bacteria 6845
198 Ga0209758_1000442 3300025297 Bacteria 69581
199 Ga0209758_1018456 3300025297 Bacteria 3416
200 Ga0209758_1022261 3300025297 Bacteria 2915
201 Ga0209050_1000008 3300025298 Bacteria 1144179
202 Ga0209050_1000052 3300025298 Bacteria 351785
203 Ga0209050_1000704 3300025298 Bacteria 49577
204 Ga0209050_1002686 3300025298 Bacteria 14483
205 Ga0209050_1005000 3300025298 Bacteria 8622
206 Ga0209050_1006730 3300025298 Bacteria 6713
207 Ga0209050_1008663 3300025298 Bacteria 5372
208 Ga0209256_1000019 3300025299 Bacteria 558627
209 Ga0209256_1000168 3300025299 Bacteria 132040
210 Ga0209256_1000476 3300025299 Bacteria 59946
211 Ga0209256_1004668 3300025299 Bacteria 8421
212 Ga0207426_1000291 3300025302 Bacteria 99437
213 Ga0207426_1000486 3300025302 Bacteria 59946
214 Ga0207426_1000540 3300025302 Bacteria 54151
215 Ga0209051_1000004 3300025303 Bacteria 1155596
216 Ga0209051_1000005 3300025303 Bacteria 1142353
217 Ga0209051_1000105 3300025303 Bacteria 160893
218 Ga0209051_1000186 3300025303 Bacteria 109900
219 Ga0209051_1000673 3300025303 Bacteria 38238
220 Ga0209051_1000819 3300025303 Bacteria 32216
221 Ga0209051_1001262 3300025303 Bacteria 22609
222 Ga0209051_1009148 3300025303 Bacteria 5142
223 Ga0209257_1000015 3300025304 Bacteria 908141
224 Ga0209257_1000031 3300025304 Bacteria 688770
225 Ga0209257_1000037 3300025304 Bacteria 612915
226 Ga0209257_1000038 3300025304 Bacteria 609032
227 Ga0209257_1000044 3300025304 Bacteria 486709
228 Ga0209257_1000663 3300025304 Bacteria 54142
229 Ga0209257_1000746 3300025304 Bacteria 49149
230 Ga0209257_1007026 3300025304 Bacteria 6975
231 Ga0207680_10000628 3300025903 Bacteria 16642
232 Ga0207695_10007073 3300025913 Bacteria 14388
233 Ga0207695_10056393 3300025913 Bacteria 4088
234 Ga0207657_10021089 3300025919 Bacteria 6140
235 Ga0207657_10087456 3300025919 Bacteria 2607
236 Ga0207694_10033089 3300025924 Bacteria 3960
237 Ga0207659_10001382 3300025926 Bacteria 14474
238 Ga0207659_10004537 3300025926 Bacteria 8403
239 Ga0207659_10005920 3300025926 Bacteria 7464
240 Ga0207659_10023994 3300025926 Bacteria 4080
241 Ga0207687_10023967 3300025927 Bacteria 4071
242 Ga0207687_10046370 3300025927 Bacteria 3009
243 Ga0207644_10003986 3300025931 Bacteria 9590
244 Ga0207690_10009238 3300025932 Bacteria 5855
245 Ga0207706_10000948 3300025933 Bacteria 29654
246 Ga0207709_10000981 3300025935 Bacteria 21303
247 Ga0207709_10010532 3300025935 Bacteria 5092
248 Ga0207670_10004373 3300025936 Bacteria 7597
249 Ga0207669_10003970 3300025937 Bacteria 6459
250 Ga0207669_10034245 3300025937 Bacteria 2876
251 Ga0207691_10000175 3300025940 Bacteria 60250
252 Ga0207711_10001699 3300025941 Bacteria 20276
253 Ga0207689_10000313 3300025942 Bacteria 44828
254 Ga0207667_10038653 3300025949 Bacteria 5094
255 Ga0207651_10004612 3300025960 Bacteria 6977
256 Ga0207668_10031289 3300025972 Bacteria 3503
257 Ga0207658_10028074 3300025986 Bacteria 3960
258 Ga0207658_10032915 3300025986 Bacteria 3694
259 Ga0207658_10049573 3300025986 Bacteria 3086
260 Ga0207658_10057021 3300025986 Bacteria 2901
261 Ga0207703_10001914 3300026035 Bacteria 18448
262 Ga0207703_10017814 3300026035 Bacteria 5546
263 Ga0207639_10032419 3300026041 Bacteria 3846
264 Ga0207678_10000711 3300026067 Bacteria 30413
265 Ga0207678_10001371 3300026067 Bacteria 22438
266 Ga0207641_10020210 3300026088 Bacteria 5467
267 Ga0207648_10000023 3300026089 Bacteria 134519
268 Ga0207648_10002975 3300026089 Bacteria 17905
