F459392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 343 | 1052 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10094460|Ga0111539_100944606 |
| Length | 400 |
| Sequence | MQFGRAVPTIVSPRRMVGTARFQSHHLLRARRNAPLPTLHFIMRTDLFDFELPADRIALRPVSPRDAAQLLVVRPGQASEYEDRGIADLPDLLAPGDALVFNDTRVIAARLSGRRVGRGEEPRIEATLTKRLDGSRWRALVRPAKKLKPGDVVRFGEEGRVCFLGQLDATVEEKGHEGEVTLAFAFHGPVLDSAIDERGDMPLPPYIASRRPPDARDRDDYQTMFARQEGSVAAPTAALHFTENLVERLRQRGVALHFVTLHVGPGTFLPVKADDTSAHHMHPEWGTVSPETASALNAVHRAGGRIVAVGSTSLRLLETAATDDGALRPFSGDTALFITPGDRFRVVDVMLTNFHLPRSTLFMLVAAFSGLDVMQRAYAHAIRAGYRFYSYGDACLLFRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 325 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 335 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 336 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 337 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 338 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 339 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 340 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 341 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 342 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 343 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0 |
| Isolates | 1.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.27 |
| Nodule | 0 |
| Rhizoplane | 9.89 |
| Rhizosphere | 81.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10094460 | 3300009094 | Bacteria | 3513 |
| 2 | Ga0055536_1000689 | 3300003781 | Bacteria | 22680 |
| 3 | Ga0055536_1000750 | 3300003781 | Bacteria | 21664 |
| 4 | Ga0055530_10001625 | 3300003791 | Bacteria | 16093 |
| 5 | Ga0055530_10004094 | 3300003791 | Bacteria | 7762 |
| 6 | Ga0055531_10000307 | 3300003794 | Bacteria | 48396 |
| 7 | Ga0070676_10006454 | 3300005328 | Bacteria | 6270 |
| 8 | Ga0070690_100000610 | 3300005330 | Bacteria | 18087 |
| 9 | Ga0070670_100001815 | 3300005331 | Bacteria | 17406 |
| 10 | Ga0070666_10002138 | 3300005335 | Bacteria | 12008 |
| 11 | Ga0070680_100027419 | 3300005336 | Bacteria | 4561 |
| 12 | Ga0070660_100083717 | 3300005339 | Bacteria | 2506 |
| 13 | Ga0070660_100170271 | 3300005339 | Bacteria | 1759 |
| 14 | Ga0070689_100001684 | 3300005340 | Bacteria | 14130 |
| 15 | Ga0070689_100009603 | 3300005340 | Bacteria | 6865 |
| 16 | Ga0070691_10045255 | 3300005341 | Bacteria | 2088 |
| 17 | Ga0070661_100004008 | 3300005344 | Bacteria | 10125 |
| 18 | Ga0070692_10003164 | 3300005345 | Bacteria | 6610 |
| 19 | Ga0070668_100006577 | 3300005347 | Bacteria | 8609 |
| 20 | Ga0070669_100001652 | 3300005353 | Bacteria | 16134 |
| 21 | Ga0070675_100001837 | 3300005354 | Bacteria | 15692 |
| 22 | Ga0070671_100010824 | 3300005355 | Bacteria | 7319 |
| 23 | Ga0070674_100002900 | 3300005356 | Bacteria | 9496 |
| 24 | Ga0070674_100232351 | 3300005356 | Bacteria | 1440 |
| 25 | Ga0070673_100000178 | 3300005364 | Bacteria | 31036 |
| 26 | Ga0070673_100228694 | 3300005364 | Bacteria | 1613 |
| 27 | Ga0070688_100001229 | 3300005365 | Bacteria | 12784 |
| 28 | Ga0070659_100007056 | 3300005366 | Bacteria | 8139 |
| 29 | Ga0070667_100011689 | 3300005367 | Bacteria | 7256 |
| 30 | Ga0070667_100211545 | 3300005367 | Bacteria | 1723 |
| 31 | Ga0070703_10005299 | 3300005406 | Bacteria | 3601 |
| 32 | Ga0070709_10016209 | 3300005434 | Bacteria | 4250 |
| 33 | Ga0070714_100029999 | 3300005435 | Bacteria | 4525 |
| 34 | Ga0070713_100011743 | 3300005436 | Bacteria | 6395 |
| 35 | Ga0070710_10002055 | 3300005437 | Bacteria | 9535 |
| 36 | Ga0070701_10139826 | 3300005438 | Bacteria | 1383 |
| 37 | Ga0070711_100014106 | 3300005439 | Bacteria | 5029 |
| 38 | Ga0070711_100067472 | 3300005439 | Bacteria | 2510 |
| 39 | Ga0070705_100001032 | 3300005440 | Bacteria | 15518 |
| 40 | Ga0070700_100044677 | 3300005441 | Bacteria | 2730 |
| 41 | Ga0070700_100144883 | 3300005441 | Bacteria | 1618 |
| 42 | Ga0070694_100000754 | 3300005444 | Bacteria | 18116 |
| 43 | Ga0070663_100001099 | 3300005455 | Bacteria | 14848 |
| 44 | Ga0070678_100002107 | 3300005456 | Bacteria | 10790 |
| 45 | Ga0070662_100003112 | 3300005457 | Bacteria | 10304 |
| 46 | Ga0070681_10146561 | 3300005458 | Bacteria | 2289 |
| 47 | Ga0068867_100056422 | 3300005459 | Bacteria | 2906 |
| 48 | Ga0070679_100150659 | 3300005530 | Bacteria | 2303 |
| 49 | Ga0070684_100013716 | 3300005535 | Bacteria | 6541 |
| 50 | Ga0070697_100002089 | 3300005536 | Bacteria | 15283 |
| 51 | Ga0068853_100002601 | 3300005539 | Bacteria | 13569 |
| 52 | Ga0068853_100016114 | 3300005539 | Bacteria | 6147 |
| 53 | Ga0070672_100004259 | 3300005543 | Bacteria | 9355 |
| 54 | Ga0070686_100028638 | 3300005544 | Bacteria | 3380 |
| 55 | Ga0070686_100093949 | 3300005544 | Bacteria | 2012 |
| 56 | Ga0070695_100001920 | 3300005545 | Bacteria | 11764 |
| 57 | Ga0070696_100001022 | 3300005546 | Bacteria | 18054 |
| 58 | Ga0070693_100002127 | 3300005547 | Bacteria | 9068 |
| 59 | Ga0070665_100022148 | 3300005548 | Bacteria | 6391 |
| 60 | Ga0070704_100000591 | 3300005549 | Bacteria | 17382 |
| 61 | Ga0068855_100046800 | 3300005563 | Bacteria | 5112 |
| 62 | Ga0070664_100016985 | 3300005564 | Bacteria | 5973 |
| 63 | Ga0068857_100006522 | 3300005577 | Bacteria | 10013 |
| 64 | Ga0068854_100012704 | 3300005578 | Bacteria | 5514 |
| 65 | Ga0068856_100019043 | 3300005614 | Bacteria | 6660 |
| 66 | Ga0068856_100162187 | 3300005614 | Bacteria | 2246 |
| 67 | Ga0070702_100000503 | 3300005615 | Bacteria | 14034 |
| 68 | Ga0070702_100005628 | 3300005615 | Bacteria | 5860 |
| 69 | Ga0068852_100005695 | 3300005616 | Bacteria | 8936 |
| 70 | Ga0068859_100006718 | 3300005617 | Bacteria | 11686 |
| 71 | Ga0068864_100054195 | 3300005618 | Bacteria | 3461 |
| 72 | Ga0068866_10001746 | 3300005718 | Bacteria | 9141 |
| 73 | Ga0068861_100005178 | 3300005719 | Bacteria | 8797 |
| 74 | Ga0068863_100031708 | 3300005841 | Bacteria | 5042 |
| 75 | Ga0068858_100034409 | 3300005842 | Bacteria | 4699 |
| 76 | Ga0068860_100014904 | 3300005843 | Bacteria | 7601 |
| 77 | Ga0068860_100164978 | 3300005843 | Bacteria | 2138 |
| 78 | Ga0068862_100006841 | 3300005844 | Bacteria | 9453 |
| 79 | Ga0068862_100114361 | 3300005844 | Bacteria | 2372 |
| 80 | Ga0081455_10003512 | 3300005937 | Bacteria | 18009 |
| 81 | Ga0081540_1000762 | 3300005983 | Bacteria | 29651 |
| 82 | Ga0081540_1010588 | 3300005983 | Bacteria | 6231 |
| 83 | Ga0075365_10034315 | 3300006038 | Bacteria | 3276 |
| 84 | Ga0075364_10055588 | 3300006051 | Bacteria | 2590 |
| 85 | Ga0070715_10002047 | 3300006163 | Bacteria | 6081 |