269 Ga0207648_10009101 3300026089 Bacteria 9547
270 Ga0207648_10012451 3300026089 Bacteria 7963
271 Ga0207676_10000082 3300026095 Bacteria 92500
272 Ga0207676_10008727 3300026095 Bacteria 7208
273 Ga0207676_10035808 3300026095 Bacteria 3771
274 Ga0207674_10010510 3300026116 Bacteria 10476
275 Ga0207674_10017125 3300026116 Bacteria 7911
276 Ga0207674_10107918 3300026116 Bacteria 2761
277 Ga0207675_100001829 3300026118 Bacteria 21327
278 Ga0207683_10006124 3300026121 Bacteria 10305
279 Ga0207683_10031973 3300026121 Bacteria 4569
280 Ga0207698_10004465 3300026142 Bacteria 8536
281 Ga0207698_10020382 3300026142 Bacteria 4563
282 Ga0207698_10045393 3300026142 Bacteria 3310
283 Ga0209281_1000023 3300027111 Bacteria 519955
284 Ga0209968_1000239 3300027526 Bacteria 9433
285 Ga0209282_1000260 3300027666 Bacteria 26414
286 Ga0209966_1000130 3300027695 Bacteria 32242
287 Ga0268265_10013673 3300028380 Bacteria 5521
288 Ga0268264_10019606 3300028381 Bacteria 5525
289 Ga0307517_10001004 3300028786 Bacteria 47851
290 Ga0307515_10000183 3300028794 Bacteria 154076
291 Ga0307515_10000672 3300028794 Bacteria 78835
292 Ga0307515_10001346 3300028794 Bacteria 55608
293 Ga0307515_10007261 3300028794 Bacteria 21944
294 Ga0307515_10107127 3300028794 Bacteria 3308
295 Ga0307515_10122493 3300028794 Bacteria 2932
296 Ga0307512_10008895 3300030522 Bacteria 9739
297 Ga0316178_1050578 3300030735 Bacteria 4557
298 Ga0265330_10000043 3300031235 Bacteria 116829
299 Ga0265332_10000018 3300031238 Bacteria 224913
300 Ga0265332_10001858 3300031238 Bacteria 11217
301 Ga0265325_10000992 3300031241 Bacteria 20364
302 Ga0265327_10000427 3300031251 Bacteria 76690
303 Ga0265327_10004287 3300031251 Bacteria 12744
304 Ga0265316_10000748 3300031344 Bacteria 35856
305 Ga0307513_10000066 3300031456 Bacteria 141617
306 Ga0307513_10000070 3300031456 Bacteria 139895
307 Ga0307513_10005651 3300031456 Bacteria 16477
308 Ga0307513_10009085 3300031456 Bacteria 12600
309 Ga0307509_10023365 3300031507 Bacteria 6946
310 Ga0307509_10052417 3300031507 Bacteria 4355
311 Ga0307408_100000926 3300031548 Bacteria 22869
312 Ga0307408_100010876 3300031548 Bacteria 6005
313 Ga0307508_10000099 3300031616 Bacteria 102389
314 Ga0307508_10022902 3300031616 Bacteria 5676
315 Ga0307514_10002098 3300031649 Bacteria 21504
316 Ga0307514_10017696 3300031649 Bacteria 5858
317 Ga0265314_10000126 3300031711 Bacteria 116852
318 Ga0265314_10062893 3300031711 Bacteria 2520
319 Ga0307516_10003389 3300031730 Bacteria 20543
320 Ga0307516_10020006 3300031730 Bacteria 6921
321 Ga0307516_10066668 3300031730 Bacteria 3472
322 Ga0307410_10021642 3300031852 Bacteria 3958
323 Ga0307406_10000530 3300031901 Bacteria 21943
324 Ga0307412_10003995 3300031911 Bacteria 8221
325 Ga0307412_10010179 3300031911 Bacteria 5411
326 Ga0307412_10036287 3300031911 Bacteria 3157
327 Ga0307409_100011717 3300031995 Bacteria 5546
328 Ga0307416_100051942 3300032002 Bacteria 3278
329 Ga0307510_10002550 3300033180 Bacteria 20764
330 Ga0307510_10005165 3300033180 Bacteria 15512
331 Ga0373931_0003313 3300035691 Bacteria 7212
332 Ga0395900_0000690 3300037418 Bacteria 45062
333 Ga0395900_0089634 3300037418 Bacteria 3161
334 Ga0395898_0053442 3300037466 Bacteria 3945
335 Ga0395905_0000483 3300037471 Bacteria 54915
336 Ga0395905_0002033 3300037471 Bacteria 23120
337 Ga0395905_0005096 3300037471 Bacteria 13506
338 Ga0395905_0013213 3300037471 Bacteria 7924
339 Ga0395905_0043381 3300037471 Bacteria 4219
340 Ga0395905_0045857 3300037471 Bacteria 4100
341 Ga0395905_0100581 3300037471 Bacteria 2715
342 Ga0395901_0053528 3300038443 Bacteria 4193
343 Ga0436361_0236851 3300039447 Bacteria 3148
344 Ga0436361_0504201 3300039447 Bacteria 19088
345 Ga0436361_0919876 3300039447 Bacteria 112731
346 Ga0439436_0001085 3300041404 Bacteria 7662
347 Ga0439466_0002024 3300041411 Bacteria 7954
348 Ga0439466_0006369 3300041411 Bacteria 4490
349 Ga0439465_0001752 3300041413 Bacteria 7096
350 Ga0439431_0000397 3300041997 Bacteria 9184
351 Ga0439432_003733 3300042006 Bacteria 5627
352 Ga0439449_0000159 3300042007 Bacteria 23002
353 Ga0439449_0000490 3300042007 Bacteria 14817
354 Ga0439449_0001079 3300042007 Bacteria 10725
355 Ga0439452_003168 3300042010 Bacteria 5825
356 Ga0439462_0001896 3300042015 Bacteria 4752
357 Ga0450911_000295 3300042115 Bacteria 18113
358 Ga0450908_001508 3300042184 Bacteria 4521
359 Ga0439434_0011925 3300042435 Bacteria 2569
360 Ga0451577_0000388 3300042876 Bacteria 81462
361 Ga0451577_0000843 3300042876 Bacteria 45842
362 Ga0451577_0004445 3300042876 Bacteria 14806
363 Ga0466969_0000042 3300044656 Bacteria 69271
364 Ga0466969_0002004 3300044656 Bacteria 10871
365 Ga0466969_0026816 3300044656 Bacteria 2953
366 Ga0466972_0000437 3300044658 Bacteria 21547
367 Ga0453683_0012052 3300044673 Bacteria 5678
368 Ga0466965_0013041 3300044683 Bacteria 3916
369 Ga0466965_0022284 3300044683 Bacteria 3054
370 Ga0466966_0001883 3300044684 Bacteria 13611
371 Ga0466966_0007319 3300044684 Bacteria 7316
372 Ga0466961_0001997 3300044693 Bacteria 12690
373 Ga0466961_0034935 3300044693 Bacteria 3227
374 Ga0466963_0019809 3300044694 Bacteria 4225
375 Ga0466964_0017178 3300044706 Bacteria 2768
376 Ga0453684_0000187 3300044712 Bacteria 272378
377 Ga0466970_0003828 3300044765 Bacteria 7369
378 Ga0466957_0021607 3300044842 Bacteria 3793
379 Ga0466959_0001012 3300045049 Bacteria 16712
380 Ga0466959_0003881 3300045049 Bacteria 9919
381 Ga0451576_0001083 3300045051 Bacteria 49865
382 Ga0451576_0029360 3300045051 Bacteria 5885
383 Ga0495592_0000140 3300046454 Bacteria 63848
384 Ga0495590_0010369 3300046457 Bacteria 3505
385 Ga0495638_0014108 3300046460 Bacteria 5411
386 Ga0495580_0036017 3300046472 Bacteria 3556
387 Ga0495616_0006937 3300046513 Bacteria 6819
388 Ga0495631_0000789 3300046518 Bacteria 20239
389 Ga0495642_0008688 3300046528 Bacteria 3881
390 Ga0495654_0003027 3300046530 Bacteria 10474
391 Ga0495597_0017688 3300046542 Bacteria 3350
392 Ga0495656_0000930 3300046615 Bacteria 9472
393 Ga0495625_0000437 3300046660 Bacteria 62719
394 Ga0495625_0014968 3300046660 Bacteria 6163
395 Ga0495669_0020730 3300046684 Bacteria 2848
396 Ga0495649_0003446 3300046694 Bacteria 10664
397 Ga0495660_0019623 3300046810 Bacteria 3881
398 Ga0495676_0000748 3300047321 Bacteria 27031
399 Ga0495687_001876 3300047443 Bacteria 18183
400 Ga0495685_005125 3300047447 Bacteria 4268
401 Ga0495686_0000592 3300047472 Bacteria 50576
402 Ga0495593_0000325 3300047673 Bacteria 26425
403 Ga0495614_0000703 3300048089 Bacteria 14096
404 Ga0496101_0002828 3300048904 Bacteria 10664
405 Ga0496101_0003426 3300048904 Bacteria 9892
406 Ga0496102_0010853 3300048905 Bacteria 7842
407 Ga0496103_0012678 3300048906 Bacteria 5001
408 Ga0496104_0040166 3300048907 Bacteria 4384
409 Ga0496107_0008113 3300048910 Bacteria 7258
410 Ga0496110_0015521 3300048913 Bacteria 6341
411 Ga0496111_0050519 3300048914 Bacteria 3000