| 86 | Ga0070716_100000897 | 3300006173 | Bacteria | 12870 |
| 87 | Ga0070712_100004972 | 3300006175 | Bacteria | 8224 |
| 88 | Ga0070712_100017748 | 3300006175 | Bacteria | 4610 |
| 89 | Ga0070712_100036199 | 3300006175 | Bacteria | 3357 |
| 90 | Ga0075367_10086146 | 3300006178 | Bacteria | 1906 |
| 91 | Ga0075369_10002442 | 3300006186 | Bacteria | 6627 |
| 92 | Ga0075366_10071641 | 3300006195 | Bacteria | 2065 |
| 93 | Ga0097621_100243010 | 3300006237 | Bacteria | 1574 |
| 94 | Ga0068871_100134613 | 3300006358 | Bacteria | 2098 |
| 95 | Ga0075428_100151733 | 3300006844 | Bacteria | 2517 |
| 96 | Ga0075430_100000184 | 3300006846 | Bacteria | 41914 |
| 97 | Ga0075430_100057643 | 3300006846 | Bacteria | 3267 |
| 98 | Ga0075431_100104659 | 3300006847 | Bacteria | 2920 |
| 99 | Ga0075431_100141016 | 3300006847 | Bacteria | 2484 |
| 100 | Ga0075431_100193606 | 3300006847 | Bacteria | 2082 |
| 101 | Ga0075433_10032682 | 3300006852 | Bacteria | 4458 |
| 102 | Ga0075433_10324687 | 3300006852 | Bacteria | 1361 |
| 103 | Ga0075434_100023235 | 3300006871 | Bacteria | 6039 |
| 104 | Ga0075434_100076270 | 3300006871 | Bacteria | 3347 |
| 105 | Ga0075434_100180360 | 3300006871 | Bacteria | 2132 |
| 106 | Ga0075434_100236449 | 3300006871 | Bacteria | 1847 |
| 107 | Ga0075429_100287795 | 3300006880 | Bacteria | 1439 |
| 108 | Ga0075429_100315959 | 3300006880 | Bacteria | 1367 |
| 109 | Ga0068865_100001831 | 3300006881 | Bacteria | 12494 |
| 110 | Ga0068865_100015795 | 3300006881 | Bacteria | 4818 |
| 111 | Ga0075436_100229322 | 3300006914 | Bacteria | 1319 |
| 112 | Ga0097620_100006718 | 3300006931 | Bacteria | 11686 |
| 113 | Ga0075435_100211854 | 3300007076 | Bacteria | 1644 |
| 114 | Ga0105240_10029175 | 3300009093 | Bacteria | 7194 |
| 115 | Ga0111539_10107927 | 3300009094 | Bacteria | 3266 |
| 116 | Ga0105247_10001700 | 3300009101 | Bacteria | 15532 |
| 117 | Ga0114129_10004024 | 3300009147 | Bacteria | 20739 |
| 118 | Ga0114129_10097903 | 3300009147 | Bacteria | 4061 |
| 119 | Ga0105243_10006393 | 3300009148 | Bacteria | 9103 |
| 120 | Ga0105241_10004531 | 3300009174 | Bacteria | 10280 |
| 121 | Ga0105242_10003507 | 3300009176 | Bacteria | 12190 |
| 122 | Ga0105242_10123359 | 3300009176 | Bacteria | 2227 |
| 123 | Ga0105248_10017589 | 3300009177 | Bacteria | 7885 |
| 124 | Ga0105248_10146055 | 3300009177 | Bacteria | 2669 |
| 125 | Ga0105237_10042872 | 3300009545 | Bacteria | 4561 |
| 126 | Ga0105238_10047170 | 3300009551 | Bacteria | 4345 |
| 127 | Ga0105238_10298769 | 3300009551 | Bacteria | 1593 |
| 128 | Ga0105249_10005672 | 3300009553 | Bacteria | 10798 |
| 129 | Ga0105249_10014958 | 3300009553 | Bacteria | 6862 |
| 130 | Ga0105246_10001845 | 3300011119 | Bacteria | 12721 |
| 131 | Ga0157373_10007439 | 3300013100 | Bacteria | 8146 |
| 132 | Ga0157373_10019877 | 3300013100 | Bacteria | 4885 |
| 133 | Ga0157371_10004963 | 3300013102 | Bacteria | 11425 |
| 134 | Ga0157370_10064469 | 3300013104 | Bacteria | 3469 |
| 135 | Ga0157369_10019012 | 3300013105 | Bacteria | 7694 |
| 136 | Ga0157369_10301019 | 3300013105 | Bacteria | 1668 |
| 137 | Ga0157374_10008799 | 3300013296 | Bacteria | 8640 |
| 138 | Ga0163162_10005855 | 3300013306 | Bacteria | 11893 |
| 139 | Ga0163162_10382928 | 3300013306 | Bacteria | 1540 |
| 140 | Ga0157372_10016968 | 3300013307 | Bacteria | 7817 |
| 141 | Ga0157375_10002853 | 3300013308 | Bacteria | 14966 |
| 142 | Ga0157375_10246405 | 3300013308 | Bacteria | 1947 |
| 143 | Ga0163163_10284633 | 3300014325 | Bacteria | 1705 |
| 144 | Ga0157377_10056121 | 3300014745 | Bacteria | 2235 |
| 145 | Ga0157379_10003063 | 3300014968 | Bacteria | 14133 |
| 146 | Ga0157379_10023810 | 3300014968 | Bacteria | 5435 |
| 147 | Ga0157376_10000570 | 3300014969 | Bacteria | 23753 |
| 148 | Ga0163161_10004937 | 3300017792 | Bacteria | 9279 |
| 149 | Ga0163161_10005377 | 3300017792 | Bacteria | 8895 |
| 150 | Ga0209233_1026553 | 3300025261 | Bacteria | 1414 |
| 151 | Ga0209676_1000136 | 3300025292 | Bacteria | 181860 |
| 152 | Ga0209676_1000200 | 3300025292 | Bacteria | 133793 |
| 153 | Ga0209050_1000057 | 3300025298 | Bacteria | 326289 |
| 154 | Ga0209050_1000568 | 3300025298 | Bacteria | 59952 |
| 155 | Ga0209051_1000836 | 3300025303 | Bacteria | 31706 |
| 156 | Ga0209257_1000142 | 3300025304 | Bacteria | 200756 |
| 157 | Ga0209257_1008523 | 3300025304 | Bacteria | 5796 |
| 158 | Ga0207696_1011469 | 3300025711 | Bacteria | 3188 |
| 159 | Ga0207692_10004819 | 3300025898 | Bacteria | 5365 |
| 160 | Ga0207692_10022950 | 3300025898 | Bacteria | 2879 |
| 161 | Ga0207642_10003910 | 3300025899 | Bacteria | 4752 |
| 162 | Ga0207688_10006083 | 3300025901 | Bacteria | 6565 |
| 163 | Ga0207688_10061769 | 3300025901 | Bacteria | 2112 |
| 164 | Ga0207680_10019280 | 3300025903 | Bacteria | 3645 |
| 165 | Ga0207647_10009635 | 3300025904 | Bacteria | 6857 |
| 166 | Ga0207685_10000315 | 3300025905 | Bacteria | 7745 |
| 167 | Ga0207699_10056913 | 3300025906 | Bacteria | 2333 |
| 168 | Ga0207645_10002711 | 3300025907 | Bacteria | 13796 |
| 169 | Ga0207643_10056900 | 3300025908 | Bacteria | 2225 |
| 170 | Ga0207705_10033846 | 3300025909 | Bacteria | 3652 |
| 171 | Ga0207654_10020566 | 3300025911 | Bacteria | 3501 |
| 172 | Ga0207707_10070603 | 3300025912 | Bacteria | 3043 |
| 173 | Ga0207707_10295676 | 3300025912 | Bacteria | 1401 |
| 174 | Ga0207695_10034247 | 3300025913 | Bacteria | 5528 |
| 175 | Ga0207693_10005832 | 3300025915 | Bacteria | 10221 |
| 176 | Ga0207693_10009760 | 3300025915 | Bacteria | 7815 |
| 177 | Ga0207693_10064726 | 3300025915 | Bacteria | 2864 |
| 178 | Ga0207660_10060813 | 3300025917 | Bacteria | 2717 |
| 179 | Ga0207657_10001866 | 3300025919 | Bacteria | 22797 |
| 180 | Ga0207657_10061464 | 3300025919 | Bacteria | 3221 |
| 181 | Ga0207649_10003925 | 3300025920 | Bacteria | 8112 |
| 182 | Ga0207652_10040109 | 3300025921 | Bacteria | 3975 |
| 183 | Ga0207652_10113660 | 3300025921 | Bacteria | 2403 |
| 184 | Ga0207652_10121335 | 3300025921 | Bacteria | 2326 |
| 185 | Ga0207681_10002877 | 3300025923 | Bacteria | 10880 |
| 186 | Ga0207694_10118449 | 3300025924 | Bacteria | 2112 |
| 187 | Ga0207650_10003214 | 3300025925 | Bacteria | 11266 |
| 188 | Ga0207659_10005097 | 3300025926 | Bacteria | 7963 |
| 189 | Ga0207687_10006111 | 3300025927 | Bacteria | 7970 |
| 190 | Ga0207664_10016876 | 3300025929 | Bacteria | 5338 |
| 191 | Ga0207664_10020295 | 3300025929 | Bacteria | 4922 |
| 192 | Ga0207644_10036741 | 3300025931 | Bacteria | 3440 |
| 193 | Ga0207690_10005451 | 3300025932 | Bacteria | 7499 |