412 Ga0496114_0010658 3300048917 Bacteria 7315
413 Ga0496115_0031655 3300048918 Bacteria 4168
414 Ga0496116_0008081 3300048919 Bacteria 9199
415 Ga0496117_0006969 3300048920 Bacteria 11205
416 Ga0496118_0001231 3300048921 Bacteria 39357
417 Ga0496118_0016981 3300048921 Bacteria 6647
418 Ga0496121_0009927 3300048924 Bacteria 10838
419 Ga0496121_0038597 3300048924 Bacteria 4223
420 Ga0496122_0001128 3300048925 Bacteria 45936
421 Ga0496122_0023944 3300048925 Bacteria 5360
422 Ga0496123_0000181 3300048926 Bacteria 127092
423 Ga0496124_0030048 3300048927 Bacteria 4831
424 Ga0496124_0030470 3300048927 Bacteria 4788
425 Ga0496125_0003098 3300048928 Bacteria 20742
426 Ga0496125_0012240 3300048928 Bacteria 8533
427 Ga0496126_0018769 3300048929 Bacteria 6839
428 Ga0501043_0000018 3300049579 Bacteria 161101
429 Ga0501046_0000042 3300049580 Bacteria 151850
430 Ga0501047_0000052 3300049581 Bacteria 153448
431 Ga0501047_0104921 3300049581 Bacteria 2707
432 Ga0501048_0000459 3300049582 Bacteria 28550
433 Ga0501198_000042 3300049649 Bacteria 45595
434 Ga0501222_000099 3300049662 Bacteria 22061
435 Ga0501266_000105 3300049763 Bacteria 10287
436 nmdc:mga03683_3707_c1 3300050489 Bacteria 4977
437 nmdc:mga00v17_32062_c1 3300050491 Bacteria 3104
438 nmdc:mga0yw44_11138_c1 3300050492 Bacteria 4625
439 nmdc:mga0yw44_1423_c1 3300050492 Bacteria 9499
440 nmdc:mga0k408_11588_c1 3300050493 Bacteria 4805
441 nmdc:mga0k408_12855_c1 3300050493 Bacteria 3407
442 nmdc:mga0k408_24370_c1 3300050493 Bacteria 3420
443 nmdc:mga0k408_2502_c1 3300050493 Bacteria 9775
444 nmdc:mga0k408_27247_c1 3300050493 Bacteria 3245
445 nmdc:mga0k408_3973_c1 3300050493 Bacteria 7838
446 nmdc:mga0k408_6131_c1 3300050493 Bacteria 5632
447 nmdc:mga07m45_11029_c1 3300050496 Bacteria 4738
448 nmdc:mga07m45_1206_c1 3300050496 Bacteria 11700
449 nmdc:mga07m45_22278_c1 3300050496 Bacteria 3457
450 nmdc:mga07m45_518_c1 3300050496 Bacteria 13003
451 nmdc:mga07m45_592_c1 3300050496 Bacteria 15413
452 nmdc:mga07m45_604_c1 3300050496 Bacteria 15258
453 nmdc:mga09592_1383_c1 3300050508 Bacteria 19407
454 nmdc:mga0qj67_24072_c1 3300050509 Bacteria 4690
455 Ga0500578_0011500 3300053086 Bacteria 5720
456 Ga0500644_0002122 3300053088 Bacteria 5022
457 Ga0500651_0000035 3300053093 Bacteria 105120
458 Ga0500593_000697 3300053117 Bacteria 12799
459 Ga0500608_016249 3300053122 Bacteria 3359
460 Ga0500658_0001949 3300053134 Bacteria 8079
461 Ga0500658_0002275 3300053134 Bacteria 7433
462 Ga0500658_0007036 3300053134 Bacteria 4162
463 Ga0500559_0000027 3300053136 Bacteria 118758
464 Ga0500559_0001134 3300053136 Bacteria 16042
465 Ga0500619_001089 3300053154 Bacteria 4706
466 Ga0500622_0001323 3300053156 Bacteria 20153
467 Ga0500627_0003584 3300053158 Bacteria 4834
468 Ga0500645_001561 3300053730 Bacteria 11401
469 Ga0500645_012002 3300053730 Bacteria 2809
470 Ga0500587_000799 3300053739 Bacteria 4101
471 2513228114 2513020051 Bacteria 6053213
472 2548501923 2547132374 Bacteria 5530232
473 2599621297 2599185214 Bacteria 8209958
474 2599675316 2599185226 Bacteria 8233575
475 2599678086 2599185227 Bacteria 8246414
476 2599690808 2599185229 Bacteria 8216126
477 2643866446 2643221570 Bacteria 5103772
478 2643991875 2643221596 Bacteria 5006805
479 2644057313 2643221609 Bacteria 6756331
480 2644072590 2643221611 Bacteria 6820941
481 2644161156 2643221628 Bacteria 5745828
482 2644293254 2643221652 Bacteria 5140275
483 2644303629 2643221654 Bacteria 5273570
484 2644325622 2643221658 Bacteria 6064537
485 2644339795 2643221660 Bacteria 4208257
486 2644400991 2643221672 Bacteria 6322190
487 2644469706 2643221683 Bacteria 5749203
488 2644647258 2643221717 Bacteria 5676132
489 2738723128 2738541277 Bacteria 7458140
490 2738882590 2738541307 Bacteria 8606193
491 2739241577 2738543012 Bacteria 7115078
492 2739249830 2738543013 Bacteria 5618633
493 2739283859 2738543019 Bacteria 7459457
494 2816471119 2816332133 Bacteria 7249298
495 2819602799 2818991446 Bacteria 7757362
496 2831270155 2831265667 Bacteria 7184833
497 2838061798 2838054893 Bacteria 7451788
498 2842681445 2842677519 Bacteria 5615038
499 2842722032 2842718218 Bacteria 4560148
500 2842737344 2842733646 Bacteria 5716726
501 2842749920 2842747753 Bacteria 5578255
502 2881104682 2881101125 Bacteria 4590519
503 2885195795 2885192300 Bacteria 5882526
504 2885201421 2885198086 Bacteria 7212419
505 2885215075 2885211737 Bacteria 7212420
506 2899927935 2899924645 Bacteria 7487985
507 2904454241 2904449895 Bacteria 6927402
508 2904462998 2904456579 Bacteria 6819253
509 2904545849 2904541872 Bacteria 8915136
510 2919467931 2919462493 Bacteria 5817112
511 2928042457 2928037797 Bacteria 7273642
512 2928048482 2928044640 Bacteria 7271509
513 2928054807 2928051484 Bacteria 7773759
514 2928068226 2928064002 Bacteria 7419480
515 2928073885 2928070936 Bacteria 8062541
516 2928086165 2928084124 Bacteria 7159212
517 2928120569 2928115317 Bacteria 6477646
518 2929161035 2929160207 Bacteria 9075316
519 2929525009 2929520902 Bacteria 6765052
520 2945915914 2945909444 Bacteria 7065066
521 2945950133 2945945610 Bacteria 5951079
522 2945975220 2945972063 Bacteria 6086495
523 2945988654 2945984333 Bacteria 7358892
524 2954770396 2954767861 Bacteria 5535784
525 2974321853 2974320154 Bacteria 4571377
526 2990714489 2990710928 Bacteria 5002431
527 JGI25153J46596_10009416
528 JGI25155J39150_1000033
529 JGI25156J39149_1000043
530 JGI25154J39366_1000062
531 JGI25157J39369_1000060
532 JGI25152J39213_1000141
533 JGI25150J39212_1000246
534 JGI25159J45721_1000070
535 JGI25159J45721_1001805
536 JGI25159J45721_1006354
537 JGI25151J46595_10000323
538 JGI25151J46595_10000349
539 JGI25151J46595_10002871
540 JGI25151J46595_10009352
541 JGI25151J46595_10021479
542 JGI25153J46596_10000220
543 JGI25160J50197_1000174
544 JGI25160J50197_1009456
545 JGI25161J50226_1000057
546 JGI25161J50226_1000237
547 Ga0055535_1001875
548 Ga0055542_1000965
549 Ga0055526_1000222
550 Ga0055526_1004283
551 Ga0055537_1000166
552 Ga0055537_1001048
553 Ga0055524_1000033
554 Ga0055524_1000286
555 Ga0055524_1000357
556 Ga0055524_1004396
557 Ga0055536_1002203
558 Ga0055536_1004387
559 Ga0055536_1005847
560 Ga0055534_1000128
561 Ga0055534_1000166
562 Ga0055534_1001945
563 Ga0055528_1000590
564 Ga0055528_1001372
565 Ga0055528_1011021
566 Ga0055530_10002953
567 Ga0055530_10003542
568 Ga0055530_10006134
569 Ga0055530_10009650
570 Ga0055540_1000007
571 Ga0055540_1000470
572 Ga0055540_1000793
573 Ga0055540_1001815
574 Ga0055540_1003507
575 Ga0055540_1004818
576 Ga0055531_10000252
577 Ga0055531_10000909
578 Ga0055531_10003304
579 Ga0055531_10010323
580 Ga0055543_1000198
581 Ga0055543_1000308
582 Ga0065165_1000671
583 Ga0070676_10006642
584 Ga0070676_10012996
585 Ga0070670_100019702
586 Ga0068869_100005922
587 Ga0070666_10001109
588 Ga0068868_100008222
589 Ga0068868_100013064
590 Ga0068868_100038464
591 Ga0070660_100005369