| 194 | Ga0207706_10001431 | 3300025933 | Bacteria | 23899 |
| 195 | Ga0207686_10205753 | 3300025934 | Bacteria | 1412 |
| 196 | Ga0207709_10011736 | 3300025935 | Bacteria | 4830 |
| 197 | Ga0207670_10041153 | 3300025936 | Bacteria | 3037 |
| 198 | Ga0207669_10035805 | 3300025937 | Bacteria | 2829 |
| 199 | Ga0207704_10008153 | 3300025938 | Bacteria | 4990 |
| 200 | Ga0207665_10002101 | 3300025939 | Bacteria | 13465 |
| 201 | Ga0207711_10107406 | 3300025941 | Bacteria | 2478 |
| 202 | Ga0207661_10037213 | 3300025944 | Bacteria | 3805 |
| 203 | Ga0207679_10140179 | 3300025945 | Bacteria | 1953 |
| 204 | Ga0207651_10004133 | 3300025960 | Bacteria | 7252 |
| 205 | Ga0207668_10186940 | 3300025972 | Bacteria | 1638 |
| 206 | Ga0207668_10187642 | 3300025972 | Bacteria | 1636 |
| 207 | Ga0207640_10043745 | 3300025981 | Bacteria | 2864 |
| 208 | Ga0207658_10007506 | 3300025986 | Bacteria | 7427 |
| 209 | Ga0207658_10095163 | 3300025986 | Bacteria | 2320 |
| 210 | Ga0207677_10271896 | 3300026023 | Bacteria | 1387 |
| 211 | Ga0207703_10207185 | 3300026035 | Bacteria | 1746 |
| 212 | Ga0207639_10022411 | 3300026041 | Bacteria | 4550 |
| 213 | Ga0207639_10124471 | 3300026041 | Bacteria | 2124 |
| 214 | Ga0207639_10256449 | 3300026041 | Bacteria | 1527 |
| 215 | Ga0207678_10002104 | 3300026067 | Bacteria | 18028 |
| 216 | Ga0207708_10001818 | 3300026075 | Bacteria | 15746 |
| 217 | Ga0207708_10210519 | 3300026075 | Bacteria | 1554 |
| 218 | Ga0207702_10008843 | 3300026078 | Bacteria | 8488 |
| 219 | Ga0207702_10144045 | 3300026078 | Bacteria | 2160 |
| 220 | Ga0207702_10253238 | 3300026078 | Bacteria | 1654 |
| 221 | Ga0207641_10326889 | 3300026088 | Bacteria | 1455 |
| 222 | Ga0207648_10011227 | 3300026089 | Bacteria | 8446 |
| 223 | Ga0207674_10004952 | 3300026116 | Bacteria | 15911 |
| 224 | Ga0207675_100000249 | 3300026118 | Bacteria | 51517 |
| 225 | Ga0207675_100076325 | 3300026118 | Bacteria | 3138 |
| 226 | Ga0207683_10001156 | 3300026121 | Bacteria | 24004 |
| 227 | Ga0207683_10058139 | 3300026121 | Bacteria | 3395 |
| 228 | Ga0207683_10211819 | 3300026121 | Bacteria | 1764 |
| 229 | Ga0207698_10010099 | 3300026142 | Bacteria | 6047 |
| 230 | Ga0268266_10023678 | 3300028379 | Bacteria | 5227 |
| 231 | Ga0268264_10005008 | 3300028381 | Bacteria | 11210 |
| 232 | Ga0307515_10056829 | 3300028794 | Bacteria | 5677 |
| 233 | Ga0265338_10088214 | 3300028800 | Bacteria | 2575 |
| 234 | Ga0265325_10002730 | 3300031241 | Bacteria | 11787 |
| 235 | Ga0265325_10009871 | 3300031241 | Bacteria | 5558 |
| 236 | Ga0307513_10058634 | 3300031456 | Bacteria | 4090 |
| 237 | Ga0265313_10017035 | 3300031595 | Bacteria | 4150 |
| 238 | Ga0316579_10115121 | 3300031691 | Bacteria | 1291 |
| 239 | Ga0265314_10135445 | 3300031711 | Bacteria | 1530 |
| 240 | Ga0265342_10014994 | 3300031712 | Bacteria | 5118 |
| 241 | Ga0373938_0005178 | 3300034957 | Bacteria | 2209 |
| 242 | Ga0373926_0000693 | 3300035083 | Bacteria | 9301 |
| 243 | Ga0373929_0015725 | 3300035085 | Bacteria | 1475 |
| 244 | Ga0373951_0024061 | 3300035091 | Bacteria | 1409 |
| 245 | Ga0373936_0002391 | 3300035113 | Bacteria | 7024 |
| 246 | Ga0373936_0033542 | 3300035113 | Bacteria | 2035 |
| 247 | Ga0373939_0006158 | 3300035114 | Bacteria | 2884 |
| 248 | Ga0373939_0042429 | 3300035114 | Bacteria | 1375 |
| 249 | Ga0373941_0008486 | 3300035115 | Bacteria | 2553 |
| 250 | Ga0373945_0005113 | 3300035116 | Bacteria | 4186 |
| 251 | Ga0373945_0008225 | 3300035116 | Bacteria | 3393 |
| 252 | Ga0373954_0002383 | 3300035118 | Bacteria | 7863 |
| 253 | Ga0373957_0010302 | 3300035120 | Bacteria | 3086 |
| 254 | Ga0373943_0000268 | 3300035170 | Bacteria | 21475 |
| 255 | Ga0373943_0036377 | 3300035170 | Bacteria | 2358 |
| 256 | Ga0373946_0034498 | 3300035171 | Bacteria | 2043 |
| 257 | Ga0373955_0000399 | 3300035172 | Bacteria | 18379 |
| 258 | Ga0373961_0005801 | 3300035241 | Bacteria | 2964 |
| 259 | Ga0373924_0001527 | 3300035410 | Bacteria | 7550 |
| 260 | Ga0373931_0004198 | 3300035691 | Bacteria | 6560 |
| 261 | Ga0373931_0026950 | 3300035691 | Bacteria | 2929 |
| 262 | Ga0373931_0044485 | 3300035691 | Bacteria | 2342 |
| 263 | Ga0373931_0051276 | 3300035691 | Bacteria | 2197 |
| 264 | Ga0373931_0146765 | 3300035691 | Bacteria | 1372 |
| 265 | Ga0373935_0000286 | 3300035692 | Bacteria | 24948 |
| 266 | Ga0373935_0026063 | 3300035692 | Bacteria | 3605 |
| 267 | Ga0373935_0032185 | 3300035692 | Bacteria | 3258 |
| 268 | Ga0373935_0159801 | 3300035692 | Bacteria | 1535 |
| 269 | Ga0373935_0274400 | 3300035692 | Bacteria | 1186 |
| 270 | Ga0373927_0001748 | 3300035695 | Bacteria | 16212 |
| 271 | Ga0373927_0005366 | 3300035695 | Bacteria | 8856 |
| 272 | Ga0373927_0036597 | 3300035695 | Bacteria | 3191 |
| 273 | Ga0373927_0040440 | 3300035695 | Bacteria | 3024 |
| 274 | Ga0373933_0005496 | 3300035724 | Bacteria | 6905 |
| 275 | Ga0373947_0001270 | 3300035725 | Bacteria | 15552 |
| 276 | Ga0373947_0007076 | 3300035725 | Bacteria | 6502 |
| 277 | Ga0373947_0007690 | 3300035725 | Bacteria | 6228 |
| 278 | Ga0373947_0010286 | 3300035725 | Bacteria | 5368 |
| 279 | Ga0373937_0000695 | 3300036401 | Bacteria | 29345 |
| 280 | Ga0373925_0000019 | 3300037068 | Bacteria | 170628 |
| 281 | Ga0373925_0012774 | 3300037068 | Bacteria | 6083 |
| 282 | Ga0373925_0028134 | 3300037068 | Bacteria | 4117 |
| 283 | Ga0395900_0005362 | 3300037418 | Bacteria | 13439 |
| 284 | Ga0395898_0008423 | 3300037466 | Bacteria | 10902 |
| 285 | Ga0395905_0002905 | 3300037471 | Bacteria | 18696 |
| 286 | Ga0395901_0063898 | 3300038443 | Bacteria | 3831 |
| 287 | Ga0436365_0734149 | 3300039437 | Bacteria | 2024 |
| 288 | Ga0436365_1795903 | 3300039437 | Bacteria | 1372 |
| 289 | Ga0451576_0203921 | 3300045051 | Bacteria | 2065 |
| 290 | Ga0466967_0025986 | 3300045976 | Bacteria | 4840 |
| 291 | Ga0495592_0000005 | 3300046454 | Bacteria | 194493 |
| 292 | Ga0495592_0167865 | 3300046454 | Bacteria | 1505 |
| 293 | Ga0495603_0000114 | 3300046455 | Bacteria | 38942 |
| 294 | Ga0495590_0001808 | 3300046457 | Bacteria | 9060 |
| 295 | Ga0495629_0000430 | 3300046459 | Bacteria | 34982 |
| 296 | Ga0495629_0037713 | 3300046459 | Bacteria | 3406 |
| 297 | Ga0495629_0067171 | 3300046459 | Bacteria | 2502 |
| 298 | Ga0495638_0000600 | 3300046460 | Bacteria | 40531 |
| 299 | Ga0495638_0017040 | 3300046460 | Bacteria | 4854 |
| 300 | Ga0495638_0141988 | 3300046460 | Bacteria | 1400 |
| 301 | Ga0495641_0006916 | 3300046461 | Bacteria | 7238 |
| 302 | Ga0495651_0014746 | 3300046462 | Bacteria | 6043 |