592 Ga0070689_100011315
593 Ga0070669_100019221
594 Ga0070675_100000748
595 Ga0070675_100000867
596 Ga0070671_100022182
597 Ga0070674_100003369
598 Ga0070674_100024461
599 Ga0070674_100049561
600 Ga0070673_100006898
601 Ga0070673_100025149
602 Ga0070673_100032503
603 Ga0070667_100023906
604 Ga0070667_100033471
605 Ga0070667_100040567
606 Ga0070667_100056509
607 Ga0070663_100000127
608 Ga0068867_100000016
609 Ga0068867_100005537
610 Ga0070679_100039148
611 Ga0068853_100003285
612 Ga0068853_100043706
613 Ga0070672_100017481
614 Ga0070665_100010031
615 Ga0068855_100015357
616 Ga0068855_100045622
617 Ga0068855_100056749
618 Ga0068857_100020578
619 Ga0068859_100018604
620 Ga0068864_100001800
621 Ga0068864_100045109
622 Ga0068861_100000598
623 Ga0068863_100055236
624 Ga0068858_100002952
625 Ga0068862_100020538
626 Ga0068862_100065559
627 Ga0075365_10000046
628 Ga0075364_10000326
629 Ga0075364_10035765
630 Ga0075362_10004020
631 Ga0075366_10003533
632 Ga0075366_10011137
633 Ga0075370_10000452
634 Ga0075370_10004224
635 Ga0075370_10019326
636 Ga0075370_10037275
637 Ga0068871_100016751
638 Ga0075429_100008564
639 Ga0097620_100018604
640 Ga0079104_1000009
641 Ga0099826_10000576
642 Ga0105240_10011274
643 Ga0105240_10031020
644 Ga0105240_10032454
645 Ga0105245_10003302
646 Ga0105245_10015734
647 Ga0105243_10001735
648 Ga0105243_10009880
649 Ga0105237_10011976
650 Ga0105237_10013179
651 Ga0105237_10058416
652 Ga0105238_10013582
653 Ga0105239_10000231
654 Ga0157370_10003650
655 Ga0157369_10003989
656 Ga0157374_10011338
657 Ga0163162_10007787
658 Ga0157372_10027431
659 Ga0157375_10025260
660 Ga0182008_10001863
661 Ga0182008_10010316
662 Ga0182008_10013592
663 Ga0157377_10000006
664 Ga0157379_10004620
665 Ga0157376_10002598
666 Ga0182006_1005064
667 Ga0182007_10001504
668 Ga0182007_10003665
669 Ga0183362_10014
670 Ga0163161_10000532
671 Ga0213872_10001569
672 Ga0209435_100041
673 Ga0209436_100639
674 Ga0209672_100902
675 Ga0209258_100793
676 Ga0207425_1000188
677 Ga0207425_1000938
678 Ga0207425_1001417
679 Ga0207425_1002431
680 Ga0209646_1000144
681 Ga0209026_1000159
682 Ga0209148_1000666
683 Ga0209759_1000001
684 Ga0209129_1000204
685 Ga0209129_1004547
686 Ga0209129_1005648
687 Ga0209565_1000101
688 Ga0209565_1000229
689 Ga0209565_1000265
690 Ga0209565_1001671
691 Ga0209565_1002211
692 Ga0209673_1000463
693 Ga0209673_1000493
694 Ga0209673_1000611
695 Ga0209673_1000687
696 Ga0209673_1001888
697 Ga0209130_1000146
698 Ga0209130_1000291
699 Ga0209130_1002414
700 Ga0209130_1002588
701 Ga0209675_1000121
702 Ga0209675_1000186
703 Ga0209675_1000240
704 Ga0209675_1002001
705 Ga0209675_1008937
706 Ga0209676_1000073
707 Ga0209676_1001219
708 Ga0209676_1001283
709 Ga0209676_1001420
710 Ga0209676_1004287
711 Ga0209676_1006616
712 Ga0209025_1000208
713 Ga0209025_1000500
714 Ga0209025_1000693
715 Ga0209025_1001480
716 Ga0209025_1006944
717 Ga0209025_1011151
718 Ga0209025_1022921
719 Ga0209564_1000554
720 Ga0209564_1000798
721 Ga0209564_1004269
722 Ga0209564_1004490
723 Ga0209564_1005844
724 Ga0209758_1000442
725 Ga0209758_1018456
726 Ga0209758_1022261
727 Ga0209050_1000008
728 Ga0209050_1000052
729 Ga0209050_1000704
730 Ga0209050_1002686
731 Ga0209050_1005000
732 Ga0209050_1006730
733 Ga0209050_1008663
734 Ga0209256_1000019
735 Ga0209256_1000168
736 Ga0209256_1000476
737 Ga0209256_1004668
738 Ga0207426_1000291
739 Ga0207426_1000486
740 Ga0207426_1000540
741 Ga0209051_1000004
742 Ga0209051_1000005
743 Ga0209051_1000105
744 Ga0209051_1000186
745 Ga0209051_1000673
746 Ga0209051_1000819
747 Ga0209051_1001262
748 Ga0209051_1009148
749 Ga0209257_1000015
750 Ga0209257_1000031
751 Ga0209257_1000037
752 Ga0209257_1000038
753 Ga0209257_1000044
754 Ga0209257_1000663
755 Ga0209257_1000746
756 Ga0209257_1007026
757 Ga0207680_10000628
758 Ga0207695_10007073
759 Ga0207695_10056393
760 Ga0207657_10021089
761 Ga0207657_10087456
762 Ga0207694_10033089
763 Ga0207659_10001382
764 Ga0207659_10004537
765 Ga0207659_10005920
766 Ga0207659_10023994
767 Ga0207687_10023967
768 Ga0207687_10046370
769 Ga0207644_10003986
770 Ga0207690_10009238
771 Ga0207706_10000948
772 Ga0207709_10000981
773 Ga0207709_10010532
774 Ga0207670_10004373
775 Ga0207669_10003970
776 Ga0207669_10034245
777 Ga0207691_10000175
778 Ga0207711_10001699
779 Ga0207689_10000313
780 Ga0207667_10038653
781 Ga0207651_10004612
782 Ga0207668_10031289
783 Ga0207658_10028074
784 Ga0207658_10032915
785 Ga0207658_10049573
786 Ga0207658_10057021
787 Ga0207703_10001914
788 Ga0207703_10017814
789 Ga0207639_10032419
790 Ga0207678_10000711
791 Ga0207678_10001371
792 Ga0207641_10020210
793 Ga0207648_10000023
794 Ga0207648_10002975
795 Ga0207648_10009101
796 Ga0207648_10012451
797 Ga0207676_10000082
798 Ga0207676_10008727
799 Ga0207676_10035808
800 Ga0207674_10010510
801 Ga0207674_10017125
802 Ga0207674_10107918
803 Ga0207675_100001829
804 Ga0207683_10006124
805 Ga0207683_10031973
806 Ga0207698_10004465
807 Ga0207698_10020382
808 Ga0207698_10045393
809 Ga0209281_1000023
810 Ga0209968_1000239
811 Ga0209282_1000260
812 Ga0209966_1000130
813 Ga0268265_10013673
814 Ga0268264_10019606
815 Ga0307517_10001004
816 Ga0307515_10000183
817 Ga0307515_10000672
818 Ga0307515_10001346
819 Ga0307515_10007261
820 Ga0307515_10107127
821 Ga0307515_10122493
822 Ga0307512_10008895
823 Ga0316178_1050578
824 Ga0265330_10000043
825 Ga0265332_10000018
826 Ga0265332_10001858
827 Ga0265325_10000992
828 Ga0265327_10000427
829 Ga0265327_10004287
830 Ga0265316_10000748
831 Ga0307513_10000066
832 Ga0307513_10000070
833 Ga0307513_10005651
834 Ga0307513_10009085
835 Ga0307509_10023365
836 Ga0307509_10052417
837 Ga0307408_100000926
838 Ga0307408_100010876
839 Ga0307508_10000099
840 Ga0307508_10022902
841 Ga0307514_10002098
842 Ga0307514_10017696
843 Ga0265314_10000126
844 Ga0265314_10062893
845 Ga0307516_10003389
846 Ga0307516_10020006
847 Ga0307516_10066668
848 Ga0307410_10021642
849 Ga0307406_10000530
850 Ga0307412_10003995
851 Ga0307412_10010179
852 Ga0307412_10036287
853 Ga0307409_100011717
854 Ga0307416_100051942
855 Ga0307510_10002550
856 Ga0307510_10005165
857 Ga0373931_0003313
858 Ga0395900_0000690
859 Ga0395900_0089634
860 Ga0395898_0053442
861 Ga0395905_0000483
862 Ga0395905_0002033
863 Ga0395905_0005096
864 Ga0395905_0013213
865 Ga0395905_0043381
866 Ga0395905_0045857
867 Ga0395905_0100581
868 Ga0395901_0053528
869 Ga0436361_0236851
870 Ga0436361_0504201
871 Ga0436361_0919876
872 Ga0439436_0001085
873 Ga0439466_0002024
874 Ga0439466_0006369
875 Ga0439465_0001752
876 Ga0439431_0000397
877 Ga0439432_003733
878 Ga0439449_0000159
879 Ga0439449_0000490
880 Ga0439449_0001079
881 Ga0439452_003168
882 Ga0439462_0001896
883 Ga0450911_000295
884 Ga0450908_001508
885 Ga0439434_0011925
886 Ga0451577_0000388
887 Ga0451577_0000843
888 Ga0451577_0004445
889 Ga0466969_0000042
890 Ga0466969_0002004
891 Ga0466969_0026816
892 Ga0466972_0000437
893 Ga0453683_0012052
894 Ga0466965_0013041