| 303 | Ga0495653_0000017 | 3300046463 | Bacteria | 190660 |
| 304 | Ga0495650_0067344 | 3300046471 | Bacteria | 1415 |
| 305 | Ga0495580_0000080 | 3300046472 | Bacteria | 61309 |
| 306 | Ga0495580_0101972 | 3300046472 | Bacteria | 1995 |
| 307 | Ga0495582_0002704 | 3300046473 | Bacteria | 9893 |
| 308 | Ga0495582_0044243 | 3300046473 | Bacteria | 2453 |
| 309 | Ga0495639_0002522 | 3300046475 | Bacteria | 7995 |
| 310 | Ga0495662_0000724 | 3300046476 | Bacteria | 15776 |
| 311 | Ga0495662_0019870 | 3300046476 | Bacteria | 3249 |
| 312 | Ga0495664_0000014 | 3300046477 | Bacteria | 193962 |
| 313 | Ga0495664_0001240 | 3300046477 | Bacteria | 13352 |
| 314 | Ga0495594_0005083 | 3300046499 | Bacteria | 6770 |
| 315 | Ga0495608_0000034 | 3300046511 | Bacteria | 136686 |
| 316 | Ga0495610_0065308 | 3300046512 | Bacteria | 1717 |
| 317 | Ga0495618_0000011 | 3300046514 | Bacteria | 179208 |
| 318 | Ga0495618_0000925 | 3300046514 | Bacteria | 20165 |
| 319 | Ga0495628_0000017 | 3300046516 | Bacteria | 169983 |
| 320 | Ga0495630_0000472 | 3300046517 | Bacteria | 30208 |
| 321 | Ga0495630_0296067 | 3300046517 | Bacteria | 1236 |
| 322 | Ga0495631_0003894 | 3300046518 | Bacteria | 8075 |
| 323 | Ga0495648_0001025 | 3300046524 | Bacteria | 28499 |
| 324 | Ga0495666_0042384 | 3300046526 | Bacteria | 2201 |
| 325 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 326 | Ga0495652_0073238 | 3300046529 | Bacteria | 2853 |
| 327 | Ga0495665_0016593 | 3300046531 | Bacteria | 3967 |
| 328 | Ga0495665_0106375 | 3300046531 | Bacteria | 1472 |
| 329 | Ga0495640_0000024 | 3300046533 | Bacteria | 99088 |
| 330 | Ga0495640_0000947 | 3300046533 | Bacteria | 22435 |
| 331 | Ga0495640_0014456 | 3300046533 | Bacteria | 5973 |
| 332 | Ga0495587_0000039 | 3300046536 | Bacteria | 114200 |
| 333 | Ga0495597_0009230 | 3300046542 | Bacteria | 4887 |
| 334 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 335 | Ga0495645_0031508 | 3300046543 | Bacteria | 3864 |
| 336 | Ga0495622_0005445 | 3300046557 | Bacteria | 5907 |
| 337 | Ga0495667_0000026 | 3300046559 | Bacteria | 154971 |
| 338 | Ga0495668_0000014 | 3300046616 | Bacteria | 442055 |
| 339 | Ga0495668_0006444 | 3300046616 | Bacteria | 7683 |
| 340 | Ga0495634_0000009 | 3300046642 | Bacteria | 162893 |
| 341 | Ga0495634_0000941 | 3300046642 | Bacteria | 27590 |
| 342 | Ga0495634_0010307 | 3300046642 | Bacteria | 6849 |
| 343 | Ga0495634_0011375 | 3300046642 | Bacteria | 6483 |
| 344 | Ga0495625_0018457 | 3300046660 | Bacteria | 5445 |
| 345 | Ga0495635_0000014 | 3300046663 | Bacteria | 218080 |
| 346 | Ga0495635_0004745 | 3300046663 | Bacteria | 9447 |
| 347 | Ga0495588_0007588 | 3300046674 | Bacteria | 4946 |
| 348 | Ga0495657_0000038 | 3300046675 | Bacteria | 117535 |
| 349 | Ga0495599_0000010 | 3300046678 | Bacteria | 211658 |
| 350 | Ga0495623_0000074 | 3300046679 | Bacteria | 59542 |
| 351 | Ga0495646_0000008 | 3300046680 | Bacteria | 214486 |
| 352 | Ga0495647_0001891 | 3300046681 | Bacteria | 6519 |
| 353 | Ga0495647_0023940 | 3300046681 | Bacteria | 2219 |
| 354 | Ga0495658_0002490 | 3300046683 | Bacteria | 9267 |
| 355 | Ga0495613_0000335 | 3300046689 | Bacteria | 42318 |
| 356 | Ga0495613_0022544 | 3300046689 | Bacteria | 4690 |
| 357 | Ga0495624_0001454 | 3300046690 | Bacteria | 18421 |
| 358 | Ga0495600_0000213 | 3300046809 | Bacteria | 32833 |
| 359 | Ga0495581_0038077 | 3300047315 | Bacteria | 2783 |
| 360 | Ga0495604_0000006 | 3300047317 | Bacteria | 420480 |
| 361 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 362 | Ga0495674_0000859 | 3300047319 | Bacteria | 29014 |
| 363 | Ga0495674_0034072 | 3300047319 | Bacteria | 4607 |
| 364 | Ga0495676_0023022 | 3300047321 | Bacteria | 5413 |
| 365 | Ga0495676_0144489 | 3300047321 | Bacteria | 1701 |
| 366 | Ga0495680_0008445 | 3300047322 | Bacteria | 9361 |
| 367 | Ga0495680_0014658 | 3300047322 | Bacteria | 6780 |
| 368 | Ga0495675_0000044 | 3300047444 | Bacteria | 83527 |
| 369 | Ga0495673_0000123 | 3300047469 | Bacteria | 144484 |
| 370 | Ga0495684_0000015 | 3300047471 | Bacteria | 169596 |
| 371 | Ga0495684_0001275 | 3300047471 | Bacteria | 20286 |
| 372 | Ga0495684_0002706 | 3300047471 | Bacteria | 14030 |
| 373 | Ga0495686_0003073 | 3300047472 | Bacteria | 14792 |
| 374 | Ga0495686_0082493 | 3300047472 | Bacteria | 1962 |
| 375 | Ga0495593_0000148 | 3300047673 | Bacteria | 34657 |
| 376 | Ga0495593_0000735 | 3300047673 | Bacteria | 19005 |
| 377 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 378 | Ga0495602_0114619 | 3300048088 | Bacteria | 2182 |
| 379 | Ga0495614_0001428 | 3300048089 | Bacteria | 10307 |
| 380 | Ga0496100_0013285 | 3300048903 | Bacteria | 4743 |
| 381 | Ga0496100_0079551 | 3300048903 | Bacteria | 2209 |
| 382 | Ga0496100_0148066 | 3300048903 | Bacteria | 1671 |
| 383 | Ga0496100_0243954 | 3300048903 | Bacteria | 1327 |
| 384 | Ga0496101_0016350 | 3300048904 | Bacteria | 5010 |
| 385 | Ga0496101_0041223 | 3300048904 | Bacteria | 3291 |
| 386 | Ga0496101_0052923 | 3300048904 | Bacteria | 2928 |
| 387 | Ga0496101_0090733 | 3300048904 | Bacteria | 2273 |
| 388 | Ga0496101_0208951 | 3300048904 | Bacteria | 1511 |
| 389 | Ga0496102_0069549 | 3300048905 | Bacteria | 3231 |
| 390 | Ga0496102_0265132 | 3300048905 | Bacteria | 1619 |
| 391 | Ga0496103_0006988 | 3300048906 | Bacteria | 6735 |
| 392 | Ga0496104_0001526 | 3300048907 | Bacteria | 19967 |
| 393 | Ga0496104_0007852 | 3300048907 | Bacteria | 9458 |
| 394 | Ga0496104_0007867 | 3300048907 | Bacteria | 9450 |
| 395 | Ga0496104_0062647 | 3300048907 | Bacteria | 3526 |
| 396 | Ga0496104_0131757 | 3300048907 | Bacteria | 2401 |
| 397 | Ga0496104_0147940 | 3300048907 | Bacteria | 2255 |
| 398 | Ga0496104_0225193 | 3300048907 | Bacteria | 1787 |
| 399 | Ga0496105_0059001 | 3300048908 | Bacteria | 3166 |
| 400 | Ga0496105_0066074 | 3300048908 | Bacteria | 2985 |
| 401 | Ga0496105_0102488 | 3300048908 | Bacteria | 2364 |
| 402 | Ga0496105_0173400 | 3300048908 | Bacteria | 1767 |
| 403 | Ga0496106_0002576 | 3300048909 | Bacteria | 13500 |
| 404 | Ga0496106_0011183 | 3300048909 | Bacteria | 6640 |
| 405 | Ga0496106_0029579 | 3300048909 | Bacteria | 4083 |
| 406 | Ga0496106_0319982 | 3300048909 | Bacteria | 1245 |
| 407 | Ga0496107_0019640 | 3300048910 | Bacteria | 4767 |
| 408 | Ga0496107_0125250 | 3300048910 | Bacteria | 1894 |
| 409 | Ga0496108_0030216 | 3300048911 | Bacteria | 4490 |
| 410 | Ga0496109_0014004 | 3300048912 | Bacteria | 6972 |
| 411 | Ga0496109_0028071 | 3300048912 | Bacteria | 5031 |
| 412 | Ga0496109_0034072 | 3300048912 | Bacteria | 4583 |
| 413 | Ga0496110_0002003 | 3300048913 | Bacteria | 15155 |
| 414 | Ga0496110_0018081 | 3300048913 | Bacteria | 5905 |
| 415 | Ga0496110_0113717 | 3300048913 | Bacteria | 2435 |
| 416 | Ga0496110_0158966 | 3300048913 | Bacteria | 2048 |
| 417 | Ga0496111_0010887 | 3300048914 | Bacteria | 6118 |
| 418 | Ga0496111_0046921 | 3300048914 | Bacteria | 3111 |
| 419 | Ga0496111_0089412 | 3300048914 | Bacteria | 2255 |
| 420 | Ga0496112_0010822 | 3300048915 | Bacteria | 8301 |
| 421 | Ga0496112_0023334 | 3300048915 | Bacteria | 5910 |
| 422 | Ga0496112_0111445 | 3300048915 | Bacteria | 2706 |
| 423 | Ga0496112_0256692 | 3300048915 | Bacteria | 1698 |
| 424 | Ga0496113_0032900 | 3300048916 | Bacteria | 3771 |
| 425 | Ga0496113_0203334 | 3300048916 | Bacteria | 1575 |
| 426 | Ga0496114_0002575 | 3300048917 | Bacteria | 13855 |
| 427 | Ga0496114_0011842 | 3300048917 | Bacteria | 6978 |
| 428 | Ga0496114_0297582 | 3300048917 | Bacteria | 1424 |
| 429 | Ga0496115_0099282 | 3300048918 | Bacteria | 2385 |
| 430 | Ga0496115_0124548 | 3300048918 | Bacteria | 2122 |
| 431 | Ga0496115_0161198 | 3300048918 | Bacteria | 1853 |
| 432 | Ga0496124_0044024 | 3300048927 | Bacteria | 3833 |
| 433 | Ga0496125_0095679 | 3300048928 | Bacteria | 2208 |
| 434 | Ga0496126_0001922 | 3300048929 | Bacteria | 29774 |
| 435 | Ga0495678_001696 | 3300049459 | Bacteria | 16649 |
| 436 | Ga0501032_0079600 | 3300049569 | Bacteria | 2181 |
| 437 | Ga0501033_0090109 | 3300049570 | Bacteria | 2244 |
| 438 | Ga0501036_0047191 | 3300049572 | Bacteria | 3648 |
| 439 | Ga0501037_0008867 | 3300049573 | Bacteria | 7365 |
| 440 | Ga0501037_0210518 | 3300049573 | Bacteria | 1371 |
| 441 | Ga0501037_0232490 | 3300049573 | Bacteria | 1294 |
| 442 | Ga0501038_0003209 | 3300049574 | Bacteria | 15262 |
| 443 | Ga0501039_0103952 | 3300049575 | Bacteria | 2217 |
| 444 | Ga0501039_0215836 | 3300049575 | Bacteria | 1508 |
| 445 | Ga0501040_0071969 | 3300049576 | Bacteria | 2387 |
| 446 | Ga0501040_0131431 | 3300049576 | Bacteria | 1761 |
| 447 | Ga0501041_0029860 | 3300049577 | Bacteria | 3290 |
| 448 | Ga0501041_0107165 | 3300049577 | Bacteria | 1732 |
| 449 | Ga0501042_0069038 | 3300049578 | Bacteria | 2527 |
| 450 | Ga0501042_0097217 | 3300049578 | Bacteria | 2116 |
| 451 | Ga0501046_0032243 | 3300049580 | Bacteria | 4242 |
| 452 | Ga0501046_0155634 | 3300049580 | Bacteria | 1722 |
| 453 | Ga0501048_0002278 | 3300049582 | Bacteria | 14644 |
| 454 | Ga0501048_0021998 | 3300049582 | Bacteria | 4667 |
| 455 | Ga0501067_0022653 | 3300049583 | Bacteria | 3476 |
| 456 | Ga0501068_0105728 | 3300049584 | Bacteria | 1747 |
| 457 | Ga0501069_0000984 | 3300049585 | Bacteria | 13576 |
| 458 | Ga0501071_0064982 | 3300049587 | Bacteria | 2648 |
| 459 | Ga0501072_0023012 | 3300049588 | Bacteria | 4838 |
| 460 | Ga0501072_0180470 | 3300049588 | Bacteria | 1684 |
| 461 | Ga0501073_0019108 | 3300049589 | Bacteria | 4950 |
| 462 | Ga0501075_0027298 | 3300049591 | Bacteria | 4207 |
| 463 | Ga0501075_0054133 | 3300049591 | Bacteria | 3018 |
| 464 | Ga0501075_0075616 | 3300049591 | Bacteria | 2547 |
| 465 | Ga0501076_0085755 | 3300049592 | Bacteria | 2531 |
| 466 | Ga0501076_0309565 | 3300049592 | Bacteria | 1295 |
| 467 | Ga0501080_0274117 | 3300049742 | Bacteria | 1535 |
| 468 | Ga0501081_0030821 | 3300049743 | Bacteria | 3633 |
| 469 | Ga0501035_0096414 | 3300049822 | Bacteria | 2599 |
| 470 | Ga0501044_0001015 | 3300049823 | Bacteria | 33737 |
| 471 | Ga0501044_0321162 | 3300049823 | Bacteria | 1472 |
| 472 | Ga0501045_0026056 | 3300049824 | Bacteria | 4203 |
| 473 | Ga0501045_0058478 | 3300049824 | Bacteria | 2823 |
| 474 | Ga0501045_0163637 | 3300049824 | Bacteria | 1656 |
| 475 | Ga0501045_0178669 | 3300049824 | Bacteria | 1581 |
| 476 | nmdc:mga00v17_96769_c1 | 3300050491 | Bacteria | 1859 |
| 477 | nmdc:mga09592_119911_c1 | 3300050508 | Bacteria | 2259 |
| 478 | nmdc:mga0qj67_17268_c1 | 3300050509 | Bacteria | 5484 |
| 479 | nmdc:mga0qj67_83_c1 | 3300050509 | Bacteria | 63959 |
| 480 | nmdc:mga0qj67_86109_c1 | 3300050509 | Bacteria | 2521 |
| 481 | nmdc:mga06r32_116322_c1 | 3300050510 | Bacteria | 2634 |
| 482 | nmdc:mga06r32_188814_c1 | 3300050510 | Bacteria | 2048 |
| 483 | nmdc:mga06r32_205795_c1 | 3300050510 | Bacteria | 1956 |
| 484 | nmdc:mga06r32_46212_c1 | 3300050510 | Bacteria | 4155 |
| 485 | nmdc:mga0n895_260272_c1 | 3300050512 | Bacteria | 1761 |
| 486 | nmdc:mga0rr50_138535_c1 | 3300050513 | Bacteria | 1955 |
| 487 | nmdc:mga08x19_214181_c1 | 3300050514 | Bacteria | 1323 |
| 488 | nmdc:mga0sz30_8523_c1 | 3300050516 | Bacteria | 3874 |
| 489 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 490 | Ga0495601_0003709 | 3300053077 | Bacteria | 8792 |
| 491 | Ga0495612_0000015 | 3300053078 | Bacteria | 167816 |
| 492 | Ga0495612_0002398 | 3300053078 | Bacteria | 7727 |
| 493 | Ga0495655_0000341 | 3300053083 | Bacteria | 8234 |
| 494 | Ga0495595_0000023 | 3300053084 | Bacteria | 108096 |
| 495 | Ga0495595_0102858 | 3300053084 | Bacteria | 1380 |
| 496 | Ga0495619_0000017 | 3300053085 | Bacteria | 219276 |
| 497 | Ga0495619_0001652 | 3300053085 | Bacteria | 14723 |
| 498 | Ga0495619_0003502 | 3300053085 | Bacteria | 10119 |
| 499 | Ga0495619_0041199 | 3300053085 | Bacteria | 3020 |
| 500 | Ga0500578_0000005 | 3300053086 | Bacteria | 243789 |
| 501 | Ga0500644_0000191 | 3300053088 | Bacteria | 38234 |
| 502 | Ga0500646_0024943 | 3300053090 | Bacteria | 1612 |
| 503 | Ga0500562_000175 | 3300053108 | Bacteria | 17715 |
| 504 | Ga0500594_0000329 | 3300053118 | Bacteria | 10615 |
| 505 | Ga0500608_000093 | 3300053122 | Bacteria | 36398 |
| 506 | Ga0500652_000214 | 3300053131 | Bacteria | 22083 |
| 507 | Ga0500652_041929 | 3300053131 | Bacteria | 1845 |
| 508 | Ga0500559_0016342 | 3300053136 | Bacteria | 3132 |
| 509 | Ga0500564_000070 | 3300053138 | Bacteria | 27126 |
| 510 | Ga0500622_0002118 | 3300053156 | Bacteria | 14773 |
| 511 | Ga0500622_0005697 | 3300053156 | Bacteria | 7405 |
| 512 | Ga0500622_0016249 | 3300053156 | Bacteria | 3978 |
| 513 | Ga0501084_0014003 | 3300054114 | Bacteria | 6639 |
| 514 | Ga0501082_0000012 | 3300060353 | Bacteria | 119898 |
| 515 | Ga0501082_0041351 | 3300060353 | Bacteria | 3974 |
| 516 | Ga0501082_0051672 | 3300060353 | Bacteria | 3542 |
| 517 | 2585149374 | 2582581279 | Bacteria | 4980720 |
| 518 | 2587919721 | 2585428106 | Bacteria | 5179711 |
| 519 | 2644226345 | 2643221640 | Bacteria | 5258820 |
| 520 | 2644235833 | 2643221642 | Bacteria | 5357871 |