895 Ga0466965_0022284
896 Ga0466966_0001883
897 Ga0466966_0007319
898 Ga0466961_0001997
899 Ga0466961_0034935
900 Ga0466963_0019809
901 Ga0466964_0017178
902 Ga0453684_0000187
903 Ga0466970_0003828
904 Ga0466957_0021607
905 Ga0466959_0001012
906 Ga0466959_0003881
907 Ga0451576_0001083
908 Ga0451576_0029360
909 Ga0495592_0000140
910 Ga0495590_0010369
911 Ga0495638_0014108
912 Ga0495580_0036017
913 Ga0495616_0006937
914 Ga0495631_0000789
915 Ga0495642_0008688
916 Ga0495654_0003027
917 Ga0495597_0017688
918 Ga0495656_0000930
919 Ga0495625_0000437
920 Ga0495625_0014968
921 Ga0495669_0020730
922 Ga0495649_0003446
923 Ga0495660_0019623
924 Ga0495676_0000748
925 Ga0495687_001876
926 Ga0495685_005125
927 Ga0495686_0000592
928 Ga0495593_0000325
929 Ga0495614_0000703
930 Ga0496101_0002828
931 Ga0496101_0003426
932 Ga0496102_0010853
933 Ga0496103_0012678
934 Ga0496104_0040166
935 Ga0496107_0008113
936 Ga0496110_0015521
937 Ga0496111_0050519
938 Ga0496114_0010658
939 Ga0496115_0031655
940 Ga0496116_0008081
941 Ga0496117_0006969
942 Ga0496118_0001231
943 Ga0496118_0016981
944 Ga0496121_0009927
945 Ga0496121_0038597
946 Ga0496122_0001128
947 Ga0496122_0023944
948 Ga0496123_0000181
949 Ga0496124_0030048
950 Ga0496124_0030470
951 Ga0496125_0003098
952 Ga0496125_0012240
953 Ga0496126_0018769
954 Ga0501043_0000018
955 Ga0501046_0000042
956 Ga0501047_0000052
957 Ga0501047_0104921
958 Ga0501048_0000459
959 Ga0501198_000042
960 Ga0501222_000099
961 Ga0501266_000105
962 nmdc:mga03683_3707_c1
963 nmdc:mga00v17_32062_c1
964 nmdc:mga0yw44_11138_c1
965 nmdc:mga0yw44_1423_c1
966 nmdc:mga0k408_11588_c1
967 nmdc:mga0k408_12855_c1
968 nmdc:mga0k408_24370_c1
969 nmdc:mga0k408_2502_c1
970 nmdc:mga0k408_27247_c1
971 nmdc:mga0k408_3973_c1
972 nmdc:mga0k408_6131_c1
973 nmdc:mga07m45_11029_c1
974 nmdc:mga07m45_1206_c1
975 nmdc:mga07m45_22278_c1
976 nmdc:mga07m45_518_c1
977 nmdc:mga07m45_592_c1
978 nmdc:mga07m45_604_c1
979 nmdc:mga09592_1383_c1
980 nmdc:mga0qj67_24072_c1
981 Ga0500578_0011500
982 Ga0500644_0002122
983 Ga0500651_0000035
984 Ga0500593_000697
985 Ga0500608_016249
986 Ga0500658_0001949
987 Ga0500658_0002275
988 Ga0500658_0007036
989 Ga0500559_0000027
990 Ga0500559_0001134
991 Ga0500619_001089
992 Ga0500622_0001323
993 Ga0500627_0003584
994 Ga0500645_001561
995 Ga0500645_012002
996 Ga0500587_000799
997 2513228114
998 2548501923
999 2599621297
1000 2599675316
1001 2599678086
1002 2599690808
1003 2643866446
1004 2643991875
1005 2644057313
1006 2644072590
1007 2644161156
1008 2644293254
1009 2644303629
1010 2644325622
1011 2644339795
1012 2644400991
1013 2644469706
1014 2644647258
1015 2738723128
1016 2738882590
1017 2739241577
1018 2739249830
1019 2739283859
1020 2816471119
1021 2819602799
1022 2831270155
1023 2838061798
1024 2842681445
1025 2842722032
1026 2842737344
1027 2842749920
1028 2881104682
1029 2885195795
1030 2885201421
1031 2885215075
1032 2899927935
1033 2904454241
1034 2904462998
1035 2904545849
1036 2919467931
1037 2928042457
1038 2928048482
1039 2928054807
1040 2928068226
1041 2928073885
1042 2928086165
1043 2928120569
1044 2929161035
1045 2929525009
1046 2945915914
1047 2945950133
1048 2945975220
1049 2945988654
1050 2954770396
1051 2974321853
1052 2990714489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

312

364

0.94

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

510

582

0.89

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

622

734

0.86

Map