| 521 | 2739348208 | 2738543031 | Bacteria | 5769731 |
| 522 | 2851155496 | 2851153111 | Bacteria | 5542585 |
| 523 | 2857506656 | 2857504554 | Bacteria | 5369913 |
| 524 | 2884963957 | 2884960567 | Bacteria | 5437054 |
| 525 | 2898330907 | 2898329390 | Bacteria | 5168154 |
| 526 | 2928533920 | 2928531327 | Bacteria | 5101314 |
| 527 | Ga0111539_10094460 | |||
| 528 | Ga0055536_1000689 | |||
| 529 | Ga0055536_1000750 | |||
| 530 | Ga0055530_10001625 | |||
| 531 | Ga0055530_10004094 | |||
| 532 | Ga0055531_10000307 | |||
| 533 | Ga0070676_10006454 | |||
| 534 | Ga0070690_100000610 | |||
| 535 | Ga0070670_100001815 | |||
| 536 | Ga0070666_10002138 | |||
| 537 | Ga0070680_100027419 | |||
| 538 | Ga0070660_100083717 | |||
| 539 | Ga0070660_100170271 | |||
| 540 | Ga0070689_100001684 | |||
| 541 | Ga0070689_100009603 | |||
| 542 | Ga0070691_10045255 | |||
| 543 | Ga0070661_100004008 | |||
| 544 | Ga0070692_10003164 | |||
| 545 | Ga0070668_100006577 | |||
| 546 | Ga0070669_100001652 | |||
| 547 | Ga0070675_100001837 | |||
| 548 | Ga0070671_100010824 | |||
| 549 | Ga0070674_100002900 | |||
| 550 | Ga0070674_100232351 | |||
| 551 | Ga0070673_100000178 | |||
| 552 | Ga0070673_100228694 | |||
| 553 | Ga0070688_100001229 | |||
| 554 | Ga0070659_100007056 | |||
| 555 | Ga0070667_100011689 | |||
| 556 | Ga0070667_100211545 | |||
| 557 | Ga0070703_10005299 | |||
| 558 | Ga0070709_10016209 | |||
| 559 | Ga0070714_100029999 | |||
| 560 | Ga0070713_100011743 | |||
| 561 | Ga0070710_10002055 | |||
| 562 | Ga0070701_10139826 | |||
| 563 | Ga0070711_100014106 | |||
| 564 | Ga0070711_100067472 | |||
| 565 | Ga0070705_100001032 | |||
| 566 | Ga0070700_100044677 | |||
| 567 | Ga0070700_100144883 | |||
| 568 | Ga0070694_100000754 | |||
| 569 | Ga0070663_100001099 | |||
| 570 | Ga0070678_100002107 | |||
| 571 | Ga0070662_100003112 | |||
| 572 | Ga0070681_10146561 | |||
| 573 | Ga0068867_100056422 | |||
| 574 | Ga0070679_100150659 | |||
| 575 | Ga0070684_100013716 | |||
| 576 | Ga0070697_100002089 | |||
| 577 | Ga0068853_100002601 | |||
| 578 | Ga0068853_100016114 | |||
| 579 | Ga0070672_100004259 | |||
| 580 | Ga0070686_100028638 | |||
| 581 | Ga0070686_100093949 | |||
| 582 | Ga0070695_100001920 | |||
| 583 | Ga0070696_100001022 | |||
| 584 | Ga0070693_100002127 | |||
| 585 | Ga0070665_100022148 | |||
| 586 | Ga0070704_100000591 | |||
| 587 | Ga0068855_100046800 | |||
| 588 | Ga0070664_100016985 | |||
| 589 | Ga0068857_100006522 | |||
| 590 | Ga0068854_100012704 | |||
| 591 | Ga0068856_100019043 | |||
| 592 | Ga0068856_100162187 | |||
| 593 | Ga0070702_100000503 | |||
| 594 | Ga0070702_100005628 | |||
| 595 | Ga0068852_100005695 | |||
| 596 | Ga0068859_100006718 | |||
| 597 | Ga0068864_100054195 | |||
| 598 | Ga0068866_10001746 | |||
| 599 | Ga0068861_100005178 | |||
| 600 | Ga0068863_100031708 | |||
| 601 | Ga0068858_100034409 | |||
| 602 | Ga0068860_100014904 | |||
| 603 | Ga0068860_100164978 | |||
| 604 | Ga0068862_100006841 | |||
| 605 | Ga0068862_100114361 | |||
| 606 | Ga0081455_10003512 | |||
| 607 | Ga0081540_1000762 | |||
| 608 | Ga0081540_1010588 | |||
| 609 | Ga0075365_10034315 | |||
| 610 | Ga0075364_10055588 | |||
| 611 | Ga0070715_10002047 | |||
| 612 | Ga0070716_100000897 | |||
| 613 | Ga0070712_100004972 | |||
| 614 | Ga0070712_100017748 | |||
| 615 | Ga0070712_100036199 | |||
| 616 | Ga0075367_10086146 | |||
| 617 | Ga0075369_10002442 | |||
| 618 | Ga0075366_10071641 | |||
| 619 | Ga0097621_100243010 | |||
| 620 | Ga0068871_100134613 | |||
| 621 | Ga0075428_100151733 | |||
| 622 | Ga0075430_100000184 | |||
| 623 | Ga0075430_100057643 | |||
| 624 | Ga0075431_100104659 | |||
| 625 | Ga0075431_100141016 | |||
| 626 | Ga0075431_100193606 | |||
| 627 | Ga0075433_10032682 | |||
| 628 | Ga0075433_10324687 | |||
| 629 | Ga0075434_100023235 | |||
| 630 | Ga0075434_100076270 | |||
| 631 | Ga0075434_100180360 | |||
| 632 | Ga0075434_100236449 | |||
| 633 | Ga0075429_100287795 | |||
| 634 | Ga0075429_100315959 | |||
| 635 | Ga0068865_100001831 | |||
| 636 | Ga0068865_100015795 | |||
| 637 | Ga0075436_100229322 | |||
| 638 | Ga0097620_100006718 | |||
| 639 | Ga0075435_100211854 | |||
| 640 | Ga0105240_10029175 | |||
| 641 | Ga0111539_10107927 | |||
| 642 | Ga0105247_10001700 | |||
| 643 | Ga0114129_10004024 | |||
| 644 | Ga0114129_10097903 | |||
| 645 | Ga0105243_10006393 | |||
| 646 | Ga0105241_10004531 | |||
| 647 | Ga0105242_10003507 | |||
| 648 | Ga0105242_10123359 | |||
| 649 | Ga0105248_10017589 | |||
| 650 | Ga0105248_10146055 | |||
| 651 | Ga0105237_10042872 | |||
| 652 | Ga0105238_10047170 | |||
| 653 | Ga0105238_10298769 | |||
| 654 | Ga0105249_10005672 | |||
| 655 | Ga0105249_10014958 | |||
| 656 | Ga0105246_10001845 | |||
| 657 | Ga0157373_10007439 | |||
| 658 | Ga0157373_10019877 | |||
| 659 | Ga0157371_10004963 | |||
| 660 | Ga0157370_10064469 | |||
| 661 | Ga0157369_10019012 | |||
| 662 | Ga0157369_10301019 | |||
| 663 | Ga0157374_10008799 | |||
| 664 | Ga0163162_10005855 | |||
| 665 | Ga0163162_10382928 | |||
| 666 | Ga0157372_10016968 | |||
| 667 | Ga0157375_10002853 | |||
| 668 | Ga0157375_10246405 | |||
| 669 | Ga0163163_10284633 | |||
| 670 | Ga0157377_10056121 | |||
| 671 | Ga0157379_10003063 | |||
| 672 | Ga0157379_10023810 | |||
| 673 | Ga0157376_10000570 | |||
| 674 | Ga0163161_10004937 | |||
| 675 | Ga0163161_10005377 | |||
| 676 | Ga0209233_1026553 | |||
| 677 | Ga0209676_1000136 | |||
| 678 | Ga0209676_1000200 | |||
| 679 | Ga0209050_1000057 | |||
| 680 | Ga0209050_1000568 | |||
| 681 | Ga0209051_1000836 | |||
| 682 | Ga0209257_1000142 | |||
| 683 | Ga0209257_1008523 | |||
| 684 | Ga0207696_1011469 | |||
| 685 | Ga0207692_10004819 | |||
| 686 | Ga0207692_10022950 | |||
| 687 | Ga0207642_10003910 | |||
| 688 | Ga0207688_10006083 | |||
| 689 | Ga0207688_10061769 | |||
| 690 | Ga0207680_10019280 | |||
| 691 | Ga0207647_10009635 | |||
| 692 | Ga0207685_10000315 | |||
| 693 | Ga0207699_10056913 | |||
| 694 | Ga0207645_10002711 | |||
| 695 | Ga0207643_10056900 | |||
| 696 | Ga0207705_10033846 | |||
| 697 | Ga0207654_10020566 | |||
| 698 | Ga0207707_10070603 | |||
| 699 | Ga0207707_10295676 | |||
| 700 | Ga0207695_10034247 | |||
| 701 | Ga0207693_10005832 | |||
| 702 | Ga0207693_10009760 | |||
| 703 | Ga0207693_10064726 | |||
| 704 | Ga0207660_10060813 | |||
| 705 | Ga0207657_10001866 | |||
| 706 | Ga0207657_10061464 | |||
| 707 | Ga0207649_10003925 | |||
| 708 | Ga0207652_10040109 | |||
| 709 | Ga0207652_10113660 | |||
| 710 | Ga0207652_10121335 | |||
| 711 | Ga0207681_10002877 | |||
| 712 | Ga0207694_10118449 | |||
| 713 | Ga0207650_10003214 | |||
| 714 | Ga0207659_10005097 | |||
| 715 | Ga0207687_10006111 | |||
| 716 | Ga0207664_10016876 | |||
| 717 | Ga0207664_10020295 | |||
| 718 | Ga0207644_10036741 | |||
| 719 | Ga0207690_10005451 | |||
| 720 | Ga0207706_10001431 | |||
| 721 | Ga0207686_10205753 | |||
| 722 | Ga0207709_10011736 | |||
| 723 | Ga0207670_10041153 | |||
| 724 | Ga0207669_10035805 | |||
| 725 | Ga0207704_10008153 | |||
| 726 | Ga0207665_10002101 | |||
| 727 | Ga0207711_10107406 | |||
| 728 | Ga0207661_10037213 | |||
| 729 | Ga0207679_10140179 | |||
| 730 | Ga0207651_10004133 | |||
| 731 | Ga0207668_10186940 | |||
| 732 | Ga0207668_10187642 | |||
| 733 | Ga0207640_10043745 | |||
| 734 | Ga0207658_10007506 | |||
| 735 | Ga0207658_10095163 | |||
| 736 | Ga0207677_10271896 | |||
| 737 | Ga0207703_10207185 | |||
| 738 | Ga0207639_10022411 | |||
| 739 | Ga0207639_10124471 | |||
| 740 | Ga0207639_10256449 | |||
| 741 | Ga0207678_10002104 | |||
| 742 | Ga0207708_10001818 | |||
| 743 | Ga0207708_10210519 | |||
| 744 | Ga0207702_10008843 | |||
| 745 | Ga0207702_10144045 | |||
| 746 | Ga0207702_10253238 | |||
| 747 | Ga0207641_10326889 | |||
| 748 | Ga0207648_10011227 | |||
| 749 | Ga0207674_10004952 | |||
| 750 | Ga0207675_100000249 | |||
| 751 | Ga0207675_100076325 | |||
| 752 | Ga0207683_10001156 | |||
| 753 | Ga0207683_10058139 | |||
| 754 | Ga0207683_10211819 | |||
| 755 | Ga0207698_10010099 | |||
| 756 | Ga0268266_10023678 | |||
| 757 | Ga0268264_10005008 | |||
| 758 | Ga0307515_10056829 | |||
| 759 | Ga0265338_10088214 | |||
| 760 | Ga0265325_10002730 | |||
| 761 | Ga0265325_10009871 | |||
| 762 | Ga0307513_10058634 | |||
| 763 | Ga0265313_10017035 | |||
| 764 | Ga0316579_10115121 | |||
| 765 | Ga0265314_10135445 | |||
| 766 | Ga0265342_10014994 | |||
| 767 | Ga0373938_0005178 | |||
| 768 | Ga0373926_0000693 | |||
| 769 | Ga0373929_0015725 | |||
| 770 | Ga0373951_0024061 | |||
| 771 | Ga0373936_0002391 | |||
| 772 | Ga0373936_0033542 | |||
| 773 | Ga0373939_0006158 | |||
| 774 | Ga0373939_0042429 | |||
| 775 | Ga0373941_0008486 | |||
| 776 | Ga0373945_0005113 | |||
| 777 | Ga0373945_0008225 | |||
| 778 | Ga0373954_0002383 | |||
| 779 | Ga0373957_0010302 | |||
| 780 | Ga0373943_0000268 | |||
| 781 | Ga0373943_0036377 | |||
| 782 | Ga0373946_0034498 | |||
| 783 | Ga0373955_0000399 | |||
| 784 | Ga0373961_0005801 | |||
| 785 | Ga0373924_0001527 | |||
| 786 | Ga0373931_0004198 | |||
| 787 | Ga0373931_0026950 | |||
| 788 | Ga0373931_0044485 | |||
| 789 | Ga0373931_0051276 | |||
| 790 | Ga0373931_0146765 | |||
| 791 | Ga0373935_0000286 | |||
| 792 | Ga0373935_0026063 | |||
| 793 | Ga0373935_0032185 | |||
| 794 | Ga0373935_0159801 | |||
| 795 | Ga0373935_0274400 | |||
| 796 | Ga0373927_0001748 | |||
| 797 | Ga0373927_0005366 | |||
| 798 | Ga0373927_0036597 | |||
| 799 | Ga0373927_0040440 | |||
| 800 | Ga0373933_0005496 | |||
| 801 | Ga0373947_0001270 | |||
| 802 | Ga0373947_0007076 | |||
| 803 | Ga0373947_0007690 | |||
| 804 | Ga0373947_0010286 | |||
| 805 | Ga0373937_0000695 | |||
| 806 | Ga0373925_0000019 | |||
| 807 | Ga0373925_0012774 | |||
| 808 | Ga0373925_0028134 | |||
| 809 | Ga0395900_0005362 | |||
| 810 | Ga0395898_0008423 | |||
| 811 | Ga0395905_0002905 | |||
| 812 | Ga0395901_0063898 | |||
| 813 | Ga0436365_0734149 | |||
| 814 | Ga0436365_1795903 | |||
| 815 | Ga0451576_0203921 | |||
| 816 | Ga0466967_0025986 | |||
| 817 | Ga0495592_0000005 | |||
| 818 | Ga0495592_0167865 | |||
| 819 | Ga0495603_0000114 | |||
| 820 | Ga0495590_0001808 | |||
| 821 | Ga0495629_0000430 | |||
| 822 | Ga0495629_0037713 | |||
| 823 | Ga0495629_0067171 | |||
| 824 | Ga0495638_0000600 | |||
| 825 | Ga0495638_0017040 | |||
| 826 | Ga0495638_0141988 | |||
| 827 | Ga0495641_0006916 | |||
| 828 | Ga0495651_0014746 | |||
| 829 | Ga0495653_0000017 | |||
| 830 | Ga0495650_0067344 | |||
| 831 | Ga0495580_0000080 | |||
| 832 | Ga0495580_0101972 | |||
| 833 | Ga0495582_0002704 | |||
| 834 | Ga0495582_0044243 | |||
| 835 | Ga0495639_0002522 | |||
| 836 | Ga0495662_0000724 | |||
| 837 | Ga0495662_0019870 | |||
| 838 | Ga0495664_0000014 | |||
| 839 | Ga0495664_0001240 | |||
| 840 | Ga0495594_0005083 | |||
| 841 | Ga0495608_0000034 | |||
| 842 | Ga0495610_0065308 | |||
| 843 | Ga0495618_0000011 | |||
| 844 | Ga0495618_0000925 | |||
| 845 | Ga0495628_0000017 | |||
| 846 | Ga0495630_0000472 | |||
| 847 | Ga0495630_0296067 | |||
| 848 | Ga0495631_0003894 | |||
| 849 | Ga0495648_0001025 | |||
| 850 | Ga0495666_0042384 | |||
| 851 | Ga0495652_0000008 | |||
| 852 | Ga0495652_0073238 | |||
| 853 | Ga0495665_0016593 | |||
| 854 | Ga0495665_0106375 | |||
| 855 | Ga0495640_0000024 | |||
| 856 | Ga0495640_0000947 | |||
| 857 | Ga0495640_0014456 | |||
| 858 | Ga0495587_0000039 | |||
| 859 | Ga0495597_0009230 | |||
| 860 | Ga0495645_0000006 | |||
| 861 | Ga0495645_0031508 | |||
| 862 | Ga0495622_0005445 | |||
| 863 | Ga0495667_0000026 | |||
| 864 | Ga0495668_0000014 | |||
| 865 | Ga0495668_0006444 | |||
| 866 | Ga0495634_0000009 | |||
| 867 | Ga0495634_0000941 | |||
| 868 | Ga0495634_0010307 | |||
| 869 | Ga0495634_0011375 | |||
| 870 | Ga0495625_0018457 | |||
| 871 | Ga0495635_0000014 | |||
| 872 | Ga0495635_0004745 | |||
| 873 | Ga0495588_0007588 | |||
| 874 | Ga0495657_0000038 | |||
| 875 | Ga0495599_0000010 | |||
| 876 | Ga0495623_0000074 | |||
| 877 | Ga0495646_0000008 | |||
| 878 | Ga0495647_0001891 | |||
| 879 | Ga0495647_0023940 | |||
| 880 | Ga0495658_0002490 | |||
| 881 | Ga0495613_0000335 | |||
| 882 | Ga0495613_0022544 | |||
| 883 | Ga0495624_0001454 | |||
| 884 | Ga0495600_0000213 | |||
| 885 | Ga0495581_0038077 | |||
| 886 | Ga0495604_0000006 | |||
| 887 | Ga0495674_0000009 | |||
| 888 | Ga0495674_0000859 | |||
| 889 | Ga0495674_0034072 | |||
| 890 | Ga0495676_0023022 | |||
| 891 | Ga0495676_0144489 | |||
| 892 | Ga0495680_0008445 | |||
| 893 | Ga0495680_0014658 | |||
| 894 | Ga0495675_0000044 | |||
| 895 | Ga0495673_0000123 | |||
| 896 | Ga0495684_0000015 | |||
| 897 | Ga0495684_0001275 | |||
| 898 | Ga0495684_0002706 | |||
| 899 | Ga0495686_0003073 | |||
| 900 | Ga0495686_0082493 | |||
| 901 | Ga0495593_0000148 | |||
| 902 | Ga0495593_0000735 | |||
| 903 | Ga0495602_0000006 | |||
| 904 | Ga0495602_0114619 | |||
| 905 | Ga0495614_0001428 | |||
| 906 | Ga0496100_0013285 | |||
| 907 | Ga0496100_0079551 | |||
| 908 | Ga0496100_0148066 | |||
| 909 | Ga0496100_0243954 | |||
| 910 | Ga0496101_0016350 | |||
| 911 | Ga0496101_0041223 | |||
| 912 | Ga0496101_0052923 | |||
| 913 | Ga0496101_0090733 | |||
| 914 | Ga0496101_0208951 | |||
| 915 | Ga0496102_0069549 | |||
| 916 | Ga0496102_0265132 | |||
| 917 | Ga0496103_0006988 | |||
| 918 | Ga0496104_0001526 | |||
| 919 | Ga0496104_0007852 | |||
| 920 | Ga0496104_0007867 | |||
| 921 | Ga0496104_0062647 | |||
| 922 | Ga0496104_0131757 | |||
| 923 | Ga0496104_0147940 | |||
| 924 | Ga0496104_0225193 | |||
| 925 | Ga0496105_0059001 | |||
| 926 | Ga0496105_0066074 | |||
| 927 | Ga0496105_0102488 | |||
| 928 | Ga0496105_0173400 | |||
| 929 | Ga0496106_0002576 | |||
| 930 | Ga0496106_0011183 | |||
| 931 | Ga0496106_0029579 | |||
| 932 | Ga0496106_0319982 | |||
| 933 | Ga0496107_0019640 | |||
| 934 | Ga0496107_0125250 | |||
| 935 | Ga0496108_0030216 | |||
| 936 | Ga0496109_0014004 | |||
| 937 | Ga0496109_0028071 | |||
| 938 | Ga0496109_0034072 | |||
| 939 | Ga0496110_0002003 | |||
| 940 | Ga0496110_0018081 | |||
| 941 | Ga0496110_0113717 | |||
| 942 | Ga0496110_0158966 | |||
| 943 | Ga0496111_0010887 | |||
| 944 | Ga0496111_0046921 | |||
| 945 | Ga0496111_0089412 | |||
| 946 | Ga0496112_0010822 | |||
| 947 | Ga0496112_0023334 | |||
| 948 | Ga0496112_0111445 | |||
| 949 | Ga0496112_0256692 | |||
| 950 | Ga0496113_0032900 | |||
| 951 | Ga0496113_0203334 | |||
| 952 | Ga0496114_0002575 | |||
| 953 | Ga0496114_0011842 | |||
| 954 | Ga0496114_0297582 | |||
| 955 | Ga0496115_0099282 | |||
| 956 | Ga0496115_0124548 | |||
| 957 | Ga0496115_0161198 | |||
| 958 | Ga0496124_0044024 | |||
| 959 | Ga0496125_0095679 | |||
| 960 | Ga0496126_0001922 | |||
| 961 | Ga0495678_001696 | |||
| 962 | Ga0501032_0079600 | |||
| 963 | Ga0501033_0090109 | |||
| 964 | Ga0501036_0047191 | |||
| 965 | Ga0501037_0008867 | |||
| 966 | Ga0501037_0210518 | |||
| 967 | Ga0501037_0232490 | |||
| 968 | Ga0501038_0003209 | |||
| 969 | Ga0501039_0103952 | |||
| 970 | Ga0501039_0215836 | |||
| 971 | Ga0501040_0071969 | |||
| 972 | Ga0501040_0131431 | |||
| 973 | Ga0501041_0029860 | |||
| 974 | Ga0501041_0107165 | |||
| 975 | Ga0501042_0069038 | |||
| 976 | Ga0501042_0097217 | |||
| 977 | Ga0501046_0032243 | |||
| 978 | Ga0501046_0155634 | |||
| 979 | Ga0501048_0002278 | |||
| 980 | Ga0501048_0021998 | |||
| 981 | Ga0501067_0022653 | |||
| 982 | Ga0501068_0105728 | |||
| 983 | Ga0501069_0000984 | |||
| 984 | Ga0501071_0064982 | |||
| 985 | Ga0501072_0023012 | |||
| 986 | Ga0501072_0180470 | |||
| 987 | Ga0501073_0019108 | |||
| 988 | Ga0501075_0027298 | |||
| 989 | Ga0501075_0054133 | |||
| 990 | Ga0501075_0075616 | |||
| 991 | Ga0501076_0085755 | |||
| 992 | Ga0501076_0309565 | |||
| 993 | Ga0501080_0274117 | |||
| 994 | Ga0501081_0030821 | |||
| 995 | Ga0501035_0096414 | |||
| 996 | Ga0501044_0001015 | |||
| 997 | Ga0501044_0321162 | |||
| 998 | Ga0501045_0026056 | |||
| 999 | Ga0501045_0058478 | |||
| 1000 | Ga0501045_0163637 | |||
| 1001 | Ga0501045_0178669 | |||
| 1002 | nmdc:mga00v17_96769_c1 | |||
| 1003 | nmdc:mga09592_119911_c1 | |||
| 1004 | nmdc:mga0qj67_17268_c1 | |||
| 1005 | nmdc:mga0qj67_83_c1 | |||
| 1006 | nmdc:mga0qj67_86109_c1 | |||
| 1007 | nmdc:mga06r32_116322_c1 | |||
| 1008 | nmdc:mga06r32_188814_c1 | |||
| 1009 | nmdc:mga06r32_205795_c1 | |||
| 1010 | nmdc:mga06r32_46212_c1 | |||
| 1011 | nmdc:mga0n895_260272_c1 | |||
| 1012 | nmdc:mga0rr50_138535_c1 | |||
| 1013 | nmdc:mga08x19_214181_c1 | |||
| 1014 | nmdc:mga0sz30_8523_c1 | |||
| 1015 | Ga0495601_0000007 | |||
| 1016 | Ga0495601_0003709 | |||
| 1017 | Ga0495612_0000015 | |||
| 1018 | Ga0495612_0002398 | |||
| 1019 | Ga0495655_0000341 | |||
| 1020 | Ga0495595_0000023 | |||
| 1021 | Ga0495595_0102858 | |||
| 1022 | Ga0495619_0000017 | |||
| 1023 | Ga0495619_0001652 | |||
| 1024 | Ga0495619_0003502 | |||
| 1025 | Ga0495619_0041199 | |||
| 1026 | Ga0500578_0000005 | |||
| 1027 | Ga0500644_0000191 | |||
| 1028 | Ga0500646_0024943 | |||
| 1029 | Ga0500562_000175 | |||
| 1030 | Ga0500594_0000329 | |||
| 1031 | Ga0500608_000093 | |||
| 1032 | Ga0500652_000214 | |||
| 1033 | Ga0500652_041929 | |||
| 1034 | Ga0500559_0016342 | |||
| 1035 | Ga0500564_000070 | |||
| 1036 | Ga0500622_0002118 | |||
| 1037 | Ga0500622_0005697 | |||
| 1038 | Ga0500622_0016249 | |||
| 1039 | Ga0501084_0014003 | |||
| 1040 | Ga0501082_0000012 | |||
| 1041 | Ga0501082_0041351 | |||
| 1042 | Ga0501082_0051672 | |||
| 1043 | 2585149374 | |||
| 1044 | 2587919721 | |||
| 1045 | 2644226345 | |||
| 1046 | 2644235833 | |||
| 1047 | 2739348208 | |||
| 1048 | 2851155496 | |||
| 1049 | 2857506656 | |||
| 1050 | 2884963957 | |||
| 1051 | 2898330907 | |||
| 1052 | 2928533920 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tjx-assembly1.cif.gz_D | yeast atp synthase f1 region state 1binding(a-d) with 10 mm atp | 0.7718 | 88 | 152 |
| 6j5i-assembly1.cif.gz_E | cryo-em structure of the mammalian dp-state atp synthase | 0.7701 | 88 | 147 |
| 3oaa-assembly4.cif.gz_b | structure of the e.coli f1-atp synthase inhibited by subunit epsilon | 0.7563 | 88 | 153 |
| 4q4l-assembly1.cif.gz_A | crystal structure of an atp synthase subunit beta 1 (f1-b1) from burkholderia thailandensis | 0.7525 | 86 | 151 |
| 6re2-assembly1.cif.gz_X | cryo-em structure of polytomella f-atp synthase, rotary substate 2b, composite map | 0.7292 | 88 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vkyA01 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.9252 | 5 | 361 | 3.40.1780.10 |
| 1vkyA01 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.9164 | 5 | 361 | 3.40.1780.10 |
| af_P0A7F9_64_163_3.40.1780.10 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.8249 | 63 | 181 | 3.40.1780.10 |
| af_P0A7F9_64_163_3.40.1780.10 | Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like | 0.811 | 63 | 181 | 3.40.1780.10 |
| 1vkyA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like | 0.7801 | 63 | 155 | 2.40.10.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1A496-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9825 | 260 | 364 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A398DRM1-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9781 | 253 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A3D0QF68-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9685 | 244 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A660WTT4-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.968 | 185 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |
| AF-A0A7C1EK51-F1-model_v4 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | 0.9651 | 242 | 361 |
GO:0002099
GO:0005737 GO:0008616 GO:0051075 